| Basic Information | |
|---|---|
| Family ID | F076278 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LFVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.07 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.153 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (9.322 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.610 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (70.339 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.48% β-sheet: 0.00% Coil/Unstructured: 95.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF00990 | GGDEF | 11.86 |
| PF08281 | Sigma70_r4_2 | 2.54 |
| PF10098 | DUF2336 | 1.69 |
| PF06532 | NrsF | 0.85 |
| PF00378 | ECH_1 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG4944 | Uncharacterized conserved protein | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.15 % |
| Unclassified | root | N/A | 0.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01B6PL3 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300001661|JGI12053J15887_10186215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1065 | Open in IMG/M |
| 3300001661|JGI12053J15887_10373220 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300002077|JGI24744J21845_10067316 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300003322|rootL2_10203735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1017 | Open in IMG/M |
| 3300003541|JGI20214J51650_10274890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1166 | Open in IMG/M |
| 3300003659|JGI25404J52841_10075349 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300004800|Ga0058861_11944522 | Not Available | 570 | Open in IMG/M |
| 3300005328|Ga0070676_10206796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1289 | Open in IMG/M |
| 3300005355|Ga0070671_100514307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1030 | Open in IMG/M |
| 3300005366|Ga0070659_101452105 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005367|Ga0070667_101739523 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005438|Ga0070701_10790001 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300005444|Ga0070694_101589924 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005455|Ga0070663_100306698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1272 | Open in IMG/M |
| 3300005455|Ga0070663_100319823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1247 | Open in IMG/M |
| 3300005519|Ga0077119_10008711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 10870 | Open in IMG/M |
| 3300005543|Ga0070672_100454526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1103 | Open in IMG/M |
| 3300005616|Ga0068852_101697967 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005718|Ga0068866_10943537 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005719|Ga0068861_100052427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3100 | Open in IMG/M |
| 3300005841|Ga0068863_100249185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1715 | Open in IMG/M |
| 3300005841|Ga0068863_101454070 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300006038|Ga0075365_10067190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2406 | Open in IMG/M |
| 3300006038|Ga0075365_10987106 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006042|Ga0075368_10071873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1398 | Open in IMG/M |
| 3300006047|Ga0075024_100212587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 911 | Open in IMG/M |
| 3300006048|Ga0075363_100703064 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006177|Ga0075362_10281632 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300006178|Ga0075367_10479659 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300006237|Ga0097621_100722057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 919 | Open in IMG/M |
| 3300006358|Ga0068871_101964169 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006358|Ga0068871_102217285 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006800|Ga0066660_10623897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 898 | Open in IMG/M |
| 3300007788|Ga0099795_10504457 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300009094|Ga0111539_11326419 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300009101|Ga0105247_10371175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1012 | Open in IMG/M |
| 3300009147|Ga0114129_10240548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2433 | Open in IMG/M |
| 3300009148|Ga0105243_10304257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1446 | Open in IMG/M |
| 3300009156|Ga0111538_11539413 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300009174|Ga0105241_10261695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1470 | Open in IMG/M |
| 3300009174|Ga0105241_11141535 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300009545|Ga0105237_11997789 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300009545|Ga0105237_12664285 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010040|Ga0126308_10305922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1046 | Open in IMG/M |
| 3300010045|Ga0126311_11080627 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300010364|Ga0134066_10015444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1618 | Open in IMG/M |
| 3300010371|Ga0134125_10519951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1318 | Open in IMG/M |
| 3300010403|Ga0134123_11935288 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012210|Ga0137378_10280177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1551 | Open in IMG/M |
| 3300012356|Ga0137371_10035730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 3837 | Open in IMG/M |
| 3300012469|Ga0150984_105212230 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300012924|Ga0137413_10441789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 945 | Open in IMG/M |
| 3300012924|Ga0137413_11652570 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012929|Ga0137404_10468809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1119 | Open in IMG/M |
| 3300012944|Ga0137410_10239821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1417 | Open in IMG/M |
| 3300012961|Ga0164302_10132896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1436 | Open in IMG/M |
| 3300012985|Ga0164308_10305961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1265 | Open in IMG/M |
| 3300012987|Ga0164307_11701006 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300013296|Ga0157374_10256272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1722 | Open in IMG/M |
| 3300013296|Ga0157374_11615333 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300013297|Ga0157378_11437505 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300013306|Ga0163162_10063695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3731 | Open in IMG/M |
| 3300014326|Ga0157380_10686529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1027 | Open in IMG/M |
| 3300015371|Ga0132258_13348664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1102 | Open in IMG/M |
| 3300015373|Ga0132257_102342089 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300015373|Ga0132257_103432348 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300015373|Ga0132257_103787989 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300015374|Ga0132255_104937543 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300015374|Ga0132255_105947453 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300017792|Ga0163161_10815602 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300018059|Ga0184615_10122454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1467 | Open in IMG/M |
| 3300018081|Ga0184625_10134572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1288 | Open in IMG/M |
| 3300018469|Ga0190270_10881497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 911 | Open in IMG/M |
| 3300018476|Ga0190274_12751819 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300018476|Ga0190274_13089531 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300019377|Ga0190264_10066507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1536 | Open in IMG/M |
| 3300019377|Ga0190264_12173058 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300020581|Ga0210399_11587465 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021403|Ga0210397_10299617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1180 | Open in IMG/M |
| 3300021479|Ga0210410_11616015 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300021510|Ga0222621_1072002 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300025315|Ga0207697_10293580 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300025900|Ga0207710_10056692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1768 | Open in IMG/M |
| 3300025907|Ga0207645_10218768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1255 | Open in IMG/M |
| 3300025912|Ga0207707_11484773 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300025923|Ga0207681_11605373 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300025924|Ga0207694_10299666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1323 | Open in IMG/M |
| 3300025931|Ga0207644_10434142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1077 | Open in IMG/M |
| 3300025931|Ga0207644_10809787 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300025932|Ga0207690_10437213 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300025945|Ga0207679_10355713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1278 | Open in IMG/M |
| 3300025960|Ga0207651_11764932 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300025961|Ga0207712_11658508 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300025972|Ga0207668_10704870 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300025972|Ga0207668_10810848 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300025972|Ga0207668_11689674 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300025986|Ga0207658_11356606 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300026088|Ga0207641_10774496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 948 | Open in IMG/M |
| 3300026089|Ga0207648_10357801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1317 | Open in IMG/M |
| 3300026116|Ga0207674_11634455 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300027257|Ga0208996_1019462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 916 | Open in IMG/M |
| 3300027866|Ga0209813_10064906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1174 | Open in IMG/M |
| 3300027880|Ga0209481_10561978 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300027915|Ga0209069_10555893 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300028379|Ga0268266_12120716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300028803|Ga0307281_10012382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2379 | Open in IMG/M |
| 3300031232|Ga0302323_103016696 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031562|Ga0310886_10602594 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300031616|Ga0307508_10419750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 929 | Open in IMG/M |
| 3300031730|Ga0307516_10856044 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031731|Ga0307405_10153468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1622 | Open in IMG/M |
| 3300031852|Ga0307410_10476741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1023 | Open in IMG/M |
| 3300031911|Ga0307412_10742825 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300032075|Ga0310890_10691718 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300032205|Ga0307472_101837451 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300032897|Ga0335071_11790920 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300034156|Ga0370502_0061170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1189 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 9.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.93% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 5.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.08% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.39% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.69% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.69% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.85% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.85% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.85% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root | 0.85% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005519 | Combined assembly of arab plate scrape CL_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027257 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300034156 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_06805550 | 2170459005 | Grass Soil | VFRDLFIPYEPKPETEHPDMVPSVKHLHGEPVALGDPSDQNFV |
| JGI12053J15887_101862151 | 3300001661 | Forest Soil | EPKPETEHPDMVPSVQHLHGEPVALSDPSDQNFV* |
| JGI12053J15887_103732201 | 3300001661 | Forest Soil | NLADEVFRNLFVPNEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| JGI24744J21845_100673161 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | LANEVFRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| rootL2_102037351 | 3300003322 | Sugarcane Root And Bulk Soil | LADEIFRDLFIPYEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV* |
| JGI20214J51650_102748901 | 3300003541 | Wetland | DEVFRNLFVPNEPKPETEHPDMVPSVQHLHGKPVALSDPSDQNFV* |
| JGI25404J52841_100753492 | 3300003659 | Tabebuia Heterophylla Rhizosphere | ADEVFRDLFIPYEPKPETEHPDMVPSVEHLHGEPVALSDPSDQNLV* |
| Ga0058861_119445222 | 3300004800 | Host-Associated | MPYVENLTDEVFGDVIVADEPKPETKHSDMVASVQHLHGGPVALSD |
| Ga0070676_102067961 | 3300005328 | Miscanthus Rhizosphere | FRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0070671_1005143071 | 3300005355 | Switchgrass Rhizosphere | LFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPRDQNFV* |
| Ga0070659_1014521051 | 3300005366 | Corn Rhizosphere | DLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0070667_1017395231 | 3300005367 | Switchgrass Rhizosphere | RNLFVPNEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV* |
| Ga0070701_107900011 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | NLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0070694_1015899241 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0070663_1003066981 | 3300005455 | Corn Rhizosphere | LFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0070663_1003198232 | 3300005455 | Corn Rhizosphere | RNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0077119_1000871112 | 3300005519 | Arabidopsis Root | RHLFVPHEPEPETEHPDMVPSVQHLHGEPVALSDPGDQDFV* |
| Ga0070672_1004545261 | 3300005543 | Miscanthus Rhizosphere | PYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0068852_1016979671 | 3300005616 | Corn Rhizosphere | EPKPETKHPDMVPPVQHLHSEAVALSDPSDQNLV* |
| Ga0068866_109435371 | 3300005718 | Miscanthus Rhizosphere | DLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0068861_1000524271 | 3300005719 | Switchgrass Rhizosphere | EPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0068863_1002491851 | 3300005841 | Switchgrass Rhizosphere | YEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0068863_1014540701 | 3300005841 | Switchgrass Rhizosphere | EPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFI* |
| Ga0075365_100671901 | 3300006038 | Populus Endosphere | EIFRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0075365_109871061 | 3300006038 | Populus Endosphere | LVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV* |
| Ga0075368_100718732 | 3300006042 | Populus Endosphere | PYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV* |
| Ga0075024_1002125871 | 3300006047 | Watersheds | EPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV* |
| Ga0075363_1007030641 | 3300006048 | Populus Endosphere | FRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0075362_102816322 | 3300006177 | Populus Endosphere | FIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV* |
| Ga0075367_104796592 | 3300006178 | Populus Endosphere | FRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV* |
| Ga0097621_1007220571 | 3300006237 | Miscanthus Rhizosphere | VPNEPKPEAEHPDMVPSVQHLHGKPVALSDPSDQNFI* |
| Ga0068871_1019641691 | 3300006358 | Miscanthus Rhizosphere | LFVPNEPKPEAEHPDMVPSVQHLHGKPVALSDPSDQNFV* |
| Ga0068871_1022172851 | 3300006358 | Miscanthus Rhizosphere | VFRNLFVPHEPKPEAEHPDMVPSVKHLHGEPVALGDTSDQSFV* |
| Ga0066660_106238973 | 3300006800 | Soil | LFIPYEPKPETEHPDMVPSVKYLHGEPVALSDPSDQNFV* |
| Ga0099795_105044571 | 3300007788 | Vadose Zone Soil | DEVFCNLFVPHEPKPETKHPDMVPSVQHLHGEAVALSDPSDQNFV* |
| Ga0111539_113264192 | 3300009094 | Populus Rhizosphere | EVFCDLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0105247_103711752 | 3300009101 | Switchgrass Rhizosphere | VFRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0114129_102405481 | 3300009147 | Populus Rhizosphere | NLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0105243_103042571 | 3300009148 | Miscanthus Rhizosphere | EPKPETKHPDMVPSVQHLHGEPVALSDPSDQNFV* |
| Ga0111538_115394132 | 3300009156 | Populus Rhizosphere | VPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0105241_102616951 | 3300009174 | Corn Rhizosphere | KNLTDEVFRNLLVTYEPEPETEHPDMVPSVKHLHGEPVAFSDPSDQNFV* |
| Ga0105241_111415352 | 3300009174 | Corn Rhizosphere | FIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0105237_119977892 | 3300009545 | Corn Rhizosphere | FRDLLISYEPKPETKHPDMVPPVQHLHSEAVALSDPSDQNLV* |
| Ga0105237_126642851 | 3300009545 | Corn Rhizosphere | EKNLADEVFRNLFVPNEPKPEAEHPDMVPSVQHLHGKPVALSDPSDQNFI* |
| Ga0126308_103059221 | 3300010040 | Serpentine Soil | NLADEIFRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0126311_110806271 | 3300010045 | Serpentine Soil | EPQPETINPYMVPPIQHLHGEPVALGDPRDQDFV* |
| Ga0134066_100154442 | 3300010364 | Grasslands Soil | DEVFRNLFIPYEPKPETEHPDMVPSVKHLHGESVALSDPSDQNFV* |
| Ga0134125_105199511 | 3300010371 | Terrestrial Soil | KVFRNLFVPHEPKPEAEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0134123_119352882 | 3300010403 | Terrestrial Soil | FSDLFVSHEPEPEAKHPDMMSSVQHLHGEPVALSDPSDQNFV* |
| Ga0137378_102801772 | 3300012210 | Vadose Zone Soil | ESKPEAKHPDMVPSVQHLHGEAVALGDSSDQNLV* |
| Ga0137371_100357301 | 3300012356 | Vadose Zone Soil | EKNLADEVFRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0150984_1052122301 | 3300012469 | Avena Fatua Rhizosphere | IPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0137413_104417891 | 3300012924 | Vadose Zone Soil | DLFVPHEPQPETEHPDMVPSVQHLHGEAVALGDPSDQNFV* |
| Ga0137413_116525701 | 3300012924 | Vadose Zone Soil | NLADEVFRNLFVPYESKPETEHPDMVPSIQHLHGEPVALSDPSDQNFV* |
| Ga0137404_104688091 | 3300012929 | Vadose Zone Soil | RNLLVPDEPKPETEHPDMVPSVKYLHGEPVALSDPSDQNLV* |
| Ga0137410_102398211 | 3300012944 | Vadose Zone Soil | EPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV* |
| Ga0164302_101328961 | 3300012961 | Soil | LFVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0164308_103059612 | 3300012985 | Soil | PYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNVV* |
| Ga0164307_117010061 | 3300012987 | Soil | EPKPETEHPDMVPSVKHLHGDPVALSDPSDQNFV* |
| Ga0157374_102562721 | 3300013296 | Miscanthus Rhizosphere | LADEVFRNLFVPYESKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0157374_116153331 | 3300013296 | Miscanthus Rhizosphere | EVLRHLFVPHEPKPEAVHPDMMPSVQHLHGEPVALSDPSDQNLV* |
| Ga0157378_114375051 | 3300013297 | Miscanthus Rhizosphere | NLGDEIFRNLLVPHEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0163162_100636955 | 3300013306 | Switchgrass Rhizosphere | LVPHEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0157380_106865292 | 3300014326 | Switchgrass Rhizosphere | PHEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0132258_133486641 | 3300015371 | Arabidopsis Rhizosphere | EKNLADEIFRDLLVPYEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV* |
| Ga0132257_1023420891 | 3300015373 | Arabidopsis Rhizosphere | ADEVFRDLFVPYEPKPDTEHPDMVPSVKHLHGEPVALSDPSDQNFV* |
| Ga0132257_1034323481 | 3300015373 | Arabidopsis Rhizosphere | DFADEVFRNLFVPYEPEPETEHPDMVPSVKHLHGEPVALSDPGDQNFI* |
| Ga0132257_1037879891 | 3300015373 | Arabidopsis Rhizosphere | HEPKPEAEHPDMVPSVKHLHGEPVALGDTSDQSFV* |
| Ga0132255_1049375431 | 3300015374 | Arabidopsis Rhizosphere | EVLCRLLVPHEPKPEAVHPDMMPSVQDLHGEPVALRDPSDQNLV* |
| Ga0132255_1059474531 | 3300015374 | Arabidopsis Rhizosphere | DEIFRGLFVPNEPKPEAKHPDMVPSVQHLHGEPVALSDPSDQNFV* |
| Ga0163161_108156021 | 3300017792 | Switchgrass Rhizosphere | RNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0184615_101224542 | 3300018059 | Groundwater Sediment | RNLFIPNEPEPETEHPDMVPSVQHLHGEPVALSDPSDQNFV |
| Ga0184625_101345721 | 3300018081 | Groundwater Sediment | LADEIFRNLLVPYEPKPETEHPDMVPSVKHLHGESVALSDPSDQNFV |
| Ga0190270_108814972 | 3300018469 | Soil | PYEPKPETEHPDMVPSVKHLHGEPVALSDPGDQNVI |
| Ga0190274_127518191 | 3300018476 | Soil | LADEVFRNLFVPDEPKPETEHPDMVPSVQHLHGEPVALSDPGDQNFV |
| Ga0190274_130895311 | 3300018476 | Soil | LADEVFRNLFVPDEPKPETEHPDMVPSVQHLHGEPVALSDPSDQSFV |
| Ga0190264_100665071 | 3300019377 | Soil | LFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0190264_121730581 | 3300019377 | Soil | PYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0210399_115874652 | 3300020581 | Soil | NLADEVFRNLLVSHDPKPKAKHPDMVPSVQHLHGEAVALSDPGDQNFV |
| Ga0210397_102996171 | 3300021403 | Soil | LVPHEPKPETKHPDVVPSVQHLHGEPVALSDPADQDFVRCGCSAQ |
| Ga0210410_116160151 | 3300021479 | Soil | LVPHEPEPETEHPDMVPSIQHLHGEPVALSDPSDQNLI |
| Ga0222621_10720021 | 3300021510 | Groundwater Sediment | FIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0207697_102935802 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | LADKVFRNLFVPHEPKPEAEHPDMVPSVKHLHGEPVALGDTSDQSFV |
| Ga0207710_100566922 | 3300025900 | Switchgrass Rhizosphere | LADEVFRNLFVPNEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV |
| Ga0207645_102187682 | 3300025907 | Miscanthus Rhizosphere | IPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0207707_114847731 | 3300025912 | Corn Rhizosphere | NLFVPYESKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0207681_116053731 | 3300025923 | Switchgrass Rhizosphere | YEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0207694_102996662 | 3300025924 | Corn Rhizosphere | FRNLLVPYEPEPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0207644_104341422 | 3300025931 | Switchgrass Rhizosphere | VFCDLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPRDQNFV |
| Ga0207644_108097872 | 3300025931 | Switchgrass Rhizosphere | PHEPKPEAEHPDMVPSVKHLHGEPVALGDTSDQSFV |
| Ga0207690_104372131 | 3300025932 | Corn Rhizosphere | LRDLLVPHEPKPETKHPDVVPSVQHLHGEPVALSDPADQDFV |
| Ga0207679_103557131 | 3300025945 | Corn Rhizosphere | DEVFCDLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0207651_117649321 | 3300025960 | Switchgrass Rhizosphere | GDEIFRNLLVPHEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0207712_116585081 | 3300025961 | Switchgrass Rhizosphere | LFIPYEPKPETENPDMVPAVKHLHGEPVALSDPSDQNFV |
| Ga0207668_107048701 | 3300025972 | Switchgrass Rhizosphere | SEKNLADEIFRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0207668_108108481 | 3300025972 | Switchgrass Rhizosphere | FVPDEPKPETEHPDMVPSVQHLHGEPVALSDPSDQNFV |
| Ga0207668_116896741 | 3300025972 | Switchgrass Rhizosphere | LVPHEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0207658_113566061 | 3300025986 | Switchgrass Rhizosphere | RNLFVPNEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV |
| Ga0207641_107744961 | 3300026088 | Switchgrass Rhizosphere | NLFVPHEPKPETEHPDMVPSVQHLHGEPVALSDPSDQNFV |
| Ga0207648_103578012 | 3300026089 | Miscanthus Rhizosphere | HEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0207674_116344551 | 3300026116 | Corn Rhizosphere | PDEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0208996_10194621 | 3300027257 | Forest Soil | RNLFVPDEPKPEAEHPDMAPSVQHLHGEPVALSDPSDQNVV |
| Ga0209813_100649061 | 3300027866 | Populus Endosphere | EKDFADEVFRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV |
| Ga0209481_105619781 | 3300027880 | Populus Rhizosphere | EVFRNLFVPYEPEPETEHPDMMPSVQHLHGEPVALSDPSDQNFV |
| Ga0209069_105558932 | 3300027915 | Watersheds | PYEPKPETEHPDMVPSVEHLHGEPVALSDPRDQNLV |
| Ga0268266_121207161 | 3300028379 | Switchgrass Rhizosphere | LRDLLVPHEPQPETINPYMVPPIQHLHGEPVALGDPGNQDFV |
| Ga0307281_100123821 | 3300028803 | Soil | DEVFSNLFIPYEPKPETEHPDMMPSVKHLHGEPVALSDPSDQNFV |
| Ga0302323_1030166961 | 3300031232 | Fen | LVPNEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV |
| Ga0310886_106025941 | 3300031562 | Soil | EVFRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0307508_104197501 | 3300031616 | Ectomycorrhiza | PDEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV |
| Ga0307516_108560442 | 3300031730 | Ectomycorrhiza | IEKNLADEVFRNLFVPDEPKPETEHPDMVPSVQHLHGEPVALSDPSDQNFV |
| Ga0307405_101534682 | 3300031731 | Rhizosphere | EIFRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0307410_104767411 | 3300031852 | Rhizosphere | EVLRDLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFI |
| Ga0307412_107428251 | 3300031911 | Rhizosphere | IEKHFADEVFRNLFVPYEPKPETEHPDMVPSVEHLHGEPVALSDPSDQNFV |
| Ga0310890_106917182 | 3300032075 | Soil | ADEVFRDLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| Ga0307472_1018374511 | 3300032205 | Hardwood Forest Soil | HEPEPETEHPDMVPSIQHLHGEPVALSDPSDQNLV |
| Ga0335071_117909201 | 3300032897 | Soil | HEPEPETVHPDMVPSIQHLHGEPVALSDPGDQGFIRCRLCHAQ |
| Ga0370502_0061170_1082_1189 | 3300034156 | Untreated Peat Soil | DEPKPEAEHPDMVPSVKHLHGEPVALSDPSDQNFV |
| ⦗Top⦘ |