| Basic Information | |
|---|---|
| Family ID | F076151 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VSASVLKTSVNSKSPEFEKNARRIVDLLTKIKNEEEQIRQ |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.46 % |
| % of genes near scaffold ends (potentially truncated) | 99.15 % |
| % of genes from short scaffolds (< 2000 bps) | 87.29 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.644 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.966 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.966 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.695 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF02310 | B12-binding | 9.32 |
| PF03193 | RsgA_GTPase | 9.32 |
| PF00675 | Peptidase_M16 | 7.63 |
| PF12779 | WXXGXW | 4.24 |
| PF13480 | Acetyltransf_6 | 3.39 |
| PF05193 | Peptidase_M16_C | 3.39 |
| PF00144 | Beta-lactamase | 3.39 |
| PF07110 | EthD | 1.69 |
| PF00583 | Acetyltransf_1 | 1.69 |
| PF01642 | MM_CoA_mutase | 1.69 |
| PF13366 | PDDEXK_3 | 0.85 |
| PF13620 | CarboxypepD_reg | 0.85 |
| PF07715 | Plug | 0.85 |
| PF00034 | Cytochrom_C | 0.85 |
| PF11954 | DUF3471 | 0.85 |
| PF13689 | DUF4154 | 0.85 |
| PF00375 | SDF | 0.85 |
| PF00156 | Pribosyltran | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 9.32 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 3.39 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.39 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 3.39 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 1.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.64 % |
| Unclassified | root | N/A | 31.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10135007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
| 3300002912|JGI25386J43895_10121902 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300004082|Ga0062384_100301793 | Not Available | 995 | Open in IMG/M |
| 3300004479|Ga0062595_101987120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio coralliilyticus | 561 | Open in IMG/M |
| 3300005332|Ga0066388_108429306 | Not Available | 513 | Open in IMG/M |
| 3300005468|Ga0070707_101167892 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005529|Ga0070741_10903620 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005537|Ga0070730_10915605 | Not Available | 549 | Open in IMG/M |
| 3300005574|Ga0066694_10139566 | Not Available | 1146 | Open in IMG/M |
| 3300006050|Ga0075028_100999680 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006354|Ga0075021_11073995 | Not Available | 526 | Open in IMG/M |
| 3300006755|Ga0079222_11351015 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006794|Ga0066658_10924962 | Not Available | 504 | Open in IMG/M |
| 3300006804|Ga0079221_11513099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300007255|Ga0099791_10474445 | Not Available | 606 | Open in IMG/M |
| 3300007265|Ga0099794_10362227 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300009012|Ga0066710_100127499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3485 | Open in IMG/M |
| 3300009038|Ga0099829_10260530 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300009088|Ga0099830_11869303 | Not Available | 502 | Open in IMG/M |
| 3300009090|Ga0099827_10169588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1798 | Open in IMG/M |
| 3300009090|Ga0099827_11035156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300010325|Ga0134064_10500979 | Not Available | 504 | Open in IMG/M |
| 3300010358|Ga0126370_12232676 | Not Available | 540 | Open in IMG/M |
| 3300010360|Ga0126372_10041834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3009 | Open in IMG/M |
| 3300010366|Ga0126379_10010140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6574 | Open in IMG/M |
| 3300010366|Ga0126379_13631385 | Not Available | 517 | Open in IMG/M |
| 3300010401|Ga0134121_12992226 | Not Available | 520 | Open in IMG/M |
| 3300011269|Ga0137392_10286101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1361 | Open in IMG/M |
| 3300012096|Ga0137389_10202018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1655 | Open in IMG/M |
| 3300012202|Ga0137363_10513726 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300012203|Ga0137399_10432491 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300012205|Ga0137362_10510903 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300012205|Ga0137362_11529904 | Not Available | 554 | Open in IMG/M |
| 3300012206|Ga0137380_10188878 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300012206|Ga0137380_10481120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
| 3300012685|Ga0137397_10254621 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300012918|Ga0137396_11158955 | Not Available | 548 | Open in IMG/M |
| 3300012923|Ga0137359_10211171 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300012929|Ga0137404_10436725 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300012930|Ga0137407_11266588 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012931|Ga0153915_11616639 | Not Available | 758 | Open in IMG/M |
| 3300015054|Ga0137420_1146504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 769 | Open in IMG/M |
| 3300015242|Ga0137412_10002292 | All Organisms → cellular organisms → Bacteria | 15122 | Open in IMG/M |
| 3300016319|Ga0182033_11009759 | Not Available | 740 | Open in IMG/M |
| 3300016341|Ga0182035_10626328 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300016445|Ga0182038_10115907 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
| 3300017924|Ga0187820_1007487 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
| 3300017955|Ga0187817_10084435 | Not Available | 1987 | Open in IMG/M |
| 3300017970|Ga0187783_10120827 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
| 3300018090|Ga0187770_10124993 | All Organisms → cellular organisms → Bacteria | 1942 | Open in IMG/M |
| 3300018433|Ga0066667_10899692 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300018482|Ga0066669_11529355 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300020580|Ga0210403_11091634 | Not Available | 620 | Open in IMG/M |
| 3300020580|Ga0210403_11230466 | Not Available | 575 | Open in IMG/M |
| 3300020581|Ga0210399_10052242 | All Organisms → cellular organisms → Bacteria | 3284 | Open in IMG/M |
| 3300021086|Ga0179596_10483272 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300021168|Ga0210406_11137675 | Not Available | 572 | Open in IMG/M |
| 3300021178|Ga0210408_10533905 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300021181|Ga0210388_10585875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300021401|Ga0210393_10071737 | All Organisms → cellular organisms → Bacteria | 2734 | Open in IMG/M |
| 3300021401|Ga0210393_10290817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1327 | Open in IMG/M |
| 3300021401|Ga0210393_11288020 | Not Available | 586 | Open in IMG/M |
| 3300021405|Ga0210387_11674448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300021406|Ga0210386_10854558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300021407|Ga0210383_10084124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2667 | Open in IMG/M |
| 3300021420|Ga0210394_10387070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1230 | Open in IMG/M |
| 3300021420|Ga0210394_10858114 | Not Available | 791 | Open in IMG/M |
| 3300021433|Ga0210391_11248886 | Not Available | 574 | Open in IMG/M |
| 3300021474|Ga0210390_10403462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
| 3300021477|Ga0210398_11110079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300021478|Ga0210402_11443098 | Not Available | 615 | Open in IMG/M |
| 3300021560|Ga0126371_13125443 | Not Available | 560 | Open in IMG/M |
| 3300024290|Ga0247667_1007369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2285 | Open in IMG/M |
| 3300025927|Ga0207687_10464890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300025934|Ga0207686_10570422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300026298|Ga0209236_1028379 | All Organisms → cellular organisms → Bacteria | 3024 | Open in IMG/M |
| 3300026314|Ga0209268_1005427 | All Organisms → cellular organisms → Bacteria | 5602 | Open in IMG/M |
| 3300026318|Ga0209471_1316774 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026499|Ga0257181_1019431 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300026499|Ga0257181_1021015 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300026507|Ga0257165_1063723 | Not Available | 670 | Open in IMG/M |
| 3300026514|Ga0257168_1078939 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300026538|Ga0209056_10375437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium IMCC9480 | 906 | Open in IMG/M |
| 3300026542|Ga0209805_1404204 | Not Available | 526 | Open in IMG/M |
| 3300026551|Ga0209648_10316186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
| 3300026557|Ga0179587_10758083 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300026557|Ga0179587_11168575 | Not Available | 506 | Open in IMG/M |
| 3300026983|Ga0207856_1055136 | Not Available | 510 | Open in IMG/M |
| 3300027023|Ga0207736_112411 | Not Available | 511 | Open in IMG/M |
| 3300027643|Ga0209076_1134332 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300027671|Ga0209588_1171367 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium RBG_13_63_10 | 683 | Open in IMG/M |
| 3300027882|Ga0209590_10599325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300027882|Ga0209590_10649142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300028536|Ga0137415_10118458 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
| 3300028536|Ga0137415_10433956 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300028536|Ga0137415_10564844 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300028536|Ga0137415_11064173 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300029636|Ga0222749_10077874 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300031057|Ga0170834_105185474 | Not Available | 630 | Open in IMG/M |
| 3300031231|Ga0170824_128208270 | Not Available | 677 | Open in IMG/M |
| 3300031715|Ga0307476_10843021 | Not Available | 677 | Open in IMG/M |
| 3300031763|Ga0318537_10122871 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300031823|Ga0307478_11777202 | Not Available | 507 | Open in IMG/M |
| 3300031879|Ga0306919_10283447 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300031897|Ga0318520_10020987 | All Organisms → cellular organisms → Bacteria | 3112 | Open in IMG/M |
| 3300031897|Ga0318520_10237443 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300031941|Ga0310912_10972853 | Not Available | 651 | Open in IMG/M |
| 3300031942|Ga0310916_11183518 | Not Available | 632 | Open in IMG/M |
| 3300031945|Ga0310913_10171819 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300031946|Ga0310910_11067242 | Not Available | 630 | Open in IMG/M |
| 3300031947|Ga0310909_10220914 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300031962|Ga0307479_11279928 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300032076|Ga0306924_10518857 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300032180|Ga0307471_102594545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300032205|Ga0307472_101079739 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300032261|Ga0306920_100359284 | All Organisms → cellular organisms → Bacteria | 2166 | Open in IMG/M |
| 3300032955|Ga0335076_10044360 | All Organisms → cellular organisms → Bacteria | 4428 | Open in IMG/M |
| 3300033289|Ga0310914_10526698 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.08% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.69% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.85% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026983 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 21 (SPAdes) | Environmental | Open in IMG/M |
| 3300027023 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_101350072 | 3300002558 | Grasslands Soil | VSDSVLKTSANRKSPEFERNSRRIVDLLTKIKNEEEQIRQGGGEK |
| JGI25386J43895_101219022 | 3300002912 | Grasslands Soil | VSDSVLKTSANRKSPEFERNSRRIVDLLTKIKNEEEQIRQ |
| Ga0062384_1003017931 | 3300004082 | Bog Forest Soil | VSASVLKTSVNKKSPEFEKNTRKVIDLVTQIKNEEEQISRGGG |
| Ga0062595_1019871201 | 3300004479 | Soil | VAASVLKTSAKAKSPDFEKNHRRIIDLLTKIKNEEEQIRQGGG |
| Ga0066388_1084293062 | 3300005332 | Tropical Forest Soil | VSSSVLKTSVNSKAPQYDKNADRMTDLLTEIKNQEEKIREG |
| Ga0070707_1011678922 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VSASVLKTSVNSKSPEFEKNARRIVDLLTKIKNEEETIRQG |
| Ga0070741_109036202 | 3300005529 | Surface Soil | VTASILKTTAKPKSPEFEKNSRRIVELLTEIKNEEEQI |
| Ga0070730_109156051 | 3300005537 | Surface Soil | VPASTLSSNVNRKSPDFEKNTRRIIELLTQIKNEE |
| Ga0066694_101395663 | 3300005574 | Soil | VSAPVLKTAANRKSPDFEKNTRRIIDLLTEIKNEEEQ |
| Ga0075028_1009996802 | 3300006050 | Watersheds | VPDSVLKTSANRKSPEFEKNARRIVDLLTKIKNEEEQIRQGGGVK |
| Ga0075021_110739952 | 3300006354 | Watersheds | VSSSVLKTDVNPKSPQFEKNTRQMSELLTEIKNEEVQLR |
| Ga0079222_113510152 | 3300006755 | Agricultural Soil | VSASVLKTTANLKSPEFEKNTRHIVDLLTKIKNEEEQIRQGGG |
| Ga0066658_109249622 | 3300006794 | Soil | VSASVLKTSANRKSPEFEKNARRVADLLTIIKNEE |
| Ga0079221_115130992 | 3300006804 | Agricultural Soil | VSASVLKTAANRKSPEFEKNTRRMIDLLTEIKNEEEQIRQG |
