| Basic Information | |
|---|---|
| Family ID | F076231 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MMHLKPNKTGTADISEFSGFISTKQNSIISLTKLVVLISVILAVLMVVSR |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 117 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.42 % |
| % of genes near scaffold ends (potentially truncated) | 16.10 % |
| % of genes from short scaffolds (< 2000 bps) | 77.97 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.339 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands (33.898 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.288 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (44.068 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.15% β-sheet: 0.00% Coil/Unstructured: 53.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 117 Family Scaffolds |
|---|---|---|
| PF01740 | STAS | 13.68 |
| PF00166 | Cpn10 | 4.27 |
| PF03848 | TehB | 2.56 |
| PF16363 | GDP_Man_Dehyd | 0.85 |
| PF14667 | Polysacc_synt_C | 0.85 |
| PF02954 | HTH_8 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 4.27 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.34 % |
| Unclassified | root | N/A | 29.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10071544 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300000792|BS_KBA_SWE02_21mDRAFT_10182430 | Not Available | 512 | Open in IMG/M |
| 3300001281|JGI20213J14113_1000111 | All Organisms → cellular organisms → Bacteria | 17110 | Open in IMG/M |
| 3300001281|JGI20213J14113_1045737 | Not Available | 590 | Open in IMG/M |
| 3300002961|JGI11641J44799_10201503 | All Organisms → cellular organisms → Bacteria → FCB group | 558 | Open in IMG/M |
| 3300003432|JGI20214J51088_10004934 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 8814 | Open in IMG/M |
| 3300003432|JGI20214J51088_10805670 | Not Available | 609 | Open in IMG/M |
| 3300003432|JGI20214J51088_10999838 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300003541|JGI20214J51650_10314663 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300003541|JGI20214J51650_10546397 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300003541|JGI20214J51650_10654824 | Not Available | 736 | Open in IMG/M |
| 3300003991|Ga0055461_10128686 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 655 | Open in IMG/M |
| 3300004000|Ga0055458_10024017 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300004000|Ga0055458_10044591 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1082 | Open in IMG/M |
| 3300004000|Ga0055458_10183213 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300004001|Ga0055450_10017023 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
| 3300004001|Ga0055450_10134157 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 900 | Open in IMG/M |
| 3300004008|Ga0055446_10041202 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300004008|Ga0055446_10267276 | Not Available | 524 | Open in IMG/M |
| 3300004011|Ga0055460_10053067 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300004011|Ga0055460_10293763 | Not Available | 525 | Open in IMG/M |
| 3300004015|Ga0055462_10149655 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300004015|Ga0055462_10169506 | Not Available | 678 | Open in IMG/M |
| 3300004015|Ga0055462_10172852 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium RIFOXYA2_FULL_37_17 | 673 | Open in IMG/M |
| 3300004025|Ga0055433_10111673 | Not Available | 631 | Open in IMG/M |
| 3300004030|Ga0055444_10039810 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1476 | Open in IMG/M |
| 3300004048|Ga0055494_10147158 | Not Available | 542 | Open in IMG/M |
| 3300004050|Ga0055491_10087892 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 754 | Open in IMG/M |
| 3300004057|Ga0055496_10128020 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300004067|Ga0055485_10247668 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 521 | Open in IMG/M |
| 3300004146|Ga0055495_10012660 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1352 | Open in IMG/M |
| 3300004147|Ga0055515_10034028 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1071 | Open in IMG/M |
| 3300004148|Ga0055521_10192814 | Not Available | 562 | Open in IMG/M |
| 3300004266|Ga0055457_10068383 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300004778|Ga0062383_10182069 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 960 | Open in IMG/M |
| 3300004779|Ga0062380_10387453 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 606 | Open in IMG/M |
| 3300005219|Ga0069004_10299753 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → unclassified Ignavibacteria → Ignavibacteria bacterium RIFOXYA2_FULL_37_17 | 510 | Open in IMG/M |
| 3300005825|Ga0074476_1365389 | All Organisms → cellular organisms → Bacteria → FCB group | 1249 | Open in IMG/M |
| 3300005825|Ga0074476_1478084 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300005836|Ga0074470_11405901 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 7933 | Open in IMG/M |
| 3300005836|Ga0074470_11405901 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 7933 | Open in IMG/M |
| 3300006224|Ga0079037_100089477 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 2553 | Open in IMG/M |
| 3300006224|Ga0079037_100352154 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1381 | Open in IMG/M |
| 3300006224|Ga0079037_100680432 | Not Available | 1003 | Open in IMG/M |
| 3300006467|Ga0099972_11924070 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1690 | Open in IMG/M |
| 3300006930|Ga0079303_10006776 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 3286 | Open in IMG/M |
| 3300009037|Ga0105093_10050577 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1879 | Open in IMG/M |
| 3300009053|Ga0105095_10136726 | All Organisms → cellular organisms → Bacteria → FCB group | 1335 | Open in IMG/M |
| 3300009078|Ga0105106_10032252 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 3876 | Open in IMG/M |
| 3300009087|Ga0105107_10011774 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 6047 | Open in IMG/M |
| 3300009087|Ga0105107_10279311 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1165 | Open in IMG/M |
| 3300009091|Ga0102851_10289840 | All Organisms → cellular organisms → Bacteria → FCB group | 1593 | Open in IMG/M |
| 3300009091|Ga0102851_10851008 | All Organisms → cellular organisms → Bacteria → FCB group | 980 | Open in IMG/M |
| 3300009091|Ga0102851_12036759 | Not Available | 651 | Open in IMG/M |
| 3300009091|Ga0102851_12636309 | All Organisms → cellular organisms → Bacteria → FCB group | 576 | Open in IMG/M |
| 3300009111|Ga0115026_10285473 | Not Available | 1148 | Open in IMG/M |
| 3300009131|Ga0115027_10329935 | All Organisms → cellular organisms → Bacteria → FCB group | 1039 | Open in IMG/M |
| 3300009131|Ga0115027_10606086 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 807 | Open in IMG/M |
| 3300009504|Ga0114946_10025602 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 3499 | Open in IMG/M |
| 3300009504|Ga0114946_10259491 | Not Available | 925 | Open in IMG/M |
| 3300009506|Ga0118657_10236990 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 2505 | Open in IMG/M |
| 3300009868|Ga0130016_10067963 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 3440 | Open in IMG/M |
| 3300010412|Ga0136852_11790430 | Not Available | 580 | Open in IMG/M |
| 3300010430|Ga0118733_100150279 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 4647 | Open in IMG/M |
