NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076097

Metagenome / Metatranscriptome Family F076097

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076097
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 76 residues
Representative Sequence MGLLDKLKSSVLGLGGNKPAQFGVNPIPPDSLHLNYSTDGKPNVTWRTISGTGPKPQPSRLDINDSKDKYTPSKKYSK
Number of Associated Samples 69
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.85 %
% of genes near scaffold ends (potentially truncated) 27.12 %
% of genes from short scaffolds (< 2000 bps) 77.97 %
Associated GOLD sequencing projects 69
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (84.746 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(29.661 % of family members)
Environment Ontology (ENVO) Unclassified
(56.780 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(67.797 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.32%    β-sheet: 0.00%    Coil/Unstructured: 88.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF01510Amidase_2 1.69
PF04984Phage_sheath_1 0.85
PF14063DUF4254 0.85
PF06841Phage_T4_gp19 0.85
PF11009DUF2847 0.85
PF13385Laminin_G_3 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG3497Phage tail sheath protein FIMobilome: prophages, transposons [X] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.98 %
UnclassifiedrootN/A11.02 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000929|NpDRAFT_10029785Not Available6460Open in IMG/M
3300001968|GOS2236_1074234All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1613Open in IMG/M
3300003277|JGI25908J49247_10162361All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti519Open in IMG/M
3300003388|JGI25910J50241_10083951All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti904Open in IMG/M
3300003388|JGI25910J50241_10189555All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti521Open in IMG/M
3300004793|Ga0007760_11280238All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti705Open in IMG/M
3300006484|Ga0070744_10005767All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti3716Open in IMG/M
3300006484|Ga0070744_10047482All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1261Open in IMG/M
3300006484|Ga0070744_10070954All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1011Open in IMG/M
3300006484|Ga0070744_10074501All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti985Open in IMG/M
3300006484|Ga0070744_10139926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales695Open in IMG/M
3300006484|Ga0070744_10148069All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti674Open in IMG/M
3300006484|Ga0070744_10212132All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti550Open in IMG/M
3300006484|Ga0070744_10214524All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti546Open in IMG/M
3300007555|Ga0102817_1058723All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti840Open in IMG/M
3300007555|Ga0102817_1114650All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti595Open in IMG/M
3300007559|Ga0102828_1066979All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti849Open in IMG/M
3300007644|Ga0102902_1094826All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes892Open in IMG/M
3300007973|Ga0105746_1324546All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti535Open in IMG/M
3300007992|Ga0105748_10088587All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1229Open in IMG/M
3300008107|Ga0114340_1020819All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti3094Open in IMG/M
3300008107|Ga0114340_1023178All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti2901Open in IMG/M
3300008107|Ga0114340_1134258All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti936Open in IMG/M
3300008107|Ga0114340_1253350All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti536Open in IMG/M
3300008108|Ga0114341_10000190All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales167479Open in IMG/M
3300008110|Ga0114343_1064775All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1361Open in IMG/M
3300008110|Ga0114343_1107893All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti952Open in IMG/M
3300008120|Ga0114355_1045902All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti2026Open in IMG/M
3300008120|Ga0114355_1087033All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1269Open in IMG/M
3300008262|Ga0114337_1214947All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti769Open in IMG/M
3300008267|Ga0114364_1030474All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti2116Open in IMG/M
3300008267|Ga0114364_1080024All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1073Open in IMG/M
3300008448|Ga0114876_1010109Not Available5433Open in IMG/M
3300008448|Ga0114876_1013252All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti4576Open in IMG/M
3300008996|Ga0102831_1259205All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti574Open in IMG/M
3300011381|Ga0102688_1403090All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1013Open in IMG/M
3300012006|Ga0119955_1102281All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti804Open in IMG/M
3300012012|Ga0153799_1017148All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1497Open in IMG/M
3300012012|Ga0153799_1041005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti867Open in IMG/M
3300012013|Ga0153805_1014346All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1356Open in IMG/M
3300012013|Ga0153805_1038860All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti808Open in IMG/M
3300012017|Ga0153801_1009406All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1789Open in IMG/M
3300012665|Ga0157210_1061320All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti570Open in IMG/M
3300012760|Ga0138273_1009729All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti604Open in IMG/M
(restricted) 3300013126|Ga0172367_10227575All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1150Open in IMG/M
3300013295|Ga0170791_15513622All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1692Open in IMG/M
3300013372|Ga0177922_10869982All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti669Open in IMG/M
3300014050|Ga0119952_1146981All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti505Open in IMG/M
3300017716|Ga0181350_1045411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1180Open in IMG/M
3300017722|Ga0181347_1009805All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti3112Open in IMG/M
3300017722|Ga0181347_1029644All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1706Open in IMG/M
3300017722|Ga0181347_1059540Not Available1140Open in IMG/M
3300017736|Ga0181365_1014646All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1961Open in IMG/M
3300017736|Ga0181365_1145986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales561Open in IMG/M
3300017761|Ga0181356_1071029All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1169Open in IMG/M
3300017761|Ga0181356_1071920Not Available1159Open in IMG/M
3300017761|Ga0181356_1111111All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti883Open in IMG/M
3300017774|Ga0181358_1025165All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti2352Open in IMG/M
3300017774|Ga0181358_1068611All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1312Open in IMG/M
3300017777|Ga0181357_1224035All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti662Open in IMG/M
3300017777|Ga0181357_1250434All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti615Open in IMG/M
3300017778|Ga0181349_1241172All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti607Open in IMG/M
3300017780|Ga0181346_1023069All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti2609Open in IMG/M
3300017784|Ga0181348_1003892All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti6619Open in IMG/M
3300017788|Ga0169931_10069549All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti3584Open in IMG/M
3300019784|Ga0181359_1000306Not Available10585Open in IMG/M
3300019784|Ga0181359_1033406All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1990Open in IMG/M
3300019784|Ga0181359_1041586All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1780Open in IMG/M
3300019784|Ga0181359_1113745All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti977Open in IMG/M
3300019784|Ga0181359_1121489All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti933Open in IMG/M
3300019784|Ga0181359_1181839All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti693Open in IMG/M
3300019784|Ga0181359_1194541All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti658Open in IMG/M
3300019784|Ga0181359_1237768All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti561Open in IMG/M
3300020141|Ga0211732_1330876Not Available775Open in IMG/M
3300020151|Ga0211736_10783866All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti532Open in IMG/M
3300020159|Ga0211734_11361807All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti2234Open in IMG/M
3300020160|Ga0211733_11138309Not Available795Open in IMG/M
3300020161|Ga0211726_10724643All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti915Open in IMG/M
3300020162|Ga0211735_10910445All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1576Open in IMG/M
3300020172|Ga0211729_11096973All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti572Open in IMG/M
3300020179|Ga0194134_10031209All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti3237Open in IMG/M
3300020183|Ga0194115_10165568All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1132Open in IMG/M
3300020200|Ga0194121_10090402All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti2027Open in IMG/M
3300021961|Ga0222714_10401972All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti723Open in IMG/M
3300021962|Ga0222713_10257903All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1132Open in IMG/M
3300021962|Ga0222713_10646604All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti610Open in IMG/M
3300021963|Ga0222712_10086001All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti2234Open in IMG/M
3300022190|Ga0181354_1018042All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti2204Open in IMG/M
3300022190|Ga0181354_1188972Not Available621Open in IMG/M
3300022190|Ga0181354_1199390All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti597Open in IMG/M
3300023174|Ga0214921_10033198Not Available4983Open in IMG/M
3300023174|Ga0214921_10326005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti836Open in IMG/M
3300023174|Ga0214921_10356291All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti775Open in IMG/M
3300023179|Ga0214923_10346124All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti786Open in IMG/M
3300023184|Ga0214919_10143693All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1910Open in IMG/M
3300023184|Ga0214919_10330636Not Available1030Open in IMG/M
3300023184|Ga0214919_10523161All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti723Open in IMG/M
3300024346|Ga0244775_10053123All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti3521Open in IMG/M
3300024346|Ga0244775_10175581All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1803Open in IMG/M
3300024346|Ga0244775_10245417All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1493Open in IMG/M
3300024346|Ga0244775_10356786All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1206Open in IMG/M
3300024346|Ga0244775_11375705Not Available544Open in IMG/M
3300024346|Ga0244775_11410388All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti535Open in IMG/M
3300027707|Ga0209443_1160954All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti810Open in IMG/M
3300027772|Ga0209768_10256735All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti755Open in IMG/M
3300027772|Ga0209768_10333992All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti626Open in IMG/M
3300028025|Ga0247723_1032231All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1637Open in IMG/M
3300031784|Ga0315899_10717451All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti927Open in IMG/M
3300031787|Ga0315900_10001354Not Available39036Open in IMG/M
3300031787|Ga0315900_10061452All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti3882Open in IMG/M
3300031787|Ga0315900_10061973All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti3860Open in IMG/M
3300031787|Ga0315900_10333950All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti1234Open in IMG/M
3300031787|Ga0315900_10620373All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti785Open in IMG/M
3300032093|Ga0315902_11033069All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti613Open in IMG/M
3300034061|Ga0334987_0469095All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti776Open in IMG/M
3300034092|Ga0335010_0524039All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti618Open in IMG/M
3300034104|Ga0335031_0441822All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti806Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake29.66%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater11.86%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine11.86%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton11.02%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.93%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.24%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.24%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.39%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice1.69%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.69%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.85%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.85%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.85%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300001968Marine microbial communities from Lake Gatun, Panama - GS020EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007644Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02EnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300011381Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012006Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101BEnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012760Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014050Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007BEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300027707Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
NpDRAFT_1002978543300000929Freshwater And MarineMGLLDKLKTGILGLKGGKPQQFGVNPAPPDSLHLTYSTDGKPNVTWRTISGVGPKPQPSRLDVGETKDKFKPSFKYSDNKPK*
GOS2236_107423433300001968MarineMGLLDKLKSSILSLGGQKPQQFGVNPVPPDSLHLNYSTDGQPDVTWRTISGVGSKPQPSRLDIGESKDKYGPRKKYTGK*
JGI25908J49247_1016236113300003277Freshwater LakeMKISTILGLGGKKPSNFGVDPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPEPSRLDINDSKSKYTPKNKYSK*
JGI25910J50241_1008395123300003388Freshwater LakeMKISTILGLGGKKPSNFGVXPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPEPSRLDINDSKSKYTPKNKYIK*
JGI25910J50241_1018955513300003388Freshwater LakeMKISTILGLGGKKPSNFGVDPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPEPSRLDINDSKSKYTPKNKYIK*
Ga0007760_1128023813300004793Freshwater LakeMGLLDKLKTGILGLKGGKPQQFGVNPVPPDSLHLTYSTDGKPDVTWRTISGVGPKPLPSRLDVGETKDKFKPSFKYSDNKPK*
Ga0070744_1000576743300006484EstuarineMSLLTKLKTSILGLAGNKPSKFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK*
Ga0070744_1004748223300006484EstuarineMLSDSNLGLGGKKPSSFGVNPVPPDSLHDTFSTNGDPNVRWRTISGTGMKPQPSRLDIGDTQDNYTPAYKYSDHKPE*
Ga0070744_1007095413300006484EstuarineMSLLTKLKDSILGLAGNKPSQFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGN
Ga0070744_1007450123300006484EstuarineMKISTILGLGGNKPTQFGVDPTPPDSLHLNYSTDGKPDVKWRTISGAGMKPSPSRLDINDSKSKYTPKNKYKG*
Ga0070744_1013992623300006484EstuarineMSLLTKLKNSILGLAGNKPSQFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKK
Ga0070744_1014806913300006484EstuarineMGLLDKLKSSILGLGGKQPSNFGVDPIPPDSLHLNYSTDGKPDVKWRTISGTGPKPKPSRLDIGDTKDKYTPTKKYNG*
Ga0070744_1021213213300006484EstuarineNNTIMGLLDKLKNSVLGLGGSKPAKFGVDPIPPDSLHLNYSTDGKPDVTWRTISGTGPKPQPSRLDINDSKDKYTPRKKYSGK*
Ga0070744_1021452423300006484EstuarineMGLLDKLKSSILGLGGSKPASFGVDPVPPNSLHITYSTDGNPSVKWRTISGTGPKPEPSRLDIGDTKSTFRPTYKYSDHKPK*
Ga0102817_105872313300007555EstuarineLGGKKLSNFGVDPTPPDSLHLNYLTDGKPDVKWRTINDNVHKPEQSRLDINDSKSKYTPKNKYGK*
Ga0102817_111465013300007555EstuarineLGLAGNKPSKFGVDPNPPDSLHYTYSISGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK*
Ga0102828_106697923300007559EstuarineMSLLTKLKTSILGLAGNKPSKFGVDPNPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK*
Ga0102902_109482623300007644EstuarineMSLLTKLKNSILGLAGNKPSQFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK*
Ga0105746_132454623300007973Estuary WaterMKISTILGLGGKKPSNFGVDPTPPDSVQLNYSTDGKPDVKWRTISGNGPKPSPSRLDINDSKSKYTPKNKYGK*
Ga0105748_1008858713300007992Estuary WaterSLLTKLKNSILGLAGNKPSQFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK*
Ga0114340_102081923300008107Freshwater, PlanktonMGLLDKLKSSILGLGGNKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGVGPKPQPSRLDIGETKDKFKPNFKYSDNKPK*
Ga0114340_102317823300008107Freshwater, PlanktonMGLLDKLKTGILGLKGAKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGVGPKPQPSRLDIGDTKDKFKPSFKYSDNKPR*
Ga0114340_113425823300008107Freshwater, PlanktonMGLLDKLKSSILGLGGNKPQQFGVNPVPPDSLHLTYSTDGKPDVTWRTISGNGPKPQPSRLDIGETKDKFKPSFKYSDNKPK*
Ga0114340_125335013300008107Freshwater, PlanktonNPQQFCVNPVPPDSLHLTYSTDGKPDVTWRTISGNGPKPQPSRLDIGDTKDKFKPSFKYSDNKPR*
Ga0114341_100001901523300008108Freshwater, PlanktonMSQLLSKIKSSLLGLKGEKPARFGVDPVPPDSLHLTYSTTGTPKIKWRKISGEDTKPTPSRLDINDSKDKYGPNKKYGK*
Ga0114343_106477523300008110Freshwater, PlanktonMGLLDKLKSSVLGLGGNKPAQFGVNPIPPDSLHLNYSTDGKPNVTWRAISGTGPKPQPSRLDINDSKDKYTPSKKYSK*
Ga0114343_110789323300008110Freshwater, PlanktonMGLLDKLKTGILGLKGAKPQQFGVNPVPPDSLHLNYSTDGKPNVTWRTISGTGQKPQPSRLDIGDTKDKFKPTFKYSDNKPK*
Ga0114346_103201613300008113Freshwater, PlanktonMGLLDKLKSSILGLGGNKPQQFGVNPIPPDSLHQLYSVDGNPNVDWRLIKGNLSNKPQPSTLDELDTKAPNLK
Ga0114355_104590213300008120Freshwater, PlanktonMGLLDKLKSSILGLGGNKPQQFGVNPVPPDSLHLTYSTDGKPDVTWRTISGNGPKPQPYRLDIGETKDKFKPSFKYSDNKPK*
Ga0114355_108703323300008120Freshwater, PlanktonMGLLDKLKTGILGLKGAKPQQFGVNPVPPDSLHLTYSTDGKPDVTWRTISGVGPKPQPSRLDIGDTKDKFKPSFKYSDNKPR*
Ga0114337_121494723300008262Freshwater, PlanktonMGLLDKLKSSILGLGGNKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGVGPKPQPSRLDIGDTKDKFKPSFKYSDNKPK*
Ga0114364_103047423300008267Freshwater, PlanktonMGLLDKLTSSILGLKGETPVNFGVDPLPPGSLHDEFSTTGKPNVKWRTISGNGPKPQPSRLDIGDSKDKYKPTSKYTG*
Ga0114364_108002423300008267Freshwater, PlanktonMKISTILGLGGKKPSNFGVDPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKNKYIK*
Ga0114876_101010923300008448Freshwater LakeMGLLDKLKSSVLGLGGNKPAQFGVNPIPPDSLHLNYSTDGKPNVTWRTISGTGPKPQPSRLDINDSKDKYTPSKKYSK*
Ga0114876_101325253300008448Freshwater LakeMGLLDKLKSSILGLGGNKPQQFGVNPVPPDSLHLTYSTDGKPDVTWRTISGNGPKPQPSRLDIGETKDKFKPSFKYSDNKPR*
Ga0102831_125920513300008996EstuarineKPANFGVDPLPPGSLHDEFSTTGKPNVTWRTISGNGPKPQPSRLGISNSKDKFKPTSKYTV*
Ga0102688_140309013300011381Freshwater LakeLSKIKSSLLGLKGEKPARFGVDPVPPDSLHLTYSTTGTPKIKWRKISGEDTKPTPSRLDINDSKDKYGPNKKYGK*
Ga0119955_110228113300012006FreshwaterMSLLTKLKTSILGLAGNKPSQFGVDPVPPDSLHYTYSVSGKPNVKWRTISGSGMKPQPSRLDVGNDKYNSKKKYTGK*
Ga0153799_101714823300012012FreshwaterMGLLDKLKSSILGLGGSKPSSFGVDPVPPDSLHDTFSTTGAPNVKWRTISGGGPKPAPSRLDIGDTKSTFRPTYKYSDHKPK*
Ga0153799_104100523300012012FreshwaterILGLAGNKPSQFGVDPTPPDSLPYAYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK*
Ga0153805_101434613300012013Surface IceNMSLLTKLKNSILGLAGNKPSQFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK*
Ga0153805_103886013300012013Surface IceITMSLLSKLFSKTSSILGLKGNTPLQFGVDPVPPDTLHYHYSTDGTPNIKWRTISGVGPKPRPSRLDVNDSKDKFTPSKKYTGK*
Ga0153801_100940623300012017FreshwaterMKISTILGLGGKKPSNFGVDPIPPDSLHLNYSTDGKPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKNKYIK*
Ga0157210_106132013300012665FreshwaterMGLLDKLKTGILGLKGAKPQQFGVNPVPPNSLHLDYSTNGKPDVTWRTISGVGQKPLPSRLDVNDSKDKYTPKKKYN
Ga0138273_100972923300012760Freshwater LakeMGLLDKLKSSIFGLGGNKPSGFGVDPTPPDSLHLNYSTTGKPDVKWRTISGTGPKPTPSRLDIGDSKDKYGPTNKYGK*
(restricted) Ga0172367_1022757523300013126FreshwaterMGLLDKLKSSILSLRGEKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGVGPKPQPSRLDIGESKDKYSPKKKYNG*
Ga0170791_1551362213300013295FreshwaterMSLLDKLKTGIