Metagenome / Metatranscriptome Family F076278

Overview

Basic Information

• Family ID: F076278
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 118
• Average Sequence Length: 41 residues
• Representative Sequence: LFVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
• Number of Associated Samples: 101
• Number of Associated Scaffolds: 118

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 0.00 %
• % of genes near scaffold ends (potentially truncated): 100.00 %
• % of genes from short scaffolds (< 2000 bps): 94.07 %
• Associated GOLD sequencing projects: 91
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (99.153 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (9.322 % of family members)
• Environment Ontology (ENVO): Unclassified (46.610 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (70.339 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 4.48%
  β-sheet: 0.00%
  Coil/Unstructured: 95.52%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 118 Family Scaffolds
PF00990	GGDEF	11.86
PF08281	Sigma70_r4_2	2.54
PF10098	DUF2336	1.69
PF06532	NrsF	0.85
PF00378	ECH_1	0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 118 Family Scaffolds
COG4944	Uncharacterized conserved protein	Function unknown [S]	0.85

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	99.15 %
Unclassified	root	N/A	0.85 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	99.15 %
Unclassified	root	N/A	0.85 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	99.15 %
Unclassified	root	N/A	0.85 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	44.92 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.85 %
Unclassified	root	N/A	0.85 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	44.92 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.85 %
Unclassified	root	N/A	0.85 %

Level 6

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	33.90 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.85 %
Unclassified	root	N/A	0.85 %

Level 7

Name	Rank	Taxonomy	Distribution
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	33.90 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.85 %
Unclassified	root	N/A	0.85 %

Level 8

Name	Rank	Taxonomy	Distribution
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	33.90 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.85 %
Unclassified	root	N/A	0.85 %

Level 9

Name	Rank	Taxonomy	Distribution
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	2.54 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.85 %
Unclassified	root	N/A	0.85 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2170459005|F1BAP7Q01B6PL3	All Organisms → cellular organisms → Bacteria	506
3300001661|JGI12053J15887_10186215	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1065
3300001661|JGI12053J15887_10373220	All Organisms → cellular organisms → Bacteria	688
3300002077|JGI24744J21845_10067316	All Organisms → cellular organisms → Bacteria	654
3300003322|rootL2_10203735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1017
3300003541|JGI20214J51650_10274890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1166
3300003659|JGI25404J52841_10075349	All Organisms → cellular organisms → Bacteria	705
3300004800|Ga0058861_11944522	Not Available	570
3300005328|Ga0070676_10206796	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1289
3300005355|Ga0070671_100514307	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1030
3300005366|Ga0070659_101452105	All Organisms → cellular organisms → Bacteria	610
3300005367|Ga0070667_101739523	All Organisms → cellular organisms → Bacteria	587
3300005438|Ga0070701_10790001	All Organisms → cellular organisms → Bacteria	646
3300005444|Ga0070694_101589924	All Organisms → cellular organisms → Bacteria	554
3300005455|Ga0070663_100306698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1272
3300005455|Ga0070663_100319823	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1247
3300005519|Ga0077119_10008711	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	10870
3300005543|Ga0070672_100454526	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1103
3300005616|Ga0068852_101697967	All Organisms → cellular organisms → Bacteria	654
3300005718|Ga0068866_10943537	All Organisms → cellular organisms → Bacteria	609
3300005719|Ga0068861_100052427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3100
3300005841|Ga0068863_100249185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1715
3300005841|Ga0068863_101454070	All Organisms → cellular organisms → Bacteria	693
3300006038|Ga0075365_10067190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	2406
3300006038|Ga0075365_10987106	All Organisms → cellular organisms → Bacteria	593
3300006042|Ga0075368_10071873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1398
3300006047|Ga0075024_100212587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	911
3300006048|Ga0075363_100703064	All Organisms → cellular organisms → Bacteria	610
3300006177|Ga0075362_10281632	All Organisms → cellular organisms → Bacteria	822
3300006178|Ga0075367_10479659	All Organisms → cellular organisms → Bacteria	788
3300006237|Ga0097621_100722057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	919
3300006358|Ga0068871_101964169	All Organisms → cellular organisms → Bacteria	557
3300006358|Ga0068871_102217285	All Organisms → cellular organisms → Bacteria	523
3300006800|Ga0066660_10623897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	898
3300007788|Ga0099795_10504457	All Organisms → cellular organisms → Bacteria	564
3300009094|Ga0111539_11326419	All Organisms → cellular organisms → Bacteria	835
3300009101|Ga0105247_10371175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1012
3300009147|Ga0114129_10240548	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	2433
3300009148|Ga0105243_10304257	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1446
3300009156|Ga0111538_11539413	All Organisms → cellular organisms → Bacteria	838
3300009174|Ga0105241_10261695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1470
3300009174|Ga0105241_11141535	All Organisms → cellular organisms → Bacteria	735
3300009545|Ga0105237_11997789	All Organisms → cellular organisms → Bacteria	588
3300009545|Ga0105237_12664285	All Organisms → cellular organisms → Bacteria	511
3300010040|Ga0126308_10305922	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1046
3300010045|Ga0126311_11080627	All Organisms → cellular organisms → Bacteria	659
3300010364|Ga0134066_10015444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1618
3300010371|Ga0134125_10519951	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1318
3300010403|Ga0134123_11935288	All Organisms → cellular organisms → Bacteria	646
3300012210|Ga0137378_10280177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1551
3300012356|Ga0137371_10035730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	3837
3300012469|Ga0150984_105212230	All Organisms → cellular organisms → Bacteria	850
3300012924|Ga0137413_10441789	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	945
3300012924|Ga0137413_11652570	All Organisms → cellular organisms → Bacteria	525
3300012929|Ga0137404_10468809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1119
3300012944|Ga0137410_10239821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1417
3300012961|Ga0164302_10132896	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1436
3300012985|Ga0164308_10305961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1265
3300012987|Ga0164307_11701006	All Organisms → cellular organisms → Bacteria	534
3300013296|Ga0157374_10256272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1722
3300013296|Ga0157374_11615333	All Organisms → cellular organisms → Bacteria	672
3300013297|Ga0157378_11437505	All Organisms → cellular organisms → Bacteria	733
3300013306|Ga0163162_10063695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	3731
3300014326|Ga0157380_10686529	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1027
3300015371|Ga0132258_13348664	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1102
3300015373|Ga0132257_102342089	All Organisms → cellular organisms → Bacteria	692
3300015373|Ga0132257_103432348	All Organisms → cellular organisms → Bacteria	577
3300015373|Ga0132257_103787989	All Organisms → cellular organisms → Bacteria	550
3300015374|Ga0132255_104937543	All Organisms → cellular organisms → Bacteria	565
3300015374|Ga0132255_105947453	All Organisms → cellular organisms → Bacteria	516
3300017792|Ga0163161_10815602	All Organisms → cellular organisms → Bacteria	785
3300018059|Ga0184615_10122454	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1467
3300018081|Ga0184625_10134572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1288
3300018469|Ga0190270_10881497	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	911
3300018476|Ga0190274_12751819	All Organisms → cellular organisms → Bacteria	588
3300018476|Ga0190274_13089531	All Organisms → cellular organisms → Bacteria	559
3300019377|Ga0190264_10066507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1536
3300019377|Ga0190264_12173058	All Organisms → cellular organisms → Bacteria	516
3300020581|Ga0210399_11587465	All Organisms → cellular organisms → Bacteria	505
3300021403|Ga0210397_10299617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1180
3300021479|Ga0210410_11616015	All Organisms → cellular organisms → Bacteria	541
3300021510|Ga0222621_1072002	All Organisms → cellular organisms → Bacteria	729
3300025315|Ga0207697_10293580	All Organisms → cellular organisms → Bacteria	721
3300025900|Ga0207710_10056692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1768
3300025907|Ga0207645_10218768	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1255
3300025912|Ga0207707_11484773	All Organisms → cellular organisms → Bacteria	538
3300025923|Ga0207681_11605373	All Organisms → cellular organisms → Bacteria	544
3300025924|Ga0207694_10299666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1323
3300025931|Ga0207644_10434142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1077
3300025931|Ga0207644_10809787	All Organisms → cellular organisms → Bacteria	783
3300025932|Ga0207690_10437213	All Organisms → cellular organisms → Bacteria	1049
3300025945|Ga0207679_10355713	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1278
3300025960|Ga0207651_11764932	All Organisms → cellular organisms → Bacteria	557
3300025961|Ga0207712_11658508	All Organisms → cellular organisms → Bacteria	573
3300025972|Ga0207668_10704870	All Organisms → cellular organisms → Bacteria	887
3300025972|Ga0207668_10810848	All Organisms → cellular organisms → Bacteria	829
3300025972|Ga0207668_11689674	All Organisms → cellular organisms → Bacteria	571
3300025986|Ga0207658_11356606	All Organisms → cellular organisms → Bacteria	650
3300026088|Ga0207641_10774496	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	948
3300026089|Ga0207648_10357801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1317
3300026116|Ga0207674_11634455	All Organisms → cellular organisms → Bacteria	613
3300027257|Ga0208996_1019462	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	916
3300027866|Ga0209813_10064906	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1174
3300027880|Ga0209481_10561978	All Organisms → cellular organisms → Bacteria	591
3300027915|Ga0209069_10555893	All Organisms → cellular organisms → Bacteria	655
3300028379|Ga0268266_12120716	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	535
3300028803|Ga0307281_10012382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2379
3300031232|Ga0302323_103016696	All Organisms → cellular organisms → Bacteria	537
3300031562|Ga0310886_10602594	All Organisms → cellular organisms → Bacteria	675
3300031616|Ga0307508_10419750	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	929
3300031730|Ga0307516_10856044	All Organisms → cellular organisms → Bacteria	573
3300031731|Ga0307405_10153468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1622
3300031852|Ga0307410_10476741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1023
3300031911|Ga0307412_10742825	All Organisms → cellular organisms → Bacteria	846
3300032075|Ga0310890_10691718	All Organisms → cellular organisms → Bacteria	798
3300032205|Ga0307472_101837451	All Organisms → cellular organisms → Bacteria	603
3300032897|Ga0335071_11790920	All Organisms → cellular organisms → Bacteria	558
3300034156|Ga0370502_0061170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1189

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	62.71%
Environmental	Environmental	37.29%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	61.86%
Terrestrial	Environmental → Terrestrial	32.20%
Aquatic	Environmental → Aquatic	5.08%
Human	Host-Associated → Human	0.85%

Category

Habitat	Taxonomy	Distribution
Rhizosphere	Host-Associated → Plants → Rhizosphere	33.90%
Soil	Environmental → Terrestrial → Soil	31.36%
Rhizoplane	Host-Associated → Plants → Rhizoplane	16.10%
Roots	Host-Associated → Plants → Roots	11.02%
Sediment	Environmental → Aquatic → Sediment	4.24%
Marine	Environmental → Aquatic → Marine	0.85%
Peat	Environmental → Terrestrial → Peat	0.85%
Digestive System	Host-Associated → Human → Digestive System	0.85%
Rhizome	Host-Associated → Plants → Rhizome	0.85%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	24.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	16.95%
Soil	Host-Associated → Plants → Rhizosphere → Soil	16.95%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.02%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	5.93%
Loam	Environmental → Terrestrial → Soil → Loam	5.08%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	5.08%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.24%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.54%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.69%
Unclassified	Host-Associated → Plants → Roots → Unclassified	1.69%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.85%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.85%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.85%
Epiphytes	Host-Associated → Plants → Roots → Epiphytes	0.85%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified	0.85%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.80%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	16.95%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	16.95%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.02%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	5.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	5.08%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.24%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.39%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.54%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.54%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.54%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.69%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.69%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.69%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	1.69%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.85%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.85%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.85%
Unclassified	Host-Associated → Plants → Roots → Epiphytes → Unclassified	0.85%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified → Unclassified	0.85%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	9.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.63%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.93%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	5.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	5.08%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.24%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.24%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.39%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.39%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.54%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	2.54%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.54%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.54%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.69%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.69%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.69%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.69%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.69%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.69%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.69%
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	1.69%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.85%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.85%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.85%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.85%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.85%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.85%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.85%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.85%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.85%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.85%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.85%
Arabidopsis Root	Host-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root	0.85%
Sugarcane Root And Bulk Soil	Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil	0.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.85%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2170459005	Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm	Environmental
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental
3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Host-Associated
3300003322	Sugarcane root Sample L2	Host-Associated
3300003541	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk	Environmental
3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Host-Associated
3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Host-Associated
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated
3300005519	Combined assembly of arab plate scrape CL_Col (Combined Assembly)	Host-Associated
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300006038	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Host-Associated
3300006042	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Host-Associated
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental
3300006048	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Host-Associated
3300006177	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Host-Associated
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300018059	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex	Environmental
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental
3300021479	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M	Environmental
3300021510	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex	Environmental
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated
3300027257	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes)	Environmental
3300027866	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)	Host-Associated
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated
3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Host-Associated
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300032897	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5	Environmental
3300034156	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E41_06805550	2170459005	Grass Soil	VFRDLFIPYEPKPETEHPDMVPSVKHLHGEPVALGDPSDQNFV
JGI12053J15887_101862151	3300001661	Forest Soil	EPKPETEHPDMVPSVQHLHGEPVALSDPSDQNFV*
JGI12053J15887_103732201	3300001661	Forest Soil	NLADEVFRNLFVPNEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
JGI24744J21845_100673161	3300002077	Corn, Switchgrass And Miscanthus Rhizosphere	LANEVFRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
rootL2_102037351	3300003322	Sugarcane Root And Bulk Soil	LADEIFRDLFIPYEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV*
JGI20214J51650_102748901	3300003541	Wetland	DEVFRNLFVPNEPKPETEHPDMVPSVQHLHGKPVALSDPSDQNFV*
JGI25404J52841_100753492	3300003659	Tabebuia Heterophylla Rhizosphere	ADEVFRDLFIPYEPKPETEHPDMVPSVEHLHGEPVALSDPSDQNLV*
Ga0058861_119445222	3300004800	Host-Associated	MPYVENLTDEVFGDVIVADEPKPETKHSDMVASVQHLHGGPVALSD
Ga0070676_102067961	3300005328	Miscanthus Rhizosphere	FRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0070671_1005143071	3300005355	Switchgrass Rhizosphere	LFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPRDQNFV*
Ga0070659_1014521051	3300005366	Corn Rhizosphere	DLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0070667_1017395231	3300005367	Switchgrass Rhizosphere	RNLFVPNEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV*
Ga0070701_107900011	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	NLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0070694_1015899241	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	LLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0070663_1003066981	3300005455	Corn Rhizosphere	LFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0070663_1003198232	3300005455	Corn Rhizosphere	RNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0077119_1000871112	3300005519	Arabidopsis Root	RHLFVPHEPEPETEHPDMVPSVQHLHGEPVALSDPGDQDFV*
Ga0070672_1004545261	3300005543	Miscanthus Rhizosphere	PYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0068852_1016979671	3300005616	Corn Rhizosphere	EPKPETKHPDMVPPVQHLHSEAVALSDPSDQNLV*
Ga0068866_109435371	3300005718	Miscanthus Rhizosphere	DLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0068861_1000524271	3300005719	Switchgrass Rhizosphere	EPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0068863_1002491851	3300005841	Switchgrass Rhizosphere	YEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0068863_1014540701	3300005841	Switchgrass Rhizosphere	EPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFI*
Ga0075365_100671901	3300006038	Populus Endosphere	EIFRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0075365_109871061	3300006038	Populus Endosphere	LVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV*
Ga0075368_100718732	3300006042	Populus Endosphere	PYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV*
Ga0075024_1002125871	3300006047	Watersheds	EPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV*
Ga0075363_1007030641	3300006048	Populus Endosphere	FRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0075362_102816322	3300006177	Populus Endosphere	FIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV*
Ga0075367_104796592	3300006178	Populus Endosphere	FRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV*
Ga0097621_1007220571	3300006237	Miscanthus Rhizosphere	VPNEPKPEAEHPDMVPSVQHLHGKPVALSDPSDQNFI*
Ga0068871_1019641691	3300006358	Miscanthus Rhizosphere	LFVPNEPKPEAEHPDMVPSVQHLHGKPVALSDPSDQNFV*
Ga0068871_1022172851	3300006358	Miscanthus Rhizosphere	VFRNLFVPHEPKPEAEHPDMVPSVKHLHGEPVALGDTSDQSFV*
Ga0066660_106238973	3300006800	Soil	LFIPYEPKPETEHPDMVPSVKYLHGEPVALSDPSDQNFV*
Ga0099795_105044571	3300007788	Vadose Zone Soil	DEVFCNLFVPHEPKPETKHPDMVPSVQHLHGEAVALSDPSDQNFV*
Ga0111539_113264192	3300009094	Populus Rhizosphere	EVFCDLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0105247_103711752	3300009101	Switchgrass Rhizosphere	VFRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0114129_102405481	3300009147	Populus Rhizosphere	NLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0105243_103042571	3300009148	Miscanthus Rhizosphere	EPKPETKHPDMVPSVQHLHGEPVALSDPSDQNFV*
Ga0111538_115394132	3300009156	Populus Rhizosphere	VPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0105241_102616951	3300009174	Corn Rhizosphere	KNLTDEVFRNLLVTYEPEPETEHPDMVPSVKHLHGEPVAFSDPSDQNFV*
Ga0105241_111415352	3300009174	Corn Rhizosphere	FIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0105237_119977892	3300009545	Corn Rhizosphere	FRDLLISYEPKPETKHPDMVPPVQHLHSEAVALSDPSDQNLV*
Ga0105237_126642851	3300009545	Corn Rhizosphere	EKNLADEVFRNLFVPNEPKPEAEHPDMVPSVQHLHGKPVALSDPSDQNFI*
Ga0126308_103059221	3300010040	Serpentine Soil	NLADEIFRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0126311_110806271	3300010045	Serpentine Soil	EPQPETINPYMVPPIQHLHGEPVALGDPRDQDFV*
Ga0134066_100154442	3300010364	Grasslands Soil	DEVFRNLFIPYEPKPETEHPDMVPSVKHLHGESVALSDPSDQNFV*
Ga0134125_105199511	3300010371	Terrestrial Soil	KVFRNLFVPHEPKPEAEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0134123_119352882	3300010403	Terrestrial Soil	FSDLFVSHEPEPEAKHPDMMSSVQHLHGEPVALSDPSDQNFV*
Ga0137378_102801772	3300012210	Vadose Zone Soil	ESKPEAKHPDMVPSVQHLHGEAVALGDSSDQNLV*
Ga0137371_100357301	3300012356	Vadose Zone Soil	EKNLADEVFRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0150984_1052122301	3300012469	Avena Fatua Rhizosphere	IPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0137413_104417891	3300012924	Vadose Zone Soil	DLFVPHEPQPETEHPDMVPSVQHLHGEAVALGDPSDQNFV*
Ga0137413_116525701	3300012924	Vadose Zone Soil	NLADEVFRNLFVPYESKPETEHPDMVPSIQHLHGEPVALSDPSDQNFV*
Ga0137404_104688091	3300012929	Vadose Zone Soil	RNLLVPDEPKPETEHPDMVPSVKYLHGEPVALSDPSDQNLV*
Ga0137410_102398211	3300012944	Vadose Zone Soil	EPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV*
Ga0164302_101328961	3300012961	Soil	LFVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0164308_103059612	3300012985	Soil	PYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNVV*
Ga0164307_117010061	3300012987	Soil	EPKPETEHPDMVPSVKHLHGDPVALSDPSDQNFV*
Ga0157374_102562721	3300013296	Miscanthus Rhizosphere	LADEVFRNLFVPYESKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0157374_116153331	3300013296	Miscanthus Rhizosphere	EVLRHLFVPHEPKPEAVHPDMMPSVQHLHGEPVALSDPSDQNLV*
Ga0157378_114375051	3300013297	Miscanthus Rhizosphere	NLGDEIFRNLLVPHEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0163162_100636955	3300013306	Switchgrass Rhizosphere	LVPHEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0157380_106865292	3300014326	Switchgrass Rhizosphere	PHEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0132258_133486641	3300015371	Arabidopsis Rhizosphere	EKNLADEIFRDLLVPYEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV*
Ga0132257_1023420891	3300015373	Arabidopsis Rhizosphere	ADEVFRDLFVPYEPKPDTEHPDMVPSVKHLHGEPVALSDPSDQNFV*
Ga0132257_1034323481	3300015373	Arabidopsis Rhizosphere	DFADEVFRNLFVPYEPEPETEHPDMVPSVKHLHGEPVALSDPGDQNFI*
Ga0132257_1037879891	3300015373	Arabidopsis Rhizosphere	HEPKPEAEHPDMVPSVKHLHGEPVALGDTSDQSFV*
Ga0132255_1049375431	3300015374	Arabidopsis Rhizosphere	EVLCRLLVPHEPKPEAVHPDMMPSVQDLHGEPVALRDPSDQNLV*
Ga0132255_1059474531	3300015374	Arabidopsis Rhizosphere	DEIFRGLFVPNEPKPEAKHPDMVPSVQHLHGEPVALSDPSDQNFV*
Ga0163161_108156021	3300017792	Switchgrass Rhizosphere	RNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0184615_101224542	3300018059	Groundwater Sediment	RNLFIPNEPEPETEHPDMVPSVQHLHGEPVALSDPSDQNFV
Ga0184625_101345721	3300018081	Groundwater Sediment	LADEIFRNLLVPYEPKPETEHPDMVPSVKHLHGESVALSDPSDQNFV
Ga0190270_108814972	3300018469	Soil	PYEPKPETEHPDMVPSVKHLHGEPVALSDPGDQNVI
Ga0190274_127518191	3300018476	Soil	LADEVFRNLFVPDEPKPETEHPDMVPSVQHLHGEPVALSDPGDQNFV
Ga0190274_130895311	3300018476	Soil	LADEVFRNLFVPDEPKPETEHPDMVPSVQHLHGEPVALSDPSDQSFV
Ga0190264_100665071	3300019377	Soil	LFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0190264_121730581	3300019377	Soil	PYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0210399_115874652	3300020581	Soil	NLADEVFRNLLVSHDPKPKAKHPDMVPSVQHLHGEAVALSDPGDQNFV
Ga0210397_102996171	3300021403	Soil	LVPHEPKPETKHPDVVPSVQHLHGEPVALSDPADQDFVRCGCSAQ
Ga0210410_116160151	3300021479	Soil	LVPHEPEPETEHPDMVPSIQHLHGEPVALSDPSDQNLI
Ga0222621_10720021	3300021510	Groundwater Sediment	FIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0207697_102935802	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	LADKVFRNLFVPHEPKPEAEHPDMVPSVKHLHGEPVALGDTSDQSFV
Ga0207710_100566922	3300025900	Switchgrass Rhizosphere	LADEVFRNLFVPNEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV
Ga0207645_102187682	3300025907	Miscanthus Rhizosphere	IPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0207707_114847731	3300025912	Corn Rhizosphere	NLFVPYESKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0207681_116053731	3300025923	Switchgrass Rhizosphere	YEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0207694_102996662	3300025924	Corn Rhizosphere	FRNLLVPYEPEPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0207644_104341422	3300025931	Switchgrass Rhizosphere	VFCDLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPRDQNFV
Ga0207644_108097872	3300025931	Switchgrass Rhizosphere	PHEPKPEAEHPDMVPSVKHLHGEPVALGDTSDQSFV
Ga0207690_104372131	3300025932	Corn Rhizosphere	LRDLLVPHEPKPETKHPDVVPSVQHLHGEPVALSDPADQDFV
Ga0207679_103557131	3300025945	Corn Rhizosphere	DEVFCDLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0207651_117649321	3300025960	Switchgrass Rhizosphere	GDEIFRNLLVPHEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0207712_116585081	3300025961	Switchgrass Rhizosphere	LFIPYEPKPETENPDMVPAVKHLHGEPVALSDPSDQNFV
Ga0207668_107048701	3300025972	Switchgrass Rhizosphere	SEKNLADEIFRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0207668_108108481	3300025972	Switchgrass Rhizosphere	FVPDEPKPETEHPDMVPSVQHLHGEPVALSDPSDQNFV
Ga0207668_116896741	3300025972	Switchgrass Rhizosphere	LVPHEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0207658_113566061	3300025986	Switchgrass Rhizosphere	RNLFVPNEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV
Ga0207641_107744961	3300026088	Switchgrass Rhizosphere	NLFVPHEPKPETEHPDMVPSVQHLHGEPVALSDPSDQNFV
Ga0207648_103578012	3300026089	Miscanthus Rhizosphere	HEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0207674_116344551	3300026116	Corn Rhizosphere	PDEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0208996_10194621	3300027257	Forest Soil	RNLFVPDEPKPEAEHPDMAPSVQHLHGEPVALSDPSDQNVV
Ga0209813_100649061	3300027866	Populus Endosphere	EKDFADEVFRNLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV
Ga0209481_105619781	3300027880	Populus Rhizosphere	EVFRNLFVPYEPEPETEHPDMMPSVQHLHGEPVALSDPSDQNFV
Ga0209069_105558932	3300027915	Watersheds	PYEPKPETEHPDMVPSVEHLHGEPVALSDPRDQNLV
Ga0268266_121207161	3300028379	Switchgrass Rhizosphere	LRDLLVPHEPQPETINPYMVPPIQHLHGEPVALGDPGNQDFV
Ga0307281_100123821	3300028803	Soil	DEVFSNLFIPYEPKPETEHPDMMPSVKHLHGEPVALSDPSDQNFV
Ga0302323_1030166961	3300031232	Fen	LVPNEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNLV
Ga0310886_106025941	3300031562	Soil	EVFRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0307508_104197501	3300031616	Ectomycorrhiza	PDEPKPEAEHPDMVPSVQHLHGEPVALSDPSDQNFV
Ga0307516_108560442	3300031730	Ectomycorrhiza	IEKNLADEVFRNLFVPDEPKPETEHPDMVPSVQHLHGEPVALSDPSDQNFV
Ga0307405_101534682	3300031731	Rhizosphere	EIFRNLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0307410_104767411	3300031852	Rhizosphere	EVLRDLFIPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFI
Ga0307412_107428251	3300031911	Rhizosphere	IEKHFADEVFRNLFVPYEPKPETEHPDMVPSVEHLHGEPVALSDPSDQNFV
Ga0310890_106917182	3300032075	Soil	ADEVFRDLLVPYEPKPETEHPDMVPSVKHLHGEPVALSDPSDQNFV
Ga0307472_1018374511	3300032205	Hardwood Forest Soil	HEPEPETEHPDMVPSIQHLHGEPVALSDPSDQNLV
Ga0335071_117909201	3300032897	Soil	HEPEPETVHPDMVPSIQHLHGEPVALSDPGDQGFIRCRLCHAQ
Ga0370502_0061170_1082_1189	3300034156	Untreated Peat Soil	DEPKPEAEHPDMVPSVKHLHGEPVALSDPSDQNFV