| Ga0099791_104744452 | 3300007255 | Vadose Zone Soil | VSASVLKTSVNLKSPEFEKNARRIVDLLTKIKNEEEQIRQGGG |
| Ga0099794_103622271 | 3300007265 | Vadose Zone Soil | VAASTLKTIVNTKSPEFEKNTRRMIDLVTQIKNEEEQIFQGGGAK |
| Ga0066710_1001274994 | 3300009012 | Grasslands Soil | VSGSVLKTAANRKSPEFEKNTRRIVDLLTEIKNEEEEIRQ |
| Ga0099829_102605302 | 3300009038 | Vadose Zone Soil | VSASVLKTSANLKSPEFEKNARRIVDLLTKIKNEEEQIREGG |
| Ga0099830_118693031 | 3300009088 | Vadose Zone Soil | VAASALKTNVNTKSPEFEKNTRRMIDLVTQIKNEEEQIQQG |
| Ga0099827_101695881 | 3300009090 | Vadose Zone Soil | VSDSVLKTSANLKSPEFEKNARRIVDLLTRIKNEEEQ |
| Ga0099827_110351562 | 3300009090 | Vadose Zone Soil | VSASVLKTSANRKSPEFEKNTRRIVDLLTEIKNEEE |
| Ga0134064_105009792 | 3300010325 | Grasslands Soil | VNRKSPDFEKNTRRIIDLLTQIKNEEQKIREGGGAKALES |
| Ga0126370_122326761 | 3300010358 | Tropical Forest Soil | VSSSALKTAANRKSPDFEKNTRRIVDLLSQIKNEEEQIRQGGG |
| Ga0126372_100418344 | 3300010360 | Tropical Forest Soil | VPASTLSSNVNRKSPDFEKNTRRIIELLTQIKNEEQKIREGGGA |
| Ga0126379_100101401 | 3300010366 | Tropical Forest Soil | VSASVLKTSANPNSPQFEKNARQMADLLTMIKNEEETIRE |
| Ga0126379_136313851 | 3300010366 | Tropical Forest Soil | VSSSVLKTSVNSKAPQYDKNADRMTDLLTEIKNEE |
| Ga0134121_129922261 | 3300010401 | Terrestrial Soil | VPASVLKTAVNTKSPDFAKNSRKVVDLVTQIKNEETQIAQGGGAKAIE |
| Ga0137392_102861013 | 3300011269 | Vadose Zone Soil | VSDSVLKTNANRKSPEFEKNARRIVDLLTKIKNEEEQIRQGG |
| Ga0137389_102020182 | 3300012096 | Vadose Zone Soil | VSDSVLKTSANLKSPEFEKNARRIVDLLTKIKNEEEQIFQ |
| Ga0137363_105137263 | 3300012202 | Vadose Zone Soil | VSSSVLKTAINAKSPDFEKNSQRMVELLTTIKNEEEKIRQ |
| Ga0137399_104324912 | 3300012203 | Vadose Zone Soil | VSVSVLKTSANRKSPEFEKNARRIVDLLTEIKNEE |
| Ga0137362_105109031 | 3300012205 | Vadose Zone Soil | VSASVLKTSVNSKSPEFEKNARRIVDLLTKIKNEEEQIRQ |
| Ga0137362_115299041 | 3300012205 | Vadose Zone Soil | VPDSVLKTSTSLKSPEFEKNARRIVDLLTKIKNEEEQ |
| Ga0137380_101888784 | 3300012206 | Vadose Zone Soil | VSGSALKSTLNLKSPDYPKNTRRIVDFLTEIKNEEERIRQGGGP |
| Ga0137380_104811202 | 3300012206 | Vadose Zone Soil | VSASVLKTSANRKSPEFEKNTRRIVDLLTEIKNEEEKIR |
| Ga0137397_102546212 | 3300012685 | Vadose Zone Soil | VSASVLKTSVNSKSPEFEKNARRIVDLLTKIKNEEETIR |
| Ga0137396_111589551 | 3300012918 | Vadose Zone Soil | VSASVLNTSVNSKSPEFEKNARRIVDLLTRIKNEEEQIRQGGG |
| Ga0137359_102111712 | 3300012923 | Vadose Zone Soil | VAASTLKTNVNTKSAEFEKNTRRMIDLVTQIKNEEE |
| Ga0137404_104367251 | 3300012929 | Vadose Zone Soil | LYDFVRGLRVSASVLKTSVNKKSPEFETNTRKVIDLVAQIKNEEE |
| Ga0137407_112665881 | 3300012930 | Vadose Zone Soil | VSDSVLKTSANIKSPEFEKNARRIVNLLTKIKNEEEQIF |
| Ga0153915_116166392 | 3300012931 | Freshwater Wetlands | VSDSALKSKLNVHSPECEKNARRIVDLLTEMKNEEERIRQ |
| Ga0137420_11465042 | 3300015054 | Vadose Zone Soil | VSASVLKTAINAKSPDFEKNSQRMVELLTAIKNEEEKIRQGGGAK |
| Ga0137412_1000229214 | 3300015242 | Vadose Zone Soil | VSDSVLKTSANLKSPEFEKNARRIVDLLTKIKNEEEQIFQGG |
| Ga0182033_110097591 | 3300016319 | Soil | VSASVLKTSINPKSPQFEKNAHQMADPLTTIKNEEETIR |
| Ga0182035_106263281 | 3300016341 | Soil | VSASVLKTSANPKSPQFEKNARQMADLLTMIKNEEETIREGG |
| Ga0182038_101159074 | 3300016445 | Soil | VSASVLKTSVNSKSPQFEKNARQMADLLTTIKNEEETLR |
| Ga0187820_10074874 | 3300017924 | Freshwater Sediment | VAASVLKTSINAKSPNFEKNHRLFIDLLTKIKNEEE |