| 3300012675|Ga0137337_1004325 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 1685 | Open in IMG/M |
| 3300012675|Ga0137337_1005484 | Not Available | 1561 | Open in IMG/M |
| 3300014305|Ga0075349_1172105 | Not Available | 518 | Open in IMG/M |
| 3300014313|Ga0075347_1011061 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1554 | Open in IMG/M |
| 3300014315|Ga0075350_1151533 | Not Available | 585 | Open in IMG/M |
| 3300014319|Ga0075348_1036384 | Not Available | 1093 | Open in IMG/M |
| 3300014322|Ga0075355_1025368 | All Organisms → cellular organisms → Bacteria → FCB group | 1217 | Open in IMG/M |
| 3300022218|Ga0224502_10149028 | Not Available | 895 | Open in IMG/M |
| 3300025135|Ga0209498_1001779 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 13113 | Open in IMG/M |
| 3300025324|Ga0209640_10024038 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 5320 | Open in IMG/M |
| 3300025550|Ga0210098_1040516 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300025554|Ga0210060_1010985 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 1442 | Open in IMG/M |
| 3300025554|Ga0210060_1029460 | Not Available | 893 | Open in IMG/M |
| 3300025557|Ga0210141_1021930 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1234 | Open in IMG/M |
| 3300025557|Ga0210141_1066691 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300025568|Ga0210095_1044012 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 1054 | Open in IMG/M |
| 3300025573|Ga0210133_1070638 | Not Available | 759 | Open in IMG/M |
| 3300025583|Ga0210085_1026513 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 1770 | Open in IMG/M |
| 3300025583|Ga0210085_1133989 | Not Available | 665 | Open in IMG/M |
| 3300025599|Ga0210074_1000280 | All Organisms → cellular organisms → Bacteria | 19522 | Open in IMG/M |
| 3300025599|Ga0210074_1042100 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1277 | Open in IMG/M |
| 3300025599|Ga0210074_1130087 | Not Available | 665 | Open in IMG/M |
| 3300025948|Ga0210088_1006082 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 1822 | Open in IMG/M |
| 3300025967|Ga0210136_1085090 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300025976|Ga0210093_1041242 | Not Available | 590 | Open in IMG/M |
| 3300025980|Ga0210137_1078157 | Not Available | 525 | Open in IMG/M |
| 3300025995|Ga0210079_1028363 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 911 | Open in IMG/M |
| 3300026072|Ga0208292_1057134 | Not Available | 513 | Open in IMG/M |
| 3300026350|Ga0256823_1002854 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1238 | Open in IMG/M |
| 3300027713|Ga0209286_1012420 | All Organisms → cellular organisms → Bacteria | 3041 | Open in IMG/M |
| 3300027715|Ga0208665_10010047 | All Organisms → cellular organisms → Bacteria | 2298 | Open in IMG/M |
| 3300027818|Ga0209706_10053537 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
| 3300027831|Ga0209797_10043732 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 2009 | Open in IMG/M |
| 3300027858|Ga0209013_10008163 | All Organisms → cellular organisms → Bacteria | 8769 | Open in IMG/M |
| 3300027871|Ga0209397_10161170 | Not Available | 1005 | Open in IMG/M |
| 3300027887|Ga0208980_10012764 | All Organisms → cellular organisms → Bacteria | 4906 | Open in IMG/M |
| 3300027887|Ga0208980_10078516 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 1931 | Open in IMG/M |
| 3300027887|Ga0208980_10585324 | Not Available | 636 | Open in IMG/M |
| 3300027890|Ga0209496_10802199 | Not Available | 520 | Open in IMG/M |
| 3300027917|Ga0209536_100760267 | All Organisms → cellular organisms → Bacteria → FCB group | 1202 | Open in IMG/M |
