| Basic Information | |
|---|---|
| Family ID | F076254 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSTSNWEDAKARSNYHFNKWHKDTDCVQHLGKFTGGWQTELQ |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.29 % |
| % of genes near scaffold ends (potentially truncated) | 99.15 % |
| % of genes from short scaffolds (< 2000 bps) | 91.53 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.881 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (19.492 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.424 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (84.746 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01970 | TctA | 2.54 |
| PF00117 | GATase | 2.54 |
| PF00474 | SSF | 2.54 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG1784 | TctA family transporter | General function prediction only [R] | 2.54 |
| COG3333 | TctA family transporter | General function prediction only [R] | 2.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.29 % |
| Unclassified | root | N/A | 12.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10098313 | All Organisms → Viruses → Predicted Viral | 1225 | Open in IMG/M |
| 3300001419|JGI11705J14877_10196736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 519 | Open in IMG/M |
| 3300001460|JGI24003J15210_10122277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 708 | Open in IMG/M |
| 3300001460|JGI24003J15210_10148519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 603 | Open in IMG/M |
| 3300001589|JGI24005J15628_10052785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1558 | Open in IMG/M |
| 3300002231|KVRMV2_100689427 | Not Available | 593 | Open in IMG/M |
| 3300003478|JGI26238J51125_1109166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 518 | Open in IMG/M |
| 3300005523|Ga0066865_10394594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 526 | Open in IMG/M |
| 3300005913|Ga0075108_10286156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 549 | Open in IMG/M |
| 3300006191|Ga0075447_10154763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 769 | Open in IMG/M |
| 3300006325|Ga0068501_1164741 | Not Available | 610 | Open in IMG/M |
| 3300006919|Ga0070746_10069693 | All Organisms → Viruses → Predicted Viral | 1796 | Open in IMG/M |
| 3300007623|Ga0102948_1285628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 505 | Open in IMG/M |
| 3300007725|Ga0102951_1119654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 744 | Open in IMG/M |
| 3300008012|Ga0075480_10568083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 540 | Open in IMG/M |
| 3300009000|Ga0102960_1276981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 593 | Open in IMG/M |
| 3300009001|Ga0102963_1191091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 818 | Open in IMG/M |
| 3300009124|Ga0118687_10124334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 908 | Open in IMG/M |
| 3300009173|Ga0114996_10854496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 655 | Open in IMG/M |
| 3300009420|Ga0114994_10657262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 685 | Open in IMG/M |
| 3300009426|Ga0115547_1053827 | All Organisms → Viruses → Predicted Viral | 1412 | Open in IMG/M |
| 3300009438|Ga0115559_1119436 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300009467|Ga0115565_10330930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 691 | Open in IMG/M |
| 3300009472|Ga0115554_1075619 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
| 3300009481|Ga0114932_10815366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 540 | Open in IMG/M |
| 3300009497|Ga0115569_10193064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 945 | Open in IMG/M |
| 3300009507|Ga0115572_10549242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 638 | Open in IMG/M |
| 3300009512|Ga0115003_10601065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 642 | Open in IMG/M |
| 3300009526|Ga0115004_10416868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 795 | Open in IMG/M |
| 3300009593|Ga0115011_10083258 | All Organisms → Viruses → Predicted Viral | 2233 | Open in IMG/M |
| 3300009785|Ga0115001_10785911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 574 | Open in IMG/M |
| 3300010318|Ga0136656_1161932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 762 | Open in IMG/M |
| 3300012928|Ga0163110_10070184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 2264 | Open in IMG/M |
| 3300012928|Ga0163110_10638523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 825 | Open in IMG/M |
| 3300012928|Ga0163110_10793968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 744 | Open in IMG/M |
| 3300012954|Ga0163111_10041024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 3552 | Open in IMG/M |
| 3300017713|Ga0181391_1102960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 644 | Open in IMG/M |
| 3300017714|Ga0181412_1015872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 2172 | Open in IMG/M |
| 3300017714|Ga0181412_1101852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 675 | Open in IMG/M |
| 3300017717|Ga0181404_1145545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 572 | Open in IMG/M |
| 3300017717|Ga0181404_1151706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 559 | Open in IMG/M |
| 3300017719|Ga0181390_1157260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 568 | Open in IMG/M |
| 3300017721|Ga0181373_1099458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 513 | Open in IMG/M |
| 3300017727|Ga0181401_1089643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 792 | Open in IMG/M |
| 3300017731|Ga0181416_1005817 | All Organisms → Viruses → Predicted Viral | 2954 | Open in IMG/M |
| 3300017733|Ga0181426_1088911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 619 | Open in IMG/M |
| 3300017734|Ga0187222_1135556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 549 | Open in IMG/M |
| 3300017744|Ga0181397_1066937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 972 | Open in IMG/M |
| 3300017753|Ga0181407_1057246 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300017758|Ga0181409_1021961 | All Organisms → Viruses → Predicted Viral | 2061 | Open in IMG/M |
| 3300017759|Ga0181414_1171868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 564 | Open in IMG/M |
| 3300017762|Ga0181422_1179810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 643 | Open in IMG/M |
| 3300017762|Ga0181422_1220479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 567 | Open in IMG/M |
| 3300017767|Ga0181406_1058456 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
| 3300017771|Ga0181425_1158242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 717 | Open in IMG/M |
| 3300017781|Ga0181423_1241198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 677 | Open in IMG/M |
| 3300017949|Ga0181584_10161165 | All Organisms → Viruses → Predicted Viral | 1498 | Open in IMG/M |
| 3300017968|Ga0181587_10650937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 669 | Open in IMG/M |
| 3300018039|Ga0181579_10578262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 583 | Open in IMG/M |
| 3300018413|Ga0181560_10118727 | All Organisms → Viruses → Predicted Viral | 1379 | Open in IMG/M |
| 3300018424|Ga0181591_10424360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 985 | Open in IMG/M |
| 3300020207|Ga0181570_10466291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 589 | Open in IMG/M |
| 3300020367|Ga0211703_10006505 | Not Available | 2573 | Open in IMG/M |
| 3300020374|Ga0211477_10168775 | Not Available | 774 | Open in IMG/M |
| 3300020376|Ga0211682_10394032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 504 | Open in IMG/M |
| 3300020381|Ga0211476_10229057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 649 | Open in IMG/M |
| 3300020410|Ga0211699_10029663 | Not Available | 2080 | Open in IMG/M |
| 3300020410|Ga0211699_10359086 | Not Available | 573 | Open in IMG/M |
| 3300020428|Ga0211521_10411361 | Not Available | 590 | Open in IMG/M |
| 3300020440|Ga0211518_10327645 | Not Available | 719 | Open in IMG/M |
| 3300020441|Ga0211695_10080320 | Not Available | 1071 | Open in IMG/M |
| 3300020445|Ga0211564_10344568 | Not Available | 733 | Open in IMG/M |
| 3300020448|Ga0211638_10405549 | Not Available | 639 | Open in IMG/M |
| 3300020451|Ga0211473_10635190 | Not Available | 538 | Open in IMG/M |
| 3300020460|Ga0211486_10281199 | Not Available | 719 | Open in IMG/M |
| 3300020474|Ga0211547_10352901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 743 | Open in IMG/M |
| 3300021960|Ga0222715_10123078 | All Organisms → Viruses → Predicted Viral | 1645 | Open in IMG/M |
| 3300022068|Ga0212021_1068541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 727 | Open in IMG/M |
| 3300022200|Ga0196901_1101974 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300023081|Ga0255764_10015402 | All Organisms → cellular organisms → Bacteria | 5406 | Open in IMG/M |
| 3300023084|Ga0255778_10484118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 511 | Open in IMG/M |
| 3300023115|Ga0255760_10205789 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
| 3300023115|Ga0255760_10315271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 763 | Open in IMG/M |
| 3300023175|Ga0255777_10267642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 984 | Open in IMG/M |
| 3300023176|Ga0255772_10403279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 688 | Open in IMG/M |
| 3300023180|Ga0255768_10283753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 939 | Open in IMG/M |
| 3300023294|Ga0222670_1064538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 510 | Open in IMG/M |
| 3300024346|Ga0244775_10997812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 661 | Open in IMG/M |