| Ga0187817_100844352 | 3300017955 | Freshwater Sediment | VSASVLKTTVNVKSPEFEKNARRIVDLLTKIKNEEE |
| Ga0187783_101208274 | 3300017970 | Tropical Peatland | LSSSVLQSTINLKSPEFEKNSRLMIDRLTEIKTEEEKIR |
| Ga0187770_101249931 | 3300018090 | Tropical Peatland | MHRGKRVSTLKSSANPKSPHFEKNSHQMVELLTGLKNEEEKIRE |
| Ga0066667_108996922 | 3300018433 | Grasslands Soil | VSASVLKTSANLKSPEFEKNARRVVDVLTKVTNEEE |
| Ga0066669_115293552 | 3300018482 | Grasslands Soil | VSASVLKTTVNLKSPEFEKNTRRIVDLMTKIKNEEEQIR |
| Ga0210403_110916342 | 3300020580 | Soil | VSDSVLKTSANLKSPEFEKNARRIVDLLTKIKNEEEQIFQGGGTKAIE |
| Ga0210403_112304661 | 3300020580 | Soil | VSASVLKTTIDAKSPDFQKNSQRMVELLTAIKNEEEEIR |
| Ga0210399_100522423 | 3300020581 | Soil | VSDSVLKTSANRKSPEFEKNARRIVDLLTKIKNEEEQIFQ |
| Ga0179596_104832722 | 3300021086 | Vadose Zone Soil | VAASVLKTNVNTKSPEFENNTRRMIDLVTQIKNEEEQIAVGGGAKAI |
| Ga0210406_111376752 | 3300021168 | Soil | LSASILKSTVNLKSPEFEKNSRRLIDLMTGLKNEEVQIS |
| Ga0210408_105339052 | 3300021178 | Soil | VSDSVLKTSANRKSPEFEKNARRIVDLLTKIKNEE |
| Ga0210388_105858751 | 3300021181 | Soil | VSASVLKTSVNAKSPDFAKNSRKVVDLVTQIKNEEE |
| Ga0210393_100717371 | 3300021401 | Soil | VSASVLKTSVNSKSPEFEKNTRKVIDLVTQIKNEEEQISRGGGAKAI |
| Ga0210393_102908172 | 3300021401 | Soil | VAASVLKTSVKAKSPDFEKNHRRIIDLLTKIKNEEEQI |
| Ga0210393_112880201 | 3300021401 | Soil | VAASVLKTSVKAKSPDFERNHRRIIDLLTKIKNEEEQIRQGG |
| Ga0210387_116744481 | 3300021405 | Soil | VSSSVLKTSANLKSPEFEKNSRRIVDLLTKFKNEE |
| Ga0210386_108545582 | 3300021406 | Soil | VAASVLKTSVKAKSPDFEKNHRRLIDLLTKIKNEEEQILQGGG |
| Ga0210383_100841244 | 3300021407 | Soil | VAASVLKTSVKAKSPDFEKNHRRTIDLLTKIKNEE |
| Ga0210394_103870701 | 3300021420 | Soil | VSSSVLKTSVNTKSPDFEKNARRIADLLAAFKKDE |
| Ga0210394_108581142 | 3300021420 | Soil | VSASVLKTSANLKSAEFEKNTRRIIELLTQLKNEE |
| Ga0210391_112488861 | 3300021433 | Soil | VSASVLKTSVNSKSPEFEKNTRKVIDLVTQIKNEEEQISRGG |
| Ga0210390_104034621 | 3300021474 | Soil | VSASVLKTSVNAKSPDFAKNSRKVVDLVTQIKNEEEQICQGG |
| Ga0210398_111100791 | 3300021477 | Soil | VAASVLKTSVKVKSPDFEKNHRRIIDLLTKIKNEEEQILQG |
| Ga0210402_114430981 | 3300021478 | Soil | VSASVLETSINTKSPEFEKNFQRMVELLTVIKNEEEKIRQGGGA |
| Ga0126371_131254432 | 3300021560 | Tropical Forest Soil | LSAATPQSTVNTKSPEFEKNSHRLIDLMSQIKNEEAQIAQGGG |
| Ga0247667_10073691 | 3300024290 | Soil | VAASVLKTSVNAKSPDFERNHRLFIDLLTKIKNEEEAIRQGGGSKAIASQ |
| Ga0207687_104648902 | 3300025927 | Miscanthus Rhizosphere | VSGSVLKTSVNTKSPDFARNSRKVVDLVSQIKNEEEQISA |
| Ga0207686_105704221 | 3300025934 | Miscanthus Rhizosphere | VSGSVLKTSVNTKSPDFARNSRKVVDLVSQIKNEEEQI |
| Ga0209236_10283791 | 3300026298 | Grasslands Soil | VSGSVLKTAANRKSPEFEKNTRRIVDLLTEIKNEEEE |
| Ga0209268_10054271 | 3300026314 | Soil | VAGSVLKTAANRKSPDFEKNTRRIVDLLTEIKNEEE |
| Ga0209471_13167742 | 3300026318 | Soil | VSDSVLKTSANRKSPEFEKNARRAIDLLTTIKNEEE |
| Ga0257181_10194312 | 3300026499 | Soil | VAASILKTNVNTKSPEFEKNTRRMIDLVTQIKNEEEQI |
| Ga0257181_10210151 | 3300026499 | Soil | VSDSVLKTSANLKSPEFEKNARRIVDLLTKIKNEEEQIRQG |
| Ga0257165_10637232 | 3300026507 | Soil | VPASTLSSNVNRKSPDFEKNTRRIIDLLTQIKNEEQKIREGGGA |
| Ga0257168_10789391 | 3300026514 | Soil | VAASILKTNVNTKSPEFEKNTRRMIDLVTQIKNEEEQIAVG |
| Ga0209056_103754371 | 3300026538 | Soil | VSASVLKTTANLKSPEFEKNTRRIVDLLTKIKNEEEQIRQ |
