| Basic Information | |
|---|---|
| Family ID | F076098 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.05 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (76.271 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (16.102 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.153 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (70.339 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.47% β-sheet: 0.00% Coil/Unstructured: 39.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF09643 | YopX | 2.54 |
| PF01966 | HD | 0.85 |
| PF00293 | NUDIX | 0.85 |
| PF13578 | Methyltransf_24 | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 76.27 % |
| All Organisms | root | All Organisms | 23.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.10% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 12.71% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 11.86% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.02% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.08% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.39% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.39% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.39% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.54% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.69% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.69% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.69% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.69% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.85% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008021 | Estuarine microbial communities from the Columbia River estuary - metaG 1569A-3 | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020531 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027126 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027197 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes) | Environmental | Open in IMG/M |
| 3300027217 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027242 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027246 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027301 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027314 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027494 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0049081_100743514 | 3300005581 | Freshwater Lentic | SEAFASKHTYSCLRLTLGLLVFSINVDVKYNYIKMLPM* |
| Ga0049080_102176751 | 3300005582 | Freshwater Lentic | TNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM* |
| Ga0049082_101522323 | 3300005584 | Freshwater Lentic | PVTNYDSEAFASNHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ* |
| Ga0078894_104643995 | 3300005662 | Freshwater Lake | FDSNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0078894_109406303 | 3300005662 | Freshwater Lake | DSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0078894_112746561 | 3300005662 | Freshwater Lake | QFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0079957_11327921 | 3300005805 | Lake | VGIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLIFSLNIELKYKHNKKLPQ* |
| Ga0079957_12066234 | 3300005805 | Lake | VGIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0070743_101699844 | 3300005941 | Estuarine | NGGGLFVGIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0070744_100042311 | 3300006484 | Estuarine | EAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0075471_102302161 | 3300006641 | Aqueous | GIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0075473_101284391 | 3300006875 | Aqueous | FQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNRIKMLP* |
| Ga0102874_10043481 | 3300007546 | Estuarine | TNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0102918_100616610 | 3300007593 | Estuarine | ASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0102919_11717561 | 3300007597 | Estuarine | NGGGLFVGIRFQFPVTNYNIEAFASKHTYTCLRLTLGLLVISINVEVKYNYIKMLPQ* |
| Ga0102863_11495501 | 3300007622 | Estuarine | ASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0102901_100466713 | 3300007634 | Estuarine | SEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0102865_12713251 | 3300007639 | Estuarine | QWHCKNGGGLFVGIRFQFPVTNYDSEAFASKHTYTCLRLTLGLLVISINVEVKYNYIKMLPQ* |
| Ga0102898_10460475 | 3300007658 | Estuarine | CKNGGGLFVGIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0105745_10958404 | 3300007972 | Estuary Water | DSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM* |
| Ga0105746_11569601 | 3300007973 | Estuary Water | YDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0105747_13212642 | 3300007974 | Estuary Water | FPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVELKYNYIKMLPQ* |
| Ga0105748_100369566 | 3300007992 | Estuary Water | EAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM* |
| Ga0102922_11959351 | 3300008021 | Estuarine | FASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0102893_12481511 | 3300008052 | Estuarine | QWHCKNGGGLFVGIQFQFPVANYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114340_11116691 | 3300008107 | Freshwater, Plankton | VTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYSKMLPQ* |
| Ga0114340_11728221 | 3300008107 | Freshwater, Plankton | VTNYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYSKMLPQ* |
| Ga0114340_11874411 | 3300008107 | Freshwater, Plankton | IRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ* |
| Ga0114350_10707421 | 3300008116 | Freshwater, Plankton | IRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPR* |
| Ga0114350_11382441 | 3300008116 | Freshwater, Plankton | GGLFVGIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114355_11413561 | 3300008120 | Freshwater, Plankton | AFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114841_12591271 | 3300008259 | Freshwater, Plankton | DAEAFASKHTYTRLRLTFGLIVFSINVDIKYNHIKMLPM* |
| Ga0114336_12593643 | 3300008261 | Freshwater, Plankton | FVGIRFQFPVTNYDSEAFDSNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM* |
| Ga0114364_11320711 | 3300008267 | Freshwater, Plankton | VTNYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114364_11474451 | 3300008267 | Freshwater, Plankton | IRFQFPVTNYDSEAFASKHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ* |
| Ga0114364_11606371 | 3300008267 | Freshwater, Plankton | GIRFQFPVTNYDSEAFASKHTYSCLRLTLGLLVFSINAEVKYNYSKMLPQ* |
| Ga0114876_11952011 | 3300008448 | Freshwater Lake | IRFQFPVTNYDSEAFASKHTYSCLRLTLGLLVFSINVDVKYNYSKMLPQ* |
| Ga0114880_12093814 | 3300008450 | Freshwater Lake | FPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114973_101577501 | 3300009068 | Freshwater Lake | VTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114980_100595791 | 3300009152 | Freshwater Lake | TNYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114968_100951931 | 3300009155 | Freshwater Lake | FVGIRFQFPVTNYDSEAFASKHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ* |
| Ga0114968_101693071 | 3300009155 | Freshwater Lake | FVGIRFQFPVTNYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114977_104998554 | 3300009158 | Freshwater Lake | FQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ* |
| Ga0114978_105915973 | 3300009159 | Freshwater Lake | FVGIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ* |
| Ga0114966_105264371 | 3300009161 | Freshwater Lake | NYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNRIKMFPQ* |
| Ga0114970_105110501 | 3300009163 | Freshwater Lake | AFASKHTYSCLRLTLGLLVFSINVDVKYNRIKMFPQ* |
| Ga0114970_105603511 | 3300009163 | Freshwater Lake | LFVGIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114975_100098441 | 3300009164 | Freshwater Lake | FASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114974_103698831 | 3300009183 | Freshwater Lake | YDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114976_106575452 | 3300009184 | Freshwater Lake | LFLGIRLQFPVTNYDSEAFASKHTYTCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114971_101793141 | 3300009185 | Freshwater Lake | FPVTNYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0114972_100921118 | 3300009187 | Freshwater Lake | NYDSEAFASKHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ* |
| Ga0133913_116371835 | 3300010885 | Freshwater Lake | DSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0139557_10016711 | 3300011010 | Freshwater | IRFQFPVTNYDSEAFASKHTYTCLRLTLGLLVFSINVDVKYNRIKMLPQ* |
| Ga0139557_10714451 | 3300011010 | Freshwater | IRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0177922_105324583 | 3300013372 | Freshwater | FVGIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0177922_112964481 | 3300013372 | Freshwater | FQFPVTNYDSEAFASKHTYSCLRLTLGLLVFSINLDIKYNYIKTLPQ* |
| Ga0119960_10955262 | 3300014811 | Aquatic | VSQSRSGGGLFVGIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ* |
| Ga0181365_11007391 | 3300017736 | Freshwater Lake | QFPVSIYDSEAFASKHTYTCLRLTLGLLAISINVEVKYNYIKMLPQ |
| Ga0181343_10288685 | 3300017766 | Freshwater Lake | RFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNHSKMLPQ |
| Ga0181346_12455121 | 3300017780 | Freshwater Lake | FPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM |
| Ga0181355_11274231 | 3300017785 | Freshwater Lake | DSEAFASRHTYTCLRLTLGLLVISINLDIKYNYIKTLPQ |
| Ga0211734_104708441 | 3300020159 | Freshwater | FFGIRLDFPTEIYDSEAFASKHTYTRLRLTFGLIVCSVKVDIKYNYIKMLPI |
| Ga0211729_106656836 | 3300020172 | Freshwater | IRLDFPTEIYDSEAFASKHTYTRLRLTFGLIVCSVKVDIKYNYIKMLPI |
| Ga0208487_10088751 | 3300020531 | Freshwater | AFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0207941_10242703 | 3300020539 | Freshwater | TNYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0208857_10409841 | 3300020542 | Freshwater | VTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0208465_10385951 | 3300020570 | Freshwater | DIEAIDKHTYACLRLTLGLLVFSVNIDIKYNRIKMLPQ |
| Ga0214163_100145025 | 3300021141 | Freshwater | PVTNYDSEAFASKHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ |
| Ga0214163_100737011 | 3300021141 | Freshwater | PVTNYDSEAFASKHTYSCLRLTLGLLVFSINVELKYNYIKMLPQ |
| Ga0222714_103408464 | 3300021961 | Estuarine Water | NYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYSKMLPQ |
| Ga0222712_104175091 | 3300021963 | Estuarine Water | IRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNRIKMLPQ |
| Ga0181351_10152591 | 3300022407 | Freshwater Lake | SEAFDSNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM |
| Ga0181351_11543241 | 3300022407 | Freshwater Lake | NGGGLFVGIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0214921_100655709 | 3300023174 | Freshwater | PVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPR |
| Ga0214923_102551461 | 3300023179 | Freshwater | EAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0214923_103616051 | 3300023179 | Freshwater | TNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPR |
| Ga0214919_102658711 | 3300023184 | Freshwater | VTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPR |
| Ga0244775_105566633 | 3300024346 | Estuarine | DSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0256309_11134523 | 3300024566 | Freshwater | IEAIDKHTYACLRLTLGLLVFSINVDIKYNRIKMLPQ |
| Ga0256307_11570433 | 3300024567 | Freshwater | FQFPVTNYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNRIKMLLQ |
| Ga0255090_10169341 | 3300027123 | Freshwater | YDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM |
| Ga0255090_10531681 | 3300027123 | Freshwater | TNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNHSKMLPQ |
| Ga0255098_10508673 | 3300027126 | Freshwater | FASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0255066_10054458 | 3300027131 | Freshwater | IRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0255066_10431911 | 3300027131 | Freshwater | TNYDIEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0255069_10074431 | 3300027134 | Freshwater | NYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM |
| Ga0255069_10280464 | 3300027134 | Freshwater | TNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0255065_10658851 | 3300027142 | Freshwater | SEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM |
| Ga0208922_10441941 | 3300027197 | Estuarine | GGLFVGIRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0208928_10563931 | 3300027217 | Estuarine | AFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0208806_10072141 | 3300027242 | Estuarine | YDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0208931_10045401 | 3300027246 | Estuarine | YDIEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0255127_10750731 | 3300027301 | Freshwater | FPVTNYDSEAFASKHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ |
| Ga0208811_10032891 | 3300027314 | Estuarine | NYDIEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0255094_10309385 | 3300027494 | Freshwater | NYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0255072_100506210 | 3300027508 | Freshwater | FASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0255088_10704533 | 3300027597 | Freshwater | NYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0255088_10750241 | 3300027597 | Freshwater | EAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM |
| Ga0208975_10587261 | 3300027659 | Freshwater Lentic | EAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM |
| Ga0209296_12764814 | 3300027759 | Freshwater Lake | IRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ |
| Ga0209086_101098351 | 3300027770 | Freshwater Lake | NYDSEAFASNHTYSCLRFTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0209086_104441821 | 3300027770 | Freshwater Lake | EAFASKHTYSCLRLTLGLLVFSINVEVKYNRIKMFPQ |
| Ga0209768_102773873 | 3300027772 | Freshwater Lake | YDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0209829_104046742 | 3300027777 | Freshwater Lake | GGLFVGIRCQFPARIYDSEAFADKHTYTCLRLTLGLLVFSINVDVKYNHIKMLPQ |
| Ga0209246_102433833 | 3300027785 | Freshwater Lake | VTNYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0209358_1000642724 | 3300027804 | Freshwater Lake | IRFQFPVTNYDSEAFASNHTYSCLRLTLGLLVFSINVEVKYNHSKMLPQ |
| Ga0209990_104983372 | 3300027816 | Freshwater Lake | GCRLDFPASIYDAEAFASKHTYTRLRLTFGLIVFSINVDIKYNHIKMLPM |
| Ga0315909_104826761 | 3300031857 | Freshwater | QFPVTNYDSEAFDSNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM |
| Ga0315901_105552234 | 3300031963 | Freshwater | SEAFASNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0315902_101810237 | 3300032093 | Freshwater | VTNYDSEAFDSNHTYSCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0315902_105069985 | 3300032093 | Freshwater | NYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPM |
| Ga0315268_123038013 | 3300032173 | Sediment | PVTNYDSEAFASKHTYTCLRLTLGLLVFSINVEVKYNYIKMLPQ |
| Ga0334982_0316963_1_165 | 3300033981 | Freshwater | LFVGIRFQFPVTNYDSEAFASKHTYSCLRLTLGLLVFSINVEVKYNYIKMLPPQ |
| Ga0334996_0038719_2869_3012 | 3300033994 | Freshwater | FQFPVTNYDSEAFASKHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ |
| Ga0334985_0672637_2_148 | 3300034018 | Freshwater | IRLQFPKIIYDIEAIDKHTYACLRLTLGLLVFSVNIDIKYNRIKMLPQ |
| Ga0335054_0547912_2_139 | 3300034119 | Freshwater | FPKIIYDIEAFASKHTYSCLRLTLGLLVFSINVDIKYNRIKMLPQ |
| Ga0335060_0096124_3_164 | 3300034122 | Freshwater | LFVGIRFQFPVTNYDSEAFASKHTYSCLRLTLGLLVFSINVDVKYNYIKMLPQ |
| ⦗Top⦘ |