| 3300025102|Ga0208666_1076700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 868 | Open in IMG/M |
| 3300025120|Ga0209535_1161227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 690 | Open in IMG/M |
| 3300025151|Ga0209645_1208409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 571 | Open in IMG/M |
| 3300025425|Ga0208646_1085155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 501 | Open in IMG/M |
| 3300025626|Ga0209716_1036792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1743 | Open in IMG/M |
| 3300025632|Ga0209194_1070463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 944 | Open in IMG/M |
| 3300025665|Ga0209360_1145448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 657 | Open in IMG/M |
| 3300025696|Ga0209532_1201736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 567 | Open in IMG/M |
| 3300025809|Ga0209199_1256439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 569 | Open in IMG/M |
| 3300025810|Ga0208543_1085750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 757 | Open in IMG/M |
| 3300025816|Ga0209193_1109358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 679 | Open in IMG/M |
| 3300025828|Ga0208547_1187956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 564 | Open in IMG/M |
| 3300025886|Ga0209632_10272855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 855 | Open in IMG/M |
| 3300025889|Ga0208644_1296183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 645 | Open in IMG/M |
| 3300025890|Ga0209631_10099822 | All Organisms → Viruses → Predicted Viral | 1676 | Open in IMG/M |
| 3300025894|Ga0209335_10357424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 603 | Open in IMG/M |
| 3300025897|Ga0209425_10059490 | All Organisms → Viruses → Predicted Viral | 2476 | Open in IMG/M |
| 3300026187|Ga0209929_1168362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 524 | Open in IMG/M |
| 3300027668|Ga0209482_1091162 | Not Available | 997 | Open in IMG/M |
| 3300027687|Ga0209710_1131011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 938 | Open in IMG/M |
| 3300027752|Ga0209192_10337747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 533 | Open in IMG/M |
| 3300027788|Ga0209711_10400751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 562 | Open in IMG/M |
| 3300027813|Ga0209090_10567074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 518 | Open in IMG/M |
| 3300028197|Ga0257110_1352849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 513 | Open in IMG/M |
| 3300031626|Ga0302121_10114880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 784 | Open in IMG/M |
| 3300031626|Ga0302121_10141805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 691 | Open in IMG/M |
| 3300031638|Ga0302125_10206297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 607 | Open in IMG/M |
| 3300031639|Ga0302117_10356699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 554 | Open in IMG/M |
| 3300031646|Ga0302133_10397500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 627 | Open in IMG/M |