| 3300027917|Ga0209536_102682968 | Not Available | 583 | Open in IMG/M |
| 3300029304|Ga0119857_1000440 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 21891 | Open in IMG/M |
| 3300031834|Ga0315290_10080137 | All Organisms → cellular organisms → Bacteria | 2718 | Open in IMG/M |
| 3300031949|Ga0214473_10193766 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
| 3300033413|Ga0316603_10879679 | All Organisms → cellular organisms → Bacteria → FCB group | 844 | Open in IMG/M |
| 3300033418|Ga0316625_101712910 | Not Available | 606 | Open in IMG/M |
| 3300033429|Ga0316193_10853461 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 725 | Open in IMG/M |
| 3300033482|Ga0316627_100923422 | All Organisms → cellular organisms → Bacteria → FCB group | 839 | Open in IMG/M |
| 3300033482|Ga0316627_102376110 | Not Available | 557 | Open in IMG/M |
| 3300033483|Ga0316629_10642759 | Not Available | 795 | Open in IMG/M |
| 3300033521|Ga0316616_100028450 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → Ignavibacteriaceae → Ignavibacterium → Ignavibacterium album | 3931 | Open in IMG/M |
| 3300033521|Ga0316616_100600039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | 1293 | Open in IMG/M |
| 3300033521|Ga0316616_102792169 | All Organisms → cellular organisms → Bacteria → FCB group | 658 | Open in IMG/M |
| 3300033557|Ga0316617_102103274 | Not Available | 581 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 33.90% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 10.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.93% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 5.93% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 5.93% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 4.24% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 3.39% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.54% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.54% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.69% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.69% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.85% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.85% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.85% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.85% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.85% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.85% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.85% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.85% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.85% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.85% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.85% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.85% |
| Anaerobic Bioreactor | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Anaerobic Bioreactor | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
| 3300001281 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004001 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 | Environmental | Open in IMG/M |
| 3300004008 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 | Environmental | Open in IMG/M |
| 3300004011 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004015 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004030 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 | Environmental | Open in IMG/M |
| 3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004057 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004146 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004147 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 | Environmental | Open in IMG/M |
