Metagenome / Metatranscriptome Family F076100

Overview

Basic Information

• Family ID: F076100
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 118
• Average Sequence Length: 38 residues
• Representative Sequence: MKYITNKFDSIRLPVEEGLLEWLQEKYPASKYFIKEI
• Number of Associated Samples: 74
• Number of Associated Scaffolds: 118

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 77.97 %
• % of genes near scaffold ends (potentially truncated): 16.95 %
• % of genes from short scaffolds (< 2000 bps): 63.56 %
• Associated GOLD sequencing projects: 69
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.62

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (54.237 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (21.186 % of family members)
• Environment Ontology (ENVO): Unclassified (73.729 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (82.203 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 12.31%
  β-sheet: 15.38%
  Coil/Unstructured: 72.31%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 118 Family Scaffolds
PF01227	GTP_cyclohydroI	43.22
PF14083	PGDYG	6.78
PF13394	Fer4_14	4.24
PF02739	5_3_exonuc_N	2.54
PF01230	HIT	2.54
PF03721	UDPG_MGDP_dh_N	1.69
PF01027	Bax1-I	1.69
PF03819	MazG	1.69
PF00984	UDPG_MGDP_dh	1.69
PF13759	2OG-FeII_Oxy_5	1.69
PF00149	Metallophos	1.69
PF00136	DNA_pol_B	0.85
PF01370	Epimerase	0.85
PF09967	DUF2201	0.85
PF04325	DUF465	0.85
PF07230	Portal_Gp20	0.85
PF08534	Redoxin	0.85
PF14743	DNA_ligase_OB_2	0.85
PF00004	AAA	0.85
PF13517	FG-GAP_3	0.85
PF02839	CBM_5_12	0.85
PF00011	HSP20	0.85
PF07733	DNA_pol3_alpha	0.85
PF00156	Pribosyltran	0.85
PF13476	AAA_23	0.85
PF00383	dCMP_cyt_deam_1	0.85
PF13203	DUF2201_N	0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 118 Family Scaffolds
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	3.39
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	3.39
COG0258	5'-3' exonuclease Xni/ExoIX (flap endonuclease)	Replication, recombination and repair [L]	2.54
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	1.69
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	1.69
COG1893	Ketopantoate reductase	Coenzyme transport and metabolism [H]	1.69
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.85
COG0417	DNA polymerase B elongation subunit	Replication, recombination and repair [L]	0.85
COG0587	DNA polymerase III, alpha subunit	Replication, recombination and repair [L]	0.85
COG2176	DNA polymerase III, alpha subunit (gram-positive type)	Replication, recombination and repair [L]	0.85

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.24 %
All Organisms	root	All Organisms	45.76 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.24 %
Viruses	superkingdom	All Organisms → Viruses	37.29 %
cellular organisms	root	All Organisms → cellular organisms	8.47 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.24 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	22.03 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.25 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	8.47 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.24 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	22.03 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.25 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	3.39 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.24 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	22.03 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.25 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3.39 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.24 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	22.03 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.25 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3.39 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.25 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	12.71 %
unclassified Caudoviricetes	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes	5.93 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	3.39 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	1.69 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.24 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	15.25 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	12.71 %
Vibrio phage 2.275.O._10N.286.54.E11	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	5.93 %
Polynucleobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	3.39 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	1.69 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001282|B570J14230_10047321	All Organisms → Viruses → Predicted Viral	1442
3300002408|B570J29032_109030036	Not Available	572
3300002408|B570J29032_109239970	Not Available	650
3300004124|Ga0066178_10201995	Not Available	570
3300005517|Ga0070374_10001079	Not Available	11538
3300005517|Ga0070374_10006065	Not Available	5693
3300005517|Ga0070374_10045581	All Organisms → cellular organisms → Bacteria	2278
3300005517|Ga0070374_10119856	All Organisms → cellular organisms → Bacteria	1369
3300005517|Ga0070374_10469460	All Organisms → cellular organisms → Bacteria	629
3300005527|Ga0068876_10707863	Not Available	538
3300005580|Ga0049083_10229151	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	628
3300005581|Ga0049081_10006470	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4432
3300005582|Ga0049080_10193297	Not Available	674
3300005584|Ga0049082_10053441	Not Available	1417
3300005584|Ga0049082_10134256	Not Available	862
3300005662|Ga0078894_10029524	All Organisms → cellular organisms → Bacteria	4509
3300005662|Ga0078894_10169428	All Organisms → Viruses → Predicted Viral	1970
3300005662|Ga0078894_10769140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	845
3300005662|Ga0078894_11109859	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	675
3300005662|Ga0078894_11176655	Not Available	651
3300005662|Ga0078894_11284074	Not Available	616
3300006118|Ga0007859_1009861	All Organisms → Viruses → Predicted Viral	2206
3300006484|Ga0070744_10002571	Not Available	5476
3300006484|Ga0070744_10026306	All Organisms → cellular organisms → Bacteria	1723
3300006484|Ga0070744_10048008	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	1253
3300006639|Ga0079301_1199180	Not Available	575
3300007597|Ga0102919_1171521	Not Available	680
3300008055|Ga0108970_11637990	All Organisms → Viruses → Predicted Viral	1442
3300008107|Ga0114340_1070658	Not Available	1470
3300008108|Ga0114341_10010299	Not Available	7237
3300009026|Ga0102829_1277247	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	555
3300009151|Ga0114962_10011268	Not Available	6579
3300009151|Ga0114962_10021818	All Organisms → Viruses → Predicted Viral	4513
3300009151|Ga0114962_10205788	Not Available	1146
3300009151|Ga0114962_10542479	Not Available	610
3300009152|Ga0114980_10031947	Not Available	3252
3300009164|Ga0114975_10000084	Not Available	60899
3300009164|Ga0114975_10000362	Not Available	34027
3300009164|Ga0114975_10004507	Not Available	9118
3300009164|Ga0114975_10012484	Not Available	5261
3300009180|Ga0114979_10020232	Not Available	4249
3300009180|Ga0114979_10170519	All Organisms → Viruses → Predicted Viral	1327
3300009182|Ga0114959_10097408	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1618
3300009182|Ga0114959_10175746	All Organisms → Viruses → Predicted Viral	1123
3300010160|Ga0114967_10077352	Not Available	1992
3300010885|Ga0133913_10676732	All Organisms → Viruses → Predicted Viral	2702
3300012345|Ga0157139_1015297	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	504
3300012663|Ga0157203_1001606	Not Available	5456
3300012663|Ga0157203_1043558	Not Available	613
3300012665|Ga0157210_1000039	Not Available	68403
3300012665|Ga0157210_1000055	Not Available	62405
3300012665|Ga0157210_1007052	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2147
3300012665|Ga0157210_1015360	All Organisms → Viruses → Predicted Viral	1281
3300013004|Ga0164293_10102541	Not Available	2194
3300013006|Ga0164294_10000149	Not Available	64293
3300013093|Ga0164296_1089718	All Organisms → Viruses → Predicted Viral	1315
3300013286|Ga0136641_1000004	Not Available	105823
3300019784|Ga0181359_1109558	Not Available	1002
3300019784|Ga0181359_1212734	Not Available	614
3300020141|Ga0211732_1110836	Not Available	70287
3300020141|Ga0211732_1203246	Not Available	530
3300020141|Ga0211732_1586830	Not Available	21272
3300020151|Ga0211736_10000792	Not Available	751
3300020151|Ga0211736_10494030	Not Available	6778
3300020151|Ga0211736_10738632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	900
3300020151|Ga0211736_10742269	Not Available	622
3300020159|Ga0211734_11261208	Not Available	746
3300020160|Ga0211733_10186239	Not Available	1145
3300020160|Ga0211733_10474229	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	755
3300020160|Ga0211733_10928692	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4529
3300020162|Ga0211735_11212619	All Organisms → Viruses → Predicted Viral	1161
3300020172|Ga0211729_10941651	All Organisms → Viruses → Predicted Viral	1017
3300020205|Ga0211731_10111229	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1769
3300020205|Ga0211731_11127392	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	970
3300020205|Ga0211731_11239355	Not Available	568
3300020527|Ga0208232_1042403	Not Available	592
3300021139|Ga0214166_1014860	All Organisms → Viruses → Predicted Viral	2075
3300021519|Ga0194048_10081474	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1262
3300021519|Ga0194048_10171747	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	809
3300021952|Ga0213921_1014891	Not Available	1371
3300021962|Ga0222713_10195996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter	1356
3300022407|Ga0181351_1070130	Not Available	1421
3300023174|Ga0214921_10002396	Not Available	30555
3300023184|Ga0214919_10005360	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	18266
3300024346|Ga0244775_10009028	Not Available	9623
3300024346|Ga0244775_10756970	Not Available	779
3300024346|Ga0244775_11011447	Not Available	655
3300024863|Ga0255246_1135287	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	573
3300025389|Ga0208257_1057401	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	538
3300025392|Ga0208380_1059400	Not Available	540
3300027114|Ga0208009_1028325	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	1189
3300027144|Ga0255102_1000463	Not Available	11289
3300027581|Ga0209651_1049506	All Organisms → cellular organisms → Bacteria	1254
3300027631|Ga0208133_1113763	Not Available	629
3300027642|Ga0209135_1044047	All Organisms → Viruses → Predicted Viral	1580
3300027642|Ga0209135_1258537	Not Available	514
3300027679|Ga0209769_1278425	Not Available	504
3300027708|Ga0209188_1000003	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	345369
3300027708|Ga0209188_1268860	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	580
3300027749|Ga0209084_1015161	Not Available	4384
3300027749|Ga0209084_1059543	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1801
3300027759|Ga0209296_1084629	Not Available	1552
3300027772|Ga0209768_10070312	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1785
3300027797|Ga0209107_10014103	Not Available	4536
3300027798|Ga0209353_10233839	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	795
3300027969|Ga0209191_1000011	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	166311
3300027969|Ga0209191_1004660	Not Available	7919
3300027969|Ga0209191_1035409	All Organisms → Viruses → Predicted Viral	2367
3300028392|Ga0304729_1003048	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9664
3300028394|Ga0304730_1100877	Not Available	1253
3300032092|Ga0315905_10052434	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4141
3300033816|Ga0334980_0055037	All Organisms → Viruses → Predicted Viral	1678
3300033992|Ga0334992_0057346	All Organisms → Viruses → Predicted Viral	2192
3300034013|Ga0334991_0024917	All Organisms → Viruses → Predicted Viral	3422
3300034061|Ga0334987_0137849	Not Available	1807
3300034071|Ga0335028_0140383	Not Available	1547
3300034071|Ga0335028_0355391	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Vibrio phage 2.275.O._10N.286.54.E11	851
3300034102|Ga0335029_0766198	Not Available	513

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.15%
Host-Associated	Host-Associated	0.85%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	97.46%
Terrestrial	Environmental → Terrestrial	1.69%
Plants	Host-Associated → Plants	0.85%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	88.98%
Marine	Environmental → Aquatic → Marine	8.47%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.69%
Leaf	Host-Associated → Plants → Leaf	0.85%

Type

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	49.15%
Lentic	Environmental → Aquatic → Freshwater → Lentic	30.51%
Unclassified	Environmental → Aquatic → Marine → Unclassified	6.78%
Lotic	Environmental → Aquatic → Freshwater → Lotic	5.93%
River	Environmental → Aquatic → Freshwater → River	1.69%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.69%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.69%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.85%
Creek	Environmental → Aquatic → Freshwater → Creek	0.85%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.85%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	49.15%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	27.12%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	6.78%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	5.93%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.54%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.69%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	1.69%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.69%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.85%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.85%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.85%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.85%

Habitat

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	21.19%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	18.64%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	14.41%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	10.17%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	5.93%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	5.93%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	4.24%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	4.24%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.54%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	1.69%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	1.69%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.69%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.69%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.69%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.85%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.85%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.85%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	0.85%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.85%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental
3300004124	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)	Environmental
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental
3300006118	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07	Environmental
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental
3300007597	Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02	Environmental
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental
3300008108	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA	Environmental
3300009026	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575	Environmental
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental
3300009182	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG	Environmental
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental
3300010885	northern Canada Lakes Co-assembly	Environmental
3300012345	Freshwater microbial communities from Burnt River, Ontario, Canada - S22	Environmental
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental
3300013006	Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG	Environmental
3300013093	Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG	Environmental
3300013286	Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y	Environmental
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental
3300020527	Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)	Environmental
3300021139	Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion	Environmental
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental
3300021952	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG	Environmental
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental
3300024346	Whole water sample coassembly	Environmental
3300024863	Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome)	Environmental
3300025389	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes)	Environmental
3300025392	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes)	Environmental
3300027114	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)	Environmental
3300027144	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h	Environmental
3300027581	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)	Environmental
3300027631	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)	Environmental
3300027642	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes)	Environmental
3300027679	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)	Environmental
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental
3300027749	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)	Environmental
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental
3300027772	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)	Environmental
3300027797	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)	Environmental
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental
3300027969	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)	Environmental
3300028392	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)	Environmental
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental
3300033816	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005	Environmental
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental
3300034013	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034	Environmental
3300034061	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028	Environmental
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental
3300034102	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J14230_100473212	3300001282	Freshwater	MKYITNKFDSIRLPVEDGLLEWLQAKYPASKYHIKEL*
B570J29032_1090300362	3300002408	Freshwater	MKYITNKFDSIRLPVEEGLLEWLQARYPASKYYIKELG*
B570J29032_1092399702	3300002408	Freshwater	MRYITNKFDSVRLPVEEGLLEWLQTQYPASKYFIMEL*
Ga0066178_102019953	3300004124	Freshwater Lake	ATGVCTAMRYITNKFDSVRLPVEEGLLEWLQEQYPASKYFIKEVE*
Ga0070374_1000107916	3300005517	Freshwater Lake	MRYITNKFDSVRLPIEEGLLEWLQAKYPASKYYIKEI*
Ga0070374_100060652	3300005517	Freshwater Lake	MKYITNKFDSIRLPVEEGLLEWLQAKYPASKYHIKELE*
Ga0070374_100455814	3300005517	Freshwater Lake	MRYITNKFDSVRLPVEEGLLEWLQAQYPASKYHIKELE*
Ga0070374_101198565	3300005517	Freshwater Lake	MRYITNKFDSVRLPVEEGLLEWLQEQYPASKYFIKEVE*
Ga0070374_104694602	3300005517	Freshwater Lake	MKYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKE*
Ga0068876_107078631	3300005527	Freshwater Lake	TTTRVCTTMKYITNKFDSIRLPVEEGLLEWLQAKYPASKYFIKET*
Ga0049083_102291512	3300005580	Freshwater Lentic	MKYITNRYDSIRLPYEEGLLEWLQKQYPLSKYQVKELADGN*
Ga0049081_100064702	3300005581	Freshwater Lentic	MKYITNKFENIRLPVEEGLLEWLQENYPASKYFIKEI*
Ga0049080_101932971	3300005582	Freshwater Lentic	MRYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKELE*
Ga0049082_100534415	3300005584	Freshwater Lentic	MKYITNKFDSIRLPIEPGLLEWLQQNYPASQYYIKEQ*
Ga0049082_101342561	3300005584	Freshwater Lentic	MRYITNKFDSVRLPVEEGLLEWLQAQYPASEYHIKEA*
Ga0078894_100295241	3300005662	Freshwater Lake	MRYITNKFESIRLPVEEGLLEWLQERYPASKYYIKEI*
Ga0078894_101694282	3300005662	Freshwater Lake	MKYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKEI*
Ga0078894_107691401	3300005662	Freshwater Lake	TTMRYITNKFDSVRLPVEEGLLEWLQVQYPASKYFIKEI*
Ga0078894_111098592	3300005662	Freshwater Lake	MKYITNKFESIRLPVEAGLLEWLQAKYPASKYVIKEI*
Ga0078894_111766551	3300005662	Freshwater Lake	TRVCTTMKYITNKFESIRLPVEDGLLEWLQTKYPASKYYIKEV*
Ga0078894_112840742	3300005662	Freshwater Lake	MKYITNKFESIRLPVEEGLLEWLQERYPASKYYIKEI*
Ga0007859_10098612	3300006118	Freshwater	MKYITNKFDSVRLPYAEDLLEWLQQTYPHSKYHVKEIHYGN*
Ga0070744_100025714	3300006484	Estuarine	MRYITNKFDSVRLPVEEGLLEWLQTQYPASKYFIKEI*
Ga0070744_100263065	3300006484	Estuarine	MKYITNKFDSIQLPIEPGLLEWLQAQYPASKYQIVETGDHNDNN*
Ga0070744_100480082	3300006484	Estuarine	MKYITNKFDSVRLPVEEGLLEWLQMQYPASKYFIKEI*
Ga0079301_11991802	3300006639	Deep Subsurface	MRYITNKFDSVRLPVEEGLLEWLQEKYPASKYFIKEI*
Ga0102919_11715211	3300007597	Estuarine	HQTTTRVCTTMRYITNKFDSVRLPVEEGLLEWLQARYPASKYHIKEA*
Ga0108970_116379905	3300008055	Estuary	MRYITNKFDSIRLPIEEGLLEWLQQTYPASKYYVKEI*
Ga0114340_10706582	3300008107	Freshwater, Plankton	MKYITNKFDSIRLPVEEGLLEWLQEKYPASKYFIKEI*
Ga0114341_1001029911	3300008108	Freshwater, Plankton	MKYITNKFDSIRLPVEEGLLEWLQAKYPASKYFIKET*
Ga0102829_12772472	3300009026	Estuarine	MKYITNKFESIRLPVEEGLLEWLQAQYPASKYHIKEA*
Ga0114962_1001126814	3300009151	Freshwater Lake	MKYITNKFDNVRFPVEPGLLEWLRENYPASKYIIKEIK*
Ga0114962_100218184	3300009151	Freshwater Lake	MRYITNKFDSIRLPVEPGLLEWLQETYPASKYFIKDIE*
Ga0114962_102057882	3300009151	Freshwater Lake	MKYITNKFDSIRLPVEPGLLEWLQENYPASKYIIKEIK*
Ga0114962_105424792	3300009151	Freshwater Lake	MRYITNKFESIRLPVEPGLLEWLQETYPASKYFIKDIE*
Ga0114980_100319479	3300009152	Freshwater Lake	MRYITNKFDSVRLPVEEGLLEWLQAQYPASKYHIKEA*
Ga0114975_100000842	3300009164	Freshwater Lake	MKYITNKFDSVRLPVEPGLLEWLQEQYPASKYFIKET*
Ga0114975_1000036245	3300009164	Freshwater Lake	MRYITNKFESIRLPVEAGLLEWLQENYPASKYYIKEI*
Ga0114975_100045074	3300009164	Freshwater Lake	MNSRYITNKFDSIRLPVEEGLLEWLQKQYPASKYFIKEIQ*
Ga0114975_1001248410	3300009164	Freshwater Lake	MRYITNKFDSIRLPVEPGLLEWLQETYPASKYFIKDTINEMV*
Ga0114979_1002023210	3300009180	Freshwater Lake	MRYITNKFDSIRLPVEPGLLEWLQETYPASKYFIK
Ga0114979_101705195	3300009180	Freshwater Lake	VCTTMRYITNKFDSIRLPVDPGLLEWLQERYPASKYFIKET*
Ga0114959_100974086	3300009182	Freshwater Lake	MKYITNKFENIRLPVEDGLLEWLQEIYPASKYFIKEI*
Ga0114959_101757462	3300009182	Freshwater Lake	MKYITNKFDSIRLPCEEGMLEWLQETYPNSEYRIVEA*
Ga0114967_100773522	3300010160	Freshwater Lake	MNKIKYITNKFESIRLPVEDGLLEWLQEQYPASKYFIKDTANEMV*
Ga0133913_106767322	3300010885	Freshwater Lake	MYITNRYENIRLPVEPGLLEWLQANYPNSLYYIKEIENVR*
Ga0157139_10152973	3300012345	Freshwater	MRYITNKFESIRFPVEEGLLEWLQENYPASKYYIKEM*
Ga0157203_100160610	3300012663	Freshwater	MKYITNKFDSVRLPVEPGLLEWLQVKYPASKYFIKET*
Ga0157203_10435582	3300012663	Freshwater	MKYITNKFDSVRLPVEEGLLEWLQAKYPASKYFIKEI*
Ga0157210_100003956	3300012665	Freshwater	MKYITNKFESIRFPVEEGLLEWLQENYPASKYYIKEI*
Ga0157210_10000551	3300012665	Freshwater	YQTTTRVCTTMKYITNKFDSVRLPVEEGLLEWLQAKYPASKYFIKET*
Ga0157210_10070522	3300012665	Freshwater	MKYITNKFESIRLPVEEGLLEWLQEQYPASKYFIKEV*
Ga0157210_10153605	3300012665	Freshwater	TRVCTTMKYITNKFESIRLPVEEGLLEWLQEKYPASKYYIKEV*
Ga0164293_101025415	3300013004	Freshwater	MKYITNKFDSIRFPCEDGLLEWLQATYPASKYYIKEI*
Ga0164294_100001493	3300013006	Freshwater	MRYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKEQE*
Ga0164296_10897182	3300013093	Freshwater	MKYITNKFDSVRLPYAEDLLEWLQKTYPHSKYHVKEIHYGN*
Ga0136641_100000461	3300013286	Freshwater	MRYITNKFDSIRLPVESGLLEWLQAQYPASKYYIKEN*
Ga0181359_11095582	3300019784	Freshwater Lake	MRYITNKFDSVRLPVEEGLLEWLQEQYPASKYFIKEVE
Ga0181359_12127343	3300019784	Freshwater Lake	MRYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKEV
Ga0211732_111083612	3300020141	Freshwater	MRYITNKFESIRLPVEDGLLEWLQENYPNSKYYIKED
Ga0211732_12032461	3300020141	Freshwater	RVCTTMRYITNKFDSVRLPVEEGLLEWLQERYPASKYFIKELE
Ga0211732_15868302	3300020141	Freshwater	MKYITNKFDSVRLPVEEGLLEWLQEKYPASKYFIKET
Ga0211736_100007921	3300020151	Freshwater	MKYITNKFDSIRLPIEEGLLEWLQERYPASKYFIKET
Ga0211736_104940302	3300020151	Freshwater	MRYITNKFDSIRLPIEEGLLEWLQEKYPASKYFIKET
Ga0211736_107386321	3300020151	Freshwater	MRYITNKFDSIRLPIEEGLLEWLQAKYPASKYYIKEI
Ga0211736_107422691	3300020151	Freshwater	MRYITNKFDSVRLPVEDGLLEWLQAQYPASKYFIKELE
Ga0211734_112612081	3300020159	Freshwater	MKYITNKFDSIRLPIEEGLLEWLQERYPASKYHIKETQ
Ga0211733_101862391	3300020160	Freshwater	AMKYITNKFDNIRLPIEPGLLEWLQQNYPASQYYIKET
Ga0211733_104742292	3300020160	Freshwater	MRYITNKFDSVRLPVEEGLLEWLQERYPASKYFIKET
Ga0211733_109286922	3300020160	Freshwater	MRYITNKFDSIRLPIEEGLLEWLQAKYPASKYFIKEI
Ga0211735_112126191	3300020162	Freshwater	TTRVCTPMRYITNKFDSIRLPIEEGLLEWLQAKYPASKYFIKEI
Ga0211729_109416511	3300020172	Freshwater	TTTRVCTPMRYITNKFDSIRLPIEEGLLEWLQEKYPASKYFIKET
Ga0211731_101112295	3300020205	Freshwater	MKYITNKFDSIRLPYEADLLEWLQQQYPFSKYQVKEI
Ga0211731_111273922	3300020205	Freshwater	MKYITNKFDSVRLPIEEGLLEWLQAKYPASKYFIKEI
Ga0211731_112393551	3300020205	Freshwater	MKYITNKFDSIRLPIEEGLLEWLQEKYPASKYHIKETQ
Ga0208232_10424032	3300020527	Freshwater	MRYITNKFDSVRLPVEEGLLEWLQTQYPASKYFIMEL
Ga0214166_10148603	3300021139	Freshwater	MKYITNKFDSVRLPYTEDLLEWLQQTYPHSKYHVKEIHYGN
Ga0194048_100814742	3300021519	Anoxic Zone Freshwater	MKYITNKFENIRLPVEEGLLEWLQENYPASKYFIKEI
Ga0194048_101717472	3300021519	Anoxic Zone Freshwater	MKYITNKFDSVRLPAEPGLLEWLQENYPASKYIIKEIK
Ga0213921_10148914	3300021952	Freshwater	MKYITNKFESIRLPVEAGLLEWLQAKYPASQYYIKEI
Ga0222713_101959965	3300021962	Estuarine Water	MRYITNKFDSVRLPVEEGLLEWLQAKYPASKYFIKEI
Ga0181351_10701303	3300022407	Freshwater Lake	MKYITNKFDSVRLPVEEGLLEWLQAKYPASKYYIKE
Ga0214921_1000239650	3300023174	Freshwater	MKYITNKFDNIRLPYAKDLLEWLQQTYPHSQYQVKD
Ga0214919_1000536029	3300023184	Freshwater	MYITNRYENIRLPVEPGLLEWLQANYPNSLYYIKEIENVR
Ga0244775_1000902811	3300024346	Estuarine	MRYITNKFDSVRLPVEEGLLEWLQTQYPASKYFIKEI
Ga0244775_107569702	3300024346	Estuarine	MKYITNKFDSVRLPVEEGLLEWLQMQYPASKYFIKEI
Ga0244775_110114472	3300024346	Estuarine	MRYITNKFDSVRLPVEEGLLEWLQARYPASKYHIKEA
Ga0255246_11352872	3300024863	Freshwater	MRYITNKFDSVRLPIEEGLLEWLQAKYPASKYYIKEI
Ga0208257_10574011	3300025389	Freshwater	NKFDSVRLPYAEDLLEWLQQTYPHSKYHVKEIHYGN
Ga0208380_10594001	3300025392	Freshwater	MKYITNKFDSVRLPYAEDLLEWLQQTYPHSKYHVKEIHYGN
Ga0208009_10283252	3300027114	Deep Subsurface	MRYITNKFDSVRLPVEEGLLEWLQEKYPASKYFIKEI
Ga0255102_100046317	3300027144	Freshwater	MRYITNKFDSVRLPIEEGLLEWLQAKYPASKYYIK
Ga0209651_10495062	3300027581	Freshwater Lake	MRYITNKFDSVRLPVEEGLLEWLQAQYPASKYHIKELE
Ga0208133_11137631	3300027631	Estuarine	MKYITNKFESVRLPVEAGLLEWLQAKYPASKYVIKEL
Ga0209135_10440472	3300027642	Freshwater Lake	MKYITNKFDSIRLPVEEGLLEWLQAKYPASKYHIKELE
Ga0209135_12585372	3300027642	Freshwater Lake	MKYITNKFDSVRLPVEDGLLEWLQAKYPASKYHIKE
Ga0209769_12784253	3300027679	Freshwater Lake	TTTRVRATMKYITNKFDSIRLPVEEGLLEWLQAKYPASKYHIKELE
Ga0209188_1000003153	3300027708	Freshwater Lake	MKYITNKFDNVRFPVEPGLLEWLRENYPASKYIIKEIK
Ga0209188_12688601	3300027708	Freshwater Lake	MKYITNKFENIRLPVEDGLLEWLQEIYPASKYFIKEI
Ga0209084_10151619	3300027749	Freshwater Lake	MRYITNKFDSIRLPVEPGLLEWLQETYPASKYFIKDIE
Ga0209084_10595432	3300027749	Freshwater Lake	MKYITNKFDSIRLPVEPGLLEWLQENYPASKYIIKEIK
Ga0209296_10846293	3300027759	Freshwater Lake	MRYITNKFDSVRLPVEEGLLEWLQAQYPASKYHIKEA
Ga0209768_100703127	3300027772	Freshwater Lake	ATRVCAEMRYITNKFDSVRLPIEEGLLEWLQAKYPASKYYIKEI
Ga0209107_100141032	3300027797	Freshwater And Sediment	MMYITNKFDSIRLPVEPGLLEWLQQNYPASQYYIKEQ
Ga0209353_102338391	3300027798	Freshwater Lake	SGIQQTMRYITNKFDSIRFPCEEGLLEWLQATYPASKYYIKEI
Ga0209191_100001179	3300027969	Freshwater Lake	MRYITNKFESIRLPVEAGLLEWLQENYPASKYYIKEI
Ga0209191_100466011	3300027969	Freshwater Lake	MRYITNKFDSIRLPVDPGLLEWLQERYPASKYFIKEI
Ga0209191_10354094	3300027969	Freshwater Lake	MRYITNKFDSIRLPVEPGLLEWLQETYPASKYFIKDTINEMV
Ga0304729_10030486	3300028392	Freshwater Lake	MYITNRYDTIRLPVEPGLLEWLQANYPNSLYRIKEIENVR
Ga0304730_11008773	3300028394	Freshwater Lake	MNKIKYITNKFESIRLPVEDGLLEWLQVRYPASKYFIKDTANEMV
Ga0315905_100524345	3300032092	Freshwater	MRYITNKFDSIRFPCEEGLLEWLQATYPASKYYIKEI
Ga0334980_0055037_887_1000	3300033816	Freshwater	MKYITNKFDSVRLPVEAGLLEWLQAKYPASKYHIKEL
Ga0334992_0057346_1411_1527	3300033992	Freshwater	MKYITNKFDSIRLPVEEGLLEWLQARYPASKYYIKELG
Ga0334991_0024917_962_1075	3300034013	Freshwater	MKYITNKFESVRLPVEEGLLEWLQAKYPASKYVIKEL
Ga0334987_0137849_1633_1749	3300034061	Freshwater	MKYITNKFDSVRLPVEEGLLEWLQAKYPASKYFIKELV
Ga0335028_0140383_1181_1294	3300034071	Freshwater	MKYITNKFESIRLPVEAGLLEWLQEHYPASKYYIKEI
Ga0335028_0355391_502_615	3300034071	Freshwater	MKYITNKFESIRLPVEAGLLEWLQAKYPASKYVIKEI
Ga0335029_0766198_249_362	3300034102	Freshwater	MKYITNKFESIRLPVEEGLLEWLQQTYPASQYYIKEI