| Ga0209805_14042042 | 3300026542 | Soil | VSASVLKTTANLKSPEFEKNTRRIVDLLTKIKNEEE |
| Ga0209648_103161861 | 3300026551 | Grasslands Soil | VSASVLKTTANLKSPEFEKNTRRIVDLLTKIKNEE |
| Ga0179587_107580832 | 3300026557 | Vadose Zone Soil | VAASTLKTNVNPKSAEFEKNTRRMIDLVTQIKNDEEQI |
| Ga0179587_111685751 | 3300026557 | Vadose Zone Soil | VSASVLKTSANPKSPEFEKNSRRIVDLLTTIKNEEEQ |
| Ga0207856_10551362 | 3300026983 | Tropical Forest Soil | VSASVLKTSVNFTSPQFEKNARQMADLLTTIKNEEETIRE |
| Ga0207736_1124111 | 3300027023 | Tropical Forest Soil | VSSSVLKTSVNPNSPQFEKNAHQMTDLLTEIKNEEETIREGGGSK |
| Ga0209076_11343321 | 3300027643 | Vadose Zone Soil | VAASILKTNVNTKSPEFEKNTRRMIDLVTQIKNEEEQ |
| Ga0209588_11713671 | 3300027671 | Vadose Zone Soil | VSDSVLKTSANLKSPEFEKNVRRIIDLLTKIKNEEEQ |
| Ga0209590_105993251 | 3300027882 | Vadose Zone Soil | VSASVLKTSANRKSPEFEKNTRRIVDLLTEIKNEE |
| Ga0209590_106491422 | 3300027882 | Vadose Zone Soil | VSASVLKTAANLKSPEFEKNTRRIVDLLTKIKNEEEQIRQG |
| Ga0137415_101184581 | 3300028536 | Vadose Zone Soil | VAASTLKTNVNTKSAEFEKNTRRMIDLVTQIKNDEEQ |
| Ga0137415_104339561 | 3300028536 | Vadose Zone Soil | VSDSVLKTSANHKSAEFEKNARRIIDLLTKIKNEEE |
| Ga0137415_105648441 | 3300028536 | Vadose Zone Soil | VSASVLKTSVNLQSPEFEKNAHRIVDLLTDIKNEEEEI |
| Ga0137415_110641732 | 3300028536 | Vadose Zone Soil | VSASFLKTTANRKSPEFEKNARRIIDLLTKIKNEEEQIRQG |
| Ga0222749_100778742 | 3300029636 | Soil | VSASVLKSNLNPKAPEFEKNARRVVDLLTSIKNEEELIRQGGGDK |
| Ga0170834_1051854742 | 3300031057 | Forest Soil | VSGSVLKTSVNTKSPDFAKNSRKVVDLVSQIKNEEEQICAGGGAKAI |
| Ga0170824_1282082701 | 3300031231 | Forest Soil | VSASVLKTSINDKSPDFAKNSRKVVDLVTQIKNEEEQ |
| Ga0307476_108430211 | 3300031715 | Hardwood Forest Soil | VSASVLKTSVNIKSPEFEKNTRKVIDLVTQIKNEEEQ |
| Ga0318537_101228711 | 3300031763 | Soil | VSASVLKTSANPKSPQFEKNARQMADLLTMIKNEEETIREGGG |
| Ga0307478_117772022 | 3300031823 | Hardwood Forest Soil | VSASVLKTALNAKSPDFEKNSQRMVELLTTIKNEEEKIRQGGG |
| Ga0306919_102834473 | 3300031879 | Soil | VSASVLKTSANPKSPQFEKNARQMADLLTMIKNEEETIREGGGA |
| Ga0318520_100209873 | 3300031897 | Soil | VAGSVLKTAANRKSPDFEKNTRRIVDLLTEIKNQEEKAA |
| Ga0318520_102374432 | 3300031897 | Soil | VSASVLKTSANPKSPQFEKNARQMADLLTMIKIEE |
| Ga0310912_109728531 | 3300031941 | Soil | VSASVLKTSVNPKSPQFEKNAHQMVDLLTTIKNEEETIREGGGVKAI |
| Ga0310916_111835182 | 3300031942 | Soil | VSASVLKTSANPKSPQFEKNARQMADLLTMIKNEEETIREG |
| Ga0310913_101718191 | 3300031945 | Soil | VSTLKSSINAKSPQFEKNAHQMVDLLTQIKNEEEQIREGGGRKA |
| Ga0310910_110672421 | 3300031946 | Soil | VSTLKSSINAKSPQFEKNAHQMVDLLTQIKNEEEQIREGGGAKAS |
| Ga0310909_102209141 | 3300031947 | Soil | VFASVLKTSANPKSPQFEKNARQMADLLTMIKNEE |
| Ga0307479_112799281 | 3300031962 | Hardwood Forest Soil | VSASVLKTSANRKSPEFEKNSRRIVDLLTTIKNEEEQIRQG |
| Ga0306924_105188571 | 3300032076 | Soil | VFASVLKTSANPKSPQFEKNARQMADLLTMIKNEEETIRE |
| Ga0307471_1025945451 | 3300032180 | Hardwood Forest Soil | VAASILKTNVNTKSPEFEKNTRRMIDLVTQIKNQEEQIAA |
| Ga0307472_1010797392 | 3300032205 | Hardwood Forest Soil | VSASVLKTSVNLKSPEFEKNARRIVDLLTKIKNEEEQIRQG |
| Ga0306920_1003592844 | 3300032261 | Soil | VFASVLKTSANPKSPQFEKNARQMADLLTMIKNEEETIREGGGA |
| Ga0335076_100443601 | 3300032955 | Soil | VSSSALKTSITSKTPQFEKNNHQMISLMTEIKNEEE |
| Ga0310914_105266981 | 3300033289 | Soil | VSASVLKTSINPKSPQFEKNAHQMADLLTTIKNEEETI |
| ⦗Top⦘ |