| 3300004148 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004266 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005219 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300012675 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2 | Environmental | Open in IMG/M |
| 3300014305 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014313 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300025135 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025550 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025554 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025557 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025568 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025573 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025583 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025599 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025948 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025967 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025976 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025980 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025995 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026072 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026350 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU6 | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300029304 | Anaerobic bioreactor microbial community of Freshwater lake and wastewater samples from Australia - AOM-metagenome-Illumina | Engineered | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBA_SWE12_21mDRAFT_100715442 | 3300000124 | Marine | MMHLKPNKTGAADISEFSGFISTKQNSIISLTKLVVFISVILAVLMVVSR* |
| BS_KBA_SWE02_21mDRAFT_101824301 | 3300000792 | Marine | MQLKPNKGGTADISEFSGFISSKQNSSIMSLTKIVVVISVLLAVLMIVSR* |
| JGI20213J14113_100011111 | 3300001281 | Wetland | MHIKPNKSGTADISEFSGFVSTKQNSIINLTKLVVAISVLFAVLMVVSR* |
| JGI20213J14113_10457371 | 3300001281 | Wetland | MMHIKPNKSGTADISEFSGFVSTKQNSIINLTKLVVAISVLFAVLMVISR* |
| JGI11641J44799_102015032 | 3300002961 | Wetland | MIHIKPNKSGTADISEFSGFVSTKQNKIISLTKLVVAISVLFAVLMVVSR* |
| JGI20214J51088_100049343 | 3300003432 | Wetland | MMHLKTNKNGVADISEFSGYISTKQNISIISVTKLVLVISVLLAVLMVVSK* |
| JGI20214J51088_108056701 | 3300003432 | Wetland | KIKKLFKERTLMHLKPNKNGVADISEFSGYISTKQNSSIISVTKLVLVISVLLALLMVVSK* |
| JGI20214J51088_109998381 | 3300003432 | Wetland | MHLKPNKNGLADISEFSGYISTKQGISIISVTKLVLVISVLFAVLMVVSK* |
| JGI20214J51650_103146631 | 3300003541 | Wetland | MMHLKPNKNGLADISEFSGYISTKQNIGIISVTRLVLVISVLLALLMVISK* |
| JGI20214J51650_105463971 | 3300003541 | Wetland | MHLKPNKNGVADISEFSGYISTKQNSSIISVTKLVLVISVLLALLMVVSK* |
| JGI20214J51650_106548241 | 3300003541 | Wetland | MMHLKPNKNGLADISEFSGYISTKQGISIISVTKLVLVISVLFAVLMVVSK* |
| Ga0055461_101286861 | 3300003991 | Natural And Restored Wetlands | MMHLKPNKGGTADISEFSGIISSKQNSSIISLTKIVVVISVLLAVLMVVSR* |
| Ga0055458_100240172 | 3300004000 | Natural And Restored Wetlands | MMHLKTNKTGGAADISEFSGFISTKQNSIISLTKLVVLISVILAVLMVVSK* |
| Ga0055458_100445912 | 3300004000 | Natural And Restored Wetlands | MMHPKPNKGGTADLSEFSGFISSKQSSSIMSLTKIVVAISVLLAVLMVVSR* |
| Ga0055458_101832131 | 3300004000 | Natural And Restored Wetlands | MMHLKPNKTGAADISEFSGFISTKQNSIISLTKLVVLISVILAVLMVVSR* |
| Ga0055450_100170231 | 3300004001 | Natural And Restored Wetlands | MMQLKSGKTGAADLSEVSGFISTKQNSIISVTKVVVLISVLLALLMVVSK* |
| Ga0055450_101341572 | 3300004001 | Natural And Restored Wetlands | MHFKNNKSGIADISEDFSGYIAIKDGSITNLTKLVVIISVLLAVLMVVSK* |
| Ga0055446_100412022 | 3300004008 | Natural And Restored Wetlands | MMHLKPNKTGTADISEFSGFISTKQNSIISLTKLVVLISVILAVLMVVSR* |
| Ga0055446_102672761 | 3300004008 | Natural And Restored Wetlands | MMNLKPNKGGTADISEFSGFISSKQNSSIMSLTKIVVVISVLLAVLMVVSR* |
| Ga0055460_100530672 | 3300004011 | Natural And Restored Wetlands | MMHLKTNKTGVADISEFSGFISTKQNSIISLTKLVVLVSVILAVLMVVSR* |
| Ga0055460_102937631 | 3300004011 | Natural And Restored Wetlands | MHLKPNRSGMVDISDDSGYISTKQNSIISLTKLVVVISVLLAVLMVVSK* |
| Ga0055462_101496552 | 3300004015 | Natural And Restored Wetlands | MMHLKTNKTGVADISEFSGFISTKQNSIISLTKLVVLISVILAVLMVVSR* |
| Ga0055462_101695061 | 3300004015 | Natural And Restored Wetlands | MMHLKSNKNGVADISDFSGYISSNQNGSIIGITKLVLLISVLLALIMVVSK* |
| Ga0055462_101728522 | 3300004015 | Natural And Restored Wetlands | MMQLKPNRSGMVDISDFSGSISTKQSSIISLTKLVVVISILLAVLMVVSK* |
| Ga0055433_101116731 | 3300004025 | Natural And Restored Wetlands | MYLKPNKNCTADISEFSGFISSKQNDGIVNLTKLVIVVSVLLAVLMVVSR* |
| Ga0055444_100398102 | 3300004030 | Natural And Restored Wetlands | MMQLKSGKSGAADVSEVSGFISTKQNGIISLTKVVVLISVLLALLMVVSK* |
| Ga0055494_101471581 | 3300004048 | Natural And Restored Wetlands | MMHLKPNKSGTADITEFSGFVSTKQNSIMSLTKIVVAISIFLAILMVVSR* |
| Ga0055491_100878922 | 3300004050 | Natural And Restored Wetlands | MMHPKPNKGGTADISEFSGFISSKQSSSIMSLTKIVVAISVLLAVLMVVSR* |
| Ga0055496_101280202 | 3300004057 | Natural And Restored Wetlands | MMHLKPNKNGVADISEFSGYISTKQNSSIISITKLVLVISVLLAVLMVVSK* |
| Ga0055485_102476682 | 3300004067 | Natural And Restored Wetlands | MMHPKPNKGGTADLSEFSGFISSKQSSSIMSLTKIVVAISVLLAVL |
| Ga0055495_100126601 | 3300004146 | Natural And Restored Wetlands | MERTMMHSKSSRTGTANMSEFSGFVSTKQSGIISITKVVILISVLLAVLMVVSK* |
| Ga0055515_100340282 | 3300004147 | Natural And Restored Wetlands | VGIKDKSFKAIIIIFTGRKHMMHLKPNKTGAADISEFSGFISTKQNSIISLTKLVVLISVILAVLMVVSR* |
| Ga0055521_101928142 | 3300004148 | Natural And Restored Wetlands | MKIIFIGREHMMNLKPNKGGTADISEFSGFISSKQNSSIMSLTKIVVVISVLLAVLMVVSR* |
| Ga0055457_100683832 | 3300004266 | Natural And Restored Wetlands | MMHLKTNKTGVADISEFSGFISTKQNSIISLTKLVVLISVILAVLMVVSK* |
| Ga0062383_101820692 | 3300004778 | Wetland Sediment | MMHIKPNKSGTADISEFTGFVSTKQNRIINLTKLVVAISVLFAVLMVVSR* |
| Ga0062380_103874532 | 3300004779 | Wetland Sediment | MMHIKPNKSGTADISEFSGFVSTKQNRIISLTKLVVAISVLFAVLMVVSR* |
| Ga0069004_102997531 | 3300005219 | Natural And Restored Wetlands | MMHLKPNKNGLADISEFSGYISTKQSISIMSVTKLVLVISVLLAVLMVVSK* |
| Ga0074476_13653891 | 3300005825 | Sediment (Intertidal) | MMHLKTNKTGAADISEFSGFISTKQNSIISLTKLVVLISVILAVLMVVSR* |
| Ga0074476_14780842 | 3300005825 | Sediment (Intertidal) | MMHLKPNKGGVADISEFSGFISSKQNSSIMSLTKIVVAISVLLAVLMVVSR* |
| Ga0074470_114059015 | 3300005836 | Sediment (Intertidal) | MMHLKPNRSGMVDISDFSGSISTKQSSIISLTKLVVVISILLAVLMVVSK* |
| Ga0074470_114059019 | 3300005836 | Sediment (Intertidal) | MIHFKPNRSGVADISDFSGNVSTKENSIIGLTKIVIALSVLLAVLMVVSK* |
| Ga0079037_1000894774 | 3300006224 | Freshwater Wetlands | MMHFKPNKSGTADISEFSGFVSTKQSSIISLTKIVVAVSVFLAVLMIVSR* |
| Ga0079037_1003521541 | 3300006224 | Freshwater Wetlands | MEEHMMHLKPNKNGTADISEFSGFVSSKQNRIISLTKLVVAISFLFAVLMVVSR* |
| Ga0079037_1006804321 | 3300006224 | Freshwater Wetlands | MMHIKPNKGGTADISEFSGFVSTKQNSIISLTKLVVAISFLFAVLMVVSR* |
| Ga0099972_119240703 | 3300006467 | Marine | MMQLKPNKGGTADISEVSGFISTKQNSIISLTKLVVVISVILAVLMVVSR* |
| Ga0079303_100067762 | 3300006930 | Deep Subsurface | MMHLKPNKNGIADITEFSGFITSKPNNSILSLTKLVVAISVLFALLMVVSR* |
| Ga0105093_100505772 | 3300009037 | Freshwater Sediment | MMHIKPNKSGTADISEFSGFVSTKQNRIISLTKLVVAISVLFAVLMVISR* |
| Ga0105095_101367262 | 3300009053 | Freshwater Sediment | MMHIKPNKSGIADISEFSGFVSTKQNRIISLTKLVVAISVLFAVLMVISR* |
| Ga0105106_100322521 | 3300009078 | Freshwater Sediment | NKNGVADISDFSGYITTKQNSIINVTKLVVIISVLLAVLMVVSR* |
| Ga0105107_100117746 | 3300009087 | Freshwater Sediment | MMHLKTNKNGVADISDFSGYITTKQNSIINVTKLVVIISVLLAVLMVVSR* |
| Ga0105107_102793112 | 3300009087 | Freshwater Sediment | MHLKPNKSGTADISEFSGFVSTKQNRIISLTKLVVAISVLFAVLMVISR* |
| Ga0102851_102898402 | 3300009091 | Freshwater Wetlands | MMHIKPSKSGTAGISEFSGFVSTKQSSIISLTKIVVAVSVFLAVLMIVSR* |
| Ga0102851_108510081 | 3300009091 | Freshwater Wetlands | KNGTADISEFSGFVSSKQNRIISLTKLVVAISFLFAVLMVVSR* |
| Ga0102851_120367592 | 3300009091 | Freshwater Wetlands | MHFKPNKSGTADISEFSGFVSTKQSSIISLTKIVVAVSVFLAVLMIVSR* |
| Ga0102851_126363091 | 3300009091 | Freshwater Wetlands | MMHLKPNKNGTADVAEFSGFVSSKQNGIISLTKIVVAISIFLAVLMIVAK* |
| Ga0115026_102854731 | 3300009111 | Wetland | MMHIKPNKSGTADISEFSGFVSSKQNRIIGLTKMVITISVILAVLMIVSR* |
| Ga0115027_103299351 | 3300009131 | Wetland | MHIKPNKSGTADISEFSGFVSSKQNRIISLTKLVVAISFLFAVLMVVSR* |
| Ga0115027_106060862 | 3300009131 | Wetland | MMHLKPNKNGTADVAEFSGFVSSKQNGIISLTKIVVAISIFL |
| Ga0114946_100256025 | 3300009504 | Sediment | MMHLKTNKSGAANISEFSGFISAKENKIISLTKIVVMISIILAVLMIVSR* |
| Ga0114946_102594912 | 3300009504 | Sediment | MMHLKTNKVGAANISEFSGFISAKENKIISLTKIVLILSVALAVIMVVSK* |
| Ga0118657_102369902 | 3300009506 | Mangrove Sediment | MMHLKPNKNGLANVSDFSGYISSRQNDSFIGITKLVLIISVLLAVIMVVSR* |
| Ga0130016_100679632 | 3300009868 | Wastewater | MMHLKPNKNGTADVAEFSGFVSTKHNGVITLTKIVLSISIIFAVLMILLK* |
| Ga0136852_117904301 | 3300010412 | Mangrove Sediment | NGVANVSDFSGYISTRQNGSIIGIAKLVLIISVLLAVIMVVAK* |
| Ga0118733_1001502795 | 3300010430 | Marine Sediment | MMHLKPNKSGTADISEVSGFISTKQNSIISLTKLVVVISVILAVLMVVSR* |
| Ga0137337_10043252 | 3300012675 | Soil | MMHLKPNRSGTANISELSEFISSKQNNSIINLTKLVVVISVILAVLMVVSR* |
| Ga0137337_10054842 | 3300012675 | Soil | MHLKPDKNGIADITEFSGFISSKQNSGIISITKLVLAISILLAVLMVVSR* |
| Ga0075349_11721051 | 3300014305 | Natural And Restored Wetlands | KFRVKTFYIRRKHMMHPKPNKGGTADLSEFSGFISSKQSSSIMSLTKIVVAISVLLAVLMVVSR* |
| Ga0075347_10110611 | 3300014313 | Natural And Restored Wetlands | MERTMMHSKSGRTGTANMSEFSGFVSTKQSGIISITKVVILISVLLAVLMVVSK* |
| Ga0075350_11515331 | 3300014315 | Natural And Restored Wetlands | MMHLKSNKNGVADISDFSGYISSNQNGSIIGITKLVLLISVLLAVIMVVSK* |
| Ga0075348_10363842 | 3300014319 | Natural And Restored Wetlands | MERTMMHSKSSRTGTADMSEFSGFVSTKQSGIISITKVVILISVLLAVLMVVSK* |
| Ga0075355_10253681 | 3300014322 | Natural And Restored Wetlands | KPNKNGLADISEFSGYISTKQGISIISVTKLVLVISVLFAVLMVVSK* |
| Ga0224502_101490282 | 3300022218 | Sediment | MMQLKPNKGGVADFSEFSGFISSKQHNGIISLTKLVVAISVVLALLMVVSR |
| Ga0209498_10017795 | 3300025135 | Sediment | MMHLKTNKSGAANISEFSGFISAKENKIISLTKIVVMISIILAVLMIVSR |
| Ga0209640_100240385 | 3300025324 | Soil | MMHIKPNKSGTADISEFSGFVSTKQNSIISLTKIVVAISVFLAVLMIVSR |
| Ga0210098_10405162 | 3300025550 | Natural And Restored Wetlands | MMHLKTNKTGVADISEFSGFISTKQNSIISLTKLVVLVSVILAVLMVVSR |
| Ga0210060_10109852 | 3300025554 | Natural And Restored Wetlands | MMHLKTNKTGGAADISEFSGFISTKQNSIISLTKLVVLISVILAVLMVVSK |
| Ga0210060_10294601 | 3300025554 | Natural And Restored Wetlands | MMHLKPNKGGTADISEFSGIISSKQNSSIISLTKIVVVISVLLAVLMVVSR |
| Ga0210141_10219301 | 3300025557 | Natural And Restored Wetlands | MQLKSSRSGTADISEVSGFISTKQNGIISLTKVVVLISVLLALL |
| Ga0210141_10666911 | 3300025557 | Natural And Restored Wetlands | MMHLKPNKTGTADISEFSGFISTKQNSIISLTKLVVLLSVILAVLMVVSR |
| Ga0210095_10440122 | 3300025568 | Natural And Restored Wetlands | MMQLKSGKTGAADLSEVSGFISTKQNSIISVTKVVVLISVLLALLMVVSK |
| Ga0210133_10706381 | 3300025573 | Natural And Restored Wetlands | MMHLKSNKNGVADISDFSGYISSNQNGSIIGITKLVLLISVLLALIMVVSK |
| Ga0210085_10265131 | 3300025583 | Natural And Restored Wetlands | MHLKSGKNSAADISEVSGFISTKQNGIISLTKVVVLISVLLALLMVVSK |
| Ga0210085_11339892 | 3300025583 | Natural And Restored Wetlands | MKGYIMHFKNNKSGIADISEDFSGYIAIKDGSITNLTKLVVIISVLLAVLMVVSK |
| Ga0210074_100028012 | 3300025599 | Natural And Restored Wetlands | MMHLKTNKGSIADIQDFSGYISTKQSSIISLTKIVVAISILLAVLMVVSK |
| Ga0210074_10421002 | 3300025599 | Natural And Restored Wetlands | MMQLKSGKSGAADVSEVSGFISTKQNGIISLTKVVVLISVLLALLMVVSK |
| Ga0210074_11300872 | 3300025599 | Natural And Restored Wetlands | MERTMMHLKTNKDSVADIQDFSGYISTKQSSIMSLTKIVVAISILLAVLMVVSK |
| Ga0210088_10060821 | 3300025948 | Natural And Restored Wetlands | MMHPKPNKGGTADISEFSGFISSKQSSSIMSLTKIVVAISVLLAVLMVVSR |
| Ga0210136_10850902 | 3300025967 | Natural And Restored Wetlands | MHLKPNKNGVADISEFSGYISTKQNSSIISVTKLVLVISVLLALLMVVSK |
| Ga0210093_10412421 | 3300025976 | Natural And Restored Wetlands | MKIIFIGREHMMNLKPNKGGTADISEFSGFISSKQNSSIMSLTKIVVVISVLLAVLMVVS |
| Ga0210137_10781571 | 3300025980 | Natural And Restored Wetlands | MMHLKTNKNGVADISEFSGYISTKQNISIISVTKLVLVISVLLAVLMVVSK |
| Ga0210079_10283631 | 3300025995 | Natural And Restored Wetlands | MMHLKPNKTGAADISEFSGFISTKQNSIISLTKLVVLISVILAVLMVVSR |
| Ga0208292_10571341 | 3300026072 | Natural And Restored Wetlands | MERTMMHSKSGRTGTANMSEFSGFVSTKQSGIISITKVVILISVLLAVLMVVSK |
| Ga0256823_10028542 | 3300026350 | Sediment | MMHLKSNKNGVADISDFSGYISSNQNGSIIGITKLVLLISVLLAVIMVV |
| Ga0209286_10124201 | 3300027713 | Freshwater Sediment | MMHIKPNKSGTADISEFSGFVSTKQNRIISLTKLVVAISVLFAVLMVISR |
| Ga0208665_100100474 | 3300027715 | Deep Subsurface | MMHLKPNKNGIADITEFSGFITSKPNNSILSLTKLVVAISVLFALLMVVSR |
| Ga0209706_100535372 | 3300027818 | Freshwater Sediment | MMHLKTNKNGVADISDFSGYITTKQNSIINVTKLVVIISVLLAVLMVVSR |
| Ga0209797_100437322 | 3300027831 | Wetland Sediment | MMHIKPNKSGTADISEFSGFVSTKQNRIISLTKLVVAISVLFAVLMVVSR |
| Ga0209013_1000816311 | 3300027858 | Marine | MMQLKPNKGGTADISEVSGFISTKQNSIISLTKLVVVISVILAVLMVVSR |
| Ga0209397_101611702 | 3300027871 | Wetland | MMHFKPNKSGTADISEFSGFVSTKQSSIISLTKIVVAVSVFLAVLMIVSR |
| Ga0208980_100127646 | 3300027887 | Wetland | MHIKPNKSGTADISEFSGFVSTKQNSIINLTKLVVAISVLFAVLMVVSR |
| Ga0208980_100785161 | 3300027887 | Wetland | MIHIKPNKSGTADISEFSGFVSTKQNKIISLTKLVVAISVLFAVLMVVSR |
| Ga0208980_105853241 | 3300027887 | Wetland | RTLMHLKPNKNGVADISEFSGYIPTKQNSSIISVTKLVLVISVLLALLMVISK |
| Ga0209496_108021991 | 3300027890 | Wetland | MMHIKPNKSGTADISEFSGFVSSKQNRIIGLTKMVITISVILAVLMIVSR |
| Ga0209536_1007602671 | 3300027917 | Marine Sediment | KSNKTGTADLSEFSGFISTKQNGIISITKVVIMISVLLAVLMIVSK |
| Ga0209536_1026829682 | 3300027917 | Marine Sediment | MMHLKPNKNGVANVSDFSGYISSNQNGSIIGITKLVLIISVVLAVIMVVSK |
| Ga0119857_10004405 | 3300029304 | Anaerobic Bioreactor | MIQLKPNKNGTADVNEFSGFVSTKHNGVTNLTKIVLAISVLLAVLMFVSK |
| Ga0315290_100801374 | 3300031834 | Sediment | MMHLKPNKNGIADISEFSGFISSKQNSGIISLTKLVLAISILLAVLMVISR |
| Ga0214473_101937664 | 3300031949 | Soil | MIHIKPNKSGTADISEFSGFVSTKQNSIISLTKIVVAISVFLAVLMIVSR |
| Ga0316603_108796791 | 3300033413 | Soil | MHIKPNKSGTADISEFSGFVSTKQNSIISLTKLVVAISFLFAVLMVVSR |
| Ga0316625_1017129101 | 3300033418 | Soil | MMHIKPNKSGTADISEFSGFVSTKQNRIISLTKMVITISVILAVLMIVSR |
| Ga0316193_108534612 | 3300033429 | Sediment | MHLKPNKSGTADISEVSGFISTKQNSIISLTKLVVVISVLLAVLMIVSR |
| Ga0316627_1009234223 | 3300033482 | Soil | LKPNKNGTADISEFSGFVSSKQNRIISLTKLVVAISFLFAVLMVVSR |
| Ga0316627_1023761101 | 3300033482 | Soil | MGGHMMHLKPNKNGIADITEFSGFITSKPNNSILSLTKLVVAISILFALLMVVSR |
| Ga0316629_106427592 | 3300033483 | Soil | MGGHMMHLKPNKNGIADITEFSGFITSKPNNSILSLTKLVVAISVLFALLMVVSR |
| Ga0316616_1000284505 | 3300033521 | Soil | MMHLRSNRSGIVDISEVSGFISTKQNSIISLTKLVVLISVILAVLMVISR |
| Ga0316616_1006000391 | 3300033521 | Soil | MMHLKPNKNGIADITEFSGFITSKPNNSILSLTKLVVAISILFALLMVVSR |
| Ga0316616_1027921691 | 3300033521 | Soil | MHLKPNKNGTADVAEFSGFVSSKQNGIISLTKIVVAISIFLAVLMIVAK |
| Ga0316617_1021032741 | 3300033557 | Soil | MMHIKPSKSGTAGISEFSGFVSTKQSSIISLTKIVVAVSVFLAVLMIVSR |
| ⦗Top⦘ |