| 3300032360|Ga0315334_11335254 | Not Available | 617 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 19.49% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 16.10% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 13.56% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 11.02% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 8.47% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.93% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 4.24% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.39% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.54% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.69% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.69% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.69% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.85% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.85% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.85% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.85% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.85% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.85% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.85% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.85% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.85% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.85% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.85% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300023294 | Saline water microbial communities from Ace Lake, Antarctica - #732 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025665 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031639 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_32.2 | Environmental | Open in IMG/M |
| 3300031646 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_33.1 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100983131 | 3300000101 | Marine | MSTSNWEDARARSKYHFNKWHKDTDCVEHLGKFTGGWQTE |
| JGI11705J14877_101967361 | 3300001419 | Saline Water And Sediment | MSTSNWEDAKARSNYHFNKWHRDTDCVQHLGKFSGGWQTEI |
| JGI24003J15210_101222772 | 3300001460 | Marine | MSTSNWEEAKARSNYHFNKWHRDTDCVEHLGKFTGGWQTE |
| JGI24003J15210_101485192 | 3300001460 | Marine | MSTSNWKEAKARSNYHFNKWHRDTDCVEHLGKFTGGWQTE |
| JGI24005J15628_100527851 | 3300001589 | Marine | MTISSWENLKARSNYHFNKWHRDTDNVKHLGKFTGGWQTELQAVIEDAKPL |
| KVRMV2_1006894271 | 3300002231 | Marine Sediment | MISNWQEAKARSTYHFNKWHKDTDIVQHLGKFTGGWQTEVQAVINDA |
| JGI26238J51125_11091661 | 3300003478 | Marine | MSTSNWEEAKTKSNYHFNKWHKDTDCVKHLGKFTGGWQTELQAVME |
| Ga0066865_103945942 | 3300005523 | Marine | MSTSNWEEAKARSNYHFNKWHKDTDCVQHLGKFTGGW |
| Ga0075108_102861561 | 3300005913 | Saline Lake | MSTSNWEEAKARSNYHFNKWHKDTDCVEHLGKFTGGWQTEL |
| Ga0075447_101547631 | 3300006191 | Marine | MSTSNWEDAKTRSNYHFNKWHKDTDCVEHLGKFTGGWQTELQAVIEDG |
| Ga0068501_11647411 | 3300006325 | Marine | MKSNWEELKTKSEYHFNKWHKDTDCVQHLGRFTSGWQTE |
| Ga0070746_100696931 | 3300006919 | Aqueous | MSTSNWEESKARSDYHFNKWHRDTDCVQHLGRFTGGWQTEIQSVI |
| Ga0102948_12856281 | 3300007623 | Water | MSTSNWEDARARSNYHFNKWHKDTDCVQHLGKFTGGWQTELQSVIEDAKPLN |
| Ga0102951_11196541 | 3300007725 | Water | MSTSNWEESKARSDYHFNKWHRDTDCVQHLGRFTGGW |
| Ga0075480_105680832 | 3300008012 | Aqueous | MSTSNWEDARARSNYHFNKWHRDTDCVQHLGKFTGG |
| Ga0102960_12769811 | 3300009000 | Pond Water | MSTSNWEDAKARSNYHFNKWHRDTDCVQHLGKFTGGWQTELQAVIEDAKPLN |
| Ga0102963_11910911 | 3300009001 | Pond Water | MSTSNWKDAKARSNYHFNKWHRDTDCVQHLGKFTGGWQTEIQSVIDD |
| Ga0118687_101243343 | 3300009124 | Sediment | MSTSNWEDARARSNYHFNKWHRDTDCVQHLGKFTGGWQTELQTVIDDAK |
| Ga0114996_108544962 | 3300009173 | Marine | MSTSNWEEAKARSNYHFNKWHRDTDCVEHLGKFTGGWQTELQAVMEDGKQL |
| Ga0114994_106572622 | 3300009420 | Marine | MSTSNWEEAKARSNYHFNKWHRDTDCVEHLGKFTGGWQTELQAVIEDGKPL |
| Ga0115547_10538273 | 3300009426 | Pelagic Marine | MSTSNWEDAKLRSNYHFNKWHKDTDCVEHLGKFTGGWQTEL |
| Ga0115559_11194363 | 3300009438 | Pelagic Marine | MSTSNWEDAKARSNYHFNKWHKDTDCVEHLGKFTGGWQTELQAVMED |
| Ga0115565_103309301 | 3300009467 | Pelagic Marine | MSTSNWEDAKARSNYHFNKWHKDTDCVEHLGKFTGGWQTELQA |
| Ga0115554_10756191 | 3300009472 | Pelagic Marine | MSTSNWEDAKAKSNYHFNKWHRDTDCVQHMGKFTGGWQT |
| Ga0114932_108153661 | 3300009481 | Deep Subsurface | MSTSNWEDAKARSNYHFNKWHKDIDCVQHMGKFTGGWQTELQSVID |
| Ga0115569_101930643 | 3300009497 | Pelagic Marine | MSTSNWEEAKTKSNYHFNKWHKDTDCVKHLGKFTGGWQTEL |
| Ga0115572_105492422 | 3300009507 | Pelagic Marine | MSTSNWEEGKARSTYHFNKWHQDTDCVKYLGKFTGGWQTELQSVIDEAK |
| Ga0115003_106010651 | 3300009512 | Marine | MSTSNWEEAKARSNYHFNKWHKDTDCVEHLGKFTGGWQT |
| Ga0115004_104168681 | 3300009526 | Marine | MSTSNWEEAKARSNYHFNKWHRDTDCVEHLGKFTGGWQTELQAVIE |
| Ga0115011_100832583 | 3300009593 | Marine | MKSNWEELKNKSSYHFNKWHTDTDCVEHLGRFTGGWQTELQ |
| Ga0115001_107859112 | 3300009785 | Marine | MSTSNWEEAKARSNYHFNKWHKDTDCVEHLGKFTGGWQTE |
| Ga0136656_11619321 | 3300010318 | Freshwater To Marine Saline Gradient | MSTSNWEESKARSDYHFNKWHRDTDCVQHLGRFTGGWQTE |
| Ga0163110_100701841 | 3300012928 | Surface Seawater | MSTSNWEDAKARSNYHFNKWHKDTNCVEHLGRFTGGWQTELQEVIND |
| Ga0163110_106385233 | 3300012928 | Surface Seawater | MYTSNWEESKIRSNYHFNKWHRDTDCVEHLGRFTGGWQT |
| Ga0163110_107939682 | 3300012928 | Surface Seawater | MSTSNWEDAKARSNYHFNKWHKDTDCVLHLGKFTGGWQTEVQSV |
| Ga0163111_100410243 | 3300012954 | Surface Seawater | MSTSNWEDAKARSNYHFNKWHKDTNCVEHLGRFTGGWQTELQEVINDAKPLN* |
| Ga0181391_11029602 | 3300017713 | Seawater | MSISNWEEAKARSNYHFNKWKTDTDNIEHLGKFTGDWSEEIKSAIFPFLLDRK |
| Ga0181412_10158724 | 3300017714 | Seawater | MGQKEYRYMSTSNWEDAKAKSNYHFNKWHTDTDCVEHLGKFTGGWQTELQEVIND |
| Ga0181412_11018522 | 3300017714 | Seawater | MSTSNWEDARARSNYHFNKWHKDTDCVQHMGRFTGGWQTELQSVIDDAKPL |
| Ga0181404_11455451 | 3300017717 | Seawater | MQKKEYRYMSTSNWEDAKARSNYHFNKWHNDTDCVKHLGKFTGGWQIE |
| Ga0181404_11517062 | 3300017717 | Seawater | MSTSSWEDLKARSNYHFNKWHTDTDCVKHLGKFTGGWQTELQEVINDAKPL |
| Ga0181390_11572602 | 3300017719 | Seawater | MSTSNWEDAKAVSNYHFNKWHTDTDCVEHLGKFTGGWQTELQAVI |
| Ga0181373_10994582 | 3300017721 | Marine | MSTSNWEKAKARSNYHFNKWHRDTDCVEHLGKFTGGWQTELQSVIDEA |
| Ga0181401_10896431 | 3300017727 | Seawater | MSTSNWEDAKARSNYHFNKWHKDTDCVQHLGKFTGGWQTELQSVIE |
| Ga0181416_10058171 | 3300017731 | Seawater | MSISNWEEAKARSNYHFNKWKTDTDNIEHLGKFTGDWSEEIKSAI |
| Ga0181426_10889111 | 3300017733 | Seawater | MSTSNWEDAKARSNYHFNKWHKDTDCVQHLGKFTG |
| Ga0187222_11355562 | 3300017734 | Seawater | MSTSNWEDAKARSNYHFNKWHKDTDCVQHLGKFTGGWQT |
| Ga0181397_10669373 | 3300017744 | Seawater | MSTSNWEDAKARSNYHFNKWHKDTDCVKQLGKFTGGWQTELELVIKDTMPL |
| Ga0181407_10572463 | 3300017753 | Seawater | MSTSNWEDAKARSTYHFNKWHKDTDCVQHLGKFTGGWQTELQSVIEDAKPLN |
| Ga0181409_10219613 | 3300017758 | Seawater | MSTSNWEDAKARSNYHFNKWHTDTDCVEHLGKFTGGWQSELQEVIND |
| Ga0181414_11718681 | 3300017759 | Seawater | MSTSNWEDAKARSNYHFNKWHKDSDCVTQLGKFTGGW |
| Ga0181422_11798102 | 3300017762 | Seawater | MGQKEYRYMSTSNCEDAKAKSNYHFNKWHTDTDCVEHS |
| Ga0181422_12204791 | 3300017762 | Seawater | MSTSNWEDAKARSNYHFNKWHTDTDCVELLGKFTGGWQTELQEVIKDAKPT |
| Ga0181406_10584561 | 3300017767 | Seawater | MSTSNWEDAKARSNYHFNKWHTDTDCVEHLGKFTGGWQSELQE |
| Ga0181425_11582421 | 3300017771 | Seawater | MSTSNWEDAEARSNYHFNKWHTDTDCVEHLGKFTGGWQSELQEVINDAKPLN |
| Ga0181423_12411982 | 3300017781 | Seawater | MGQKEYRYMSTSNWEDAKAKSNYHFNKWHTDTDCVEHLGKFTGGWQTELQEVINDAK |
| Ga0181584_101611651 | 3300017949 | Salt Marsh | MSTSNWEESKARSNYHFNKWHKDTDCVQHLGRFTG |
| Ga0181587_106509371 | 3300017968 | Salt Marsh | MSTSNWEESKARSDYHFNKWHRDTDCVQHLGRFTGGWQTEIQSVIDD |
| Ga0181579_105782621 | 3300018039 | Salt Marsh | MSTSNWEESKARSDYHFNKWHRDTDCVQHLGRFTGGWQTEIQS |
| Ga0181560_101187271 | 3300018413 | Salt Marsh | MSTSNWEESKARSDYHFNKWHRDTDCVEHLGRFTG |
| Ga0181591_104243603 | 3300018424 | Salt Marsh | MSTSNWEESKARSDYHFNKWHRDTDCVQHLGRFTGGSQTEI |
| Ga0181570_104662912 | 3300020207 | Salt Marsh | MSTSNWEDARARSNYHFNKWHRDTDCVQHLGKFTGGWQTEL |
| Ga0211703_100065051 | 3300020367 | Marine | MSTSNWQEAKARSTYHFNKWHTDTDIVQHLGKFTGGWQTEV |
| Ga0211477_101687752 | 3300020374 | Marine | MISNWEEAKLRSTYHFNKWHTDTDIVQHLGKFTGGW |
| Ga0211682_103940321 | 3300020376 | Marine | MQIKEYRFMSTSNWEEAKTRSNYHFNKWHKDTDCVKYLGKFTGGWQTELQSVIEDAK |
| Ga0211476_102290572 | 3300020381 | Marine | MSTSNWEDAKARSNYHFNKWHTDTDTVQHLGKFTGGWQTELQEVINDAKP |
| Ga0211699_100296633 | 3300020410 | Marine | MKSNWQEAKLSSTYHFNKWHEDTDVVEHLGRFTGGWQSEINAVINDAIPLSWATRRVGSG |
| Ga0211699_103590862 | 3300020410 | Marine | MKSNWEEAKLKSTYHFNKWHTDTDCVQHLGRFTGGWQTELQAVIDDAKP |
| Ga0211521_104113611 | 3300020428 | Marine | MSTSNWQEAKARSTYHFNKWHTDTDIVQHLGKFTGGWQTEVQAVINEA |
| Ga0211518_103276451 | 3300020440 | Marine | MTESNWEESKKKSTYHFNKWHVDNGCIQHLGKFTGGWQTELQ |
| Ga0211695_100803201 | 3300020441 | Marine | MISNWQEAKARSTYHFNKWHKDTDIVQHLGKFTGGWQTEVQAVIN |
| Ga0211564_103445681 | 3300020445 | Marine | MKSNWEEAKLKSTYHFNKWHTDTDVVQHLGRFTGGWQTELQTVIDDAKPL |
| Ga0211638_104055492 | 3300020448 | Marine | MISNWQEAKARSTYHFNKWHKDTDIVQHLGKFTGG |
| Ga0211473_106351901 | 3300020451 | Marine | MSTSNWQEAKARSTYHFNKWHTDTDIVQHLGKFTGGWQTEVQAVIN |
| Ga0211486_102811991 | 3300020460 | Marine | MISNWQEAKARSTYHFNKWHKDTDIVQHLGKFTGGWQ |
| Ga0211547_103529011 | 3300020474 | Marine | MSTSNWEDAKARSNYHFNKWHKDTDCVEHLGKFTGGWQTELQSVVEDAK |
| Ga0222715_101230783 | 3300021960 | Estuarine Water | MSTSNWEESKARSDYHFNKWHRDTDCVQHLGRFTGGWQT |
| Ga0212021_10685411 | 3300022068 | Aqueous | MSTSNWEESKARSDYHFNKWHQDTDCVQHLGSFTGGWQTEIQSVIDDAKPLN |
| Ga0196901_11019743 | 3300022200 | Aqueous | MSTSNWEESKARSDYHFNKWHRDTDCVQHLGSFTGGWQTEI |
| Ga0255764_100154021 | 3300023081 | Salt Marsh | MSTSNWEDAKARSNYHFNKWHRDTDCVQHLGKFTGGWQTE |
| Ga0255778_104841181 | 3300023084 | Salt Marsh | MSTSNWEESKARSNYHFNKWHRDTDCVQHLGRFTGGWQTEIQSVIDDAKPLN |
| Ga0255760_102057891 | 3300023115 | Salt Marsh | MSTSNWEDARARSNYHFNKWHRDTDCVQHLGKFTGGWQTELQTVIDDAKP |
| Ga0255760_103152712 | 3300023115 | Salt Marsh | MSTSNWEDARARSNYHFNKWHRDTDCVEHLGKFTGGWQTELQTVIDDAKPLN |
| Ga0255777_102676423 | 3300023175 | Salt Marsh | MSTSNWEDAKARSNYHFNKWHPDTDCVEHLGKFTGGWQTELQAVIEDA |
| Ga0255772_104032791 | 3300023176 | Salt Marsh | MSTSNWEESKARSDYHFNKWHRDTDCVQHLGRFTGGWQTEIQSVIDDAKP |
| Ga0255768_102837531 | 3300023180 | Salt Marsh | MSTSNWEESKARSDYHFNKWHRDTDCVQHLGRFTGGSQTE |
| Ga0222670_10645381 | 3300023294 | Saline Water | MSTSNWEEAKTRSNYHFNKWHKDTDCVEHLGKFTGGWQTELQAVIED |
| Ga0244775_109978121 | 3300024346 | Estuarine | MSTSSWEDLKARSNYHFNKWHRDTDRVRHLGKFTGGWQTELQAVIDDGK |
| Ga0208666_10767003 | 3300025102 | Marine | MSTSNWEDAKARSNYHFNKWHKDTDCVQHLGKFTGGWQTELQ |
| Ga0209535_11612271 | 3300025120 | Marine | VNVKPYTIMKLKEYRCMSTSNWEEAKARSNYHFNKWHRDTDCVEHLGKFTGGWQTELQAVME |
| Ga0209645_12084091 | 3300025151 | Marine | MSTSNWEDAKARSNYHFNKWHKDTDCVQHLGKFTGGWHTELQSVIEDAKPL |
| Ga0208646_10851552 | 3300025425 | Saline Lake | VTIITNKKEYRYMSTSNWEDLKAKSKYHFNKWHQDTNCVKHLGK |
| Ga0209716_10367921 | 3300025626 | Pelagic Marine | MSTSNWEDAKARSNYHFNKWHRDTECVQHLGKFTGGWQTELQA |
| Ga0209194_10704633 | 3300025632 | Pelagic Marine | MSTSNWEDAKLRSNYHFNKWHKDTECVEHLGKFTGGWQTELQAVIEDGKP |
| Ga0209360_11454482 | 3300025665 | Marine | MSTSNWEEAKTKSNYHFNKWHKDTDCVKHLGKFTGGWQTELQA |
| Ga0209532_12017362 | 3300025696 | Pelagic Marine | MSTSNWEDAKARSNYHFNKWHKDTDCVEHLGKFTGGWQT |
| Ga0209199_12564392 | 3300025809 | Pelagic Marine | MSTSNWEDAKARSNYHFNKWHRDTDCVEHLGKFTGGWQTEL |
| Ga0208543_10857501 | 3300025810 | Aqueous | MSTSNWEESKARSDYHFNKWHRDTDCVQHLGRFTGGWQTEIQSVIDDAKPL |
| Ga0209193_11093582 | 3300025816 | Pelagic Marine | MQKKEYRYMSTSNWEDAKARSNYHFNKWHKDTDCVQHLGKFTGGWQTE |
| Ga0208547_11879561 | 3300025828 | Aqueous | MSTSNWEDSRARSNYHFNKWHRDTDCVEHMGRFTGGWQTEIQSVIDDAK |
| Ga0209632_102728553 | 3300025886 | Pelagic Marine | MSTSNWEDGKARSNYHFNKWHKDTDCVEHLGKFTGGW |
| Ga0208644_12961832 | 3300025889 | Aqueous | MSTSNWEDAKARSNYHFNKWHRDTECVQHLGKFTGGWQTELQAVI |
| Ga0209631_100998223 | 3300025890 | Pelagic Marine | MSTSNWEDARARSNYHFNKWHRDTDCVQHLGKFTGGWQTELQTVIDD |
| Ga0209335_103574242 | 3300025894 | Pelagic Marine | MSTSNWEDGKARSNYHFNKWHKDTDCVEHLGKFTGGWQTELQAVIEDAK |
| Ga0209425_100594904 | 3300025897 | Pelagic Marine | MSTSNWEDAKARSNYHFNKWHKDTDCVQHLGKFTGGWQTELQSVI |
| Ga0209929_11683622 | 3300026187 | Pond Water | MQKREYKFMSTSNWEDAKAKSNYHFNKWHRDTDCVQHMGKFT |
| Ga0209482_10911623 | 3300027668 | Marine | MTYRFMSTSNWEEAKTRSNYHFNKWHKDTDCVEHLGKFTGGWQ |
| Ga0209710_11310111 | 3300027687 | Marine | MSTSNWEEAKARSNYHFNKWHKDTDCVEHLGKFTGGWQTELQAVIED |
| Ga0209192_103377472 | 3300027752 | Marine | MSTSNWEEAKTRSNYHFNKWHRDTDCVEHLGKFTGGWQTELQAVIEDGK |
| Ga0209711_104007512 | 3300027788 | Marine | MSTSNWEEAKTRSNYHFNKWHRDTDCVEHLGKFTGGWQTELQAVIED |
| Ga0209090_105670742 | 3300027813 | Marine | MSTSNWEEAKARSNYHFNKWHKDTDCVEHLGKFTGGWQTELQAVMEHG |
| Ga0257110_13528491 | 3300028197 | Marine | MSTSNWEDAKARSDYHFNKWHKDTDRVEHLGKFTGGWQTELQAIIEDAK |
| Ga0302121_101148801 | 3300031626 | Marine | MHRKEYRYMSTSNWEEAKARSNYHFNKWHKDTDCVEHLGKFTGGWQTELQAVIEDGKQLN |
| Ga0302121_101418052 | 3300031626 | Marine | MSTSNWEEAKARSNYHFNKCHRDTDCVEHLGKFTGGWQTELQAVIEDGKP |
| Ga0302125_102062971 | 3300031638 | Marine | MSTSNWEEAKTRSNYHFNKWHRDTDCVEHLGKFTGGWQTEL |
| Ga0302117_103566991 | 3300031639 | Marine | MSTSNWEEAKARSNYHFNKWHKDTDCVEHLGKFTGGWQTELQA |
| Ga0302133_103975002 | 3300031646 | Marine | MSTSNWEEAKARSNYHFNKWHKDTDCVEHLGKFTGGWQTELQAVIEDGK |
| Ga0315334_113352541 | 3300032360 | Seawater | MKSNWEEAKLKSTYHFNKWHKDTDCIEHLGCFTGG |
| ⦗Top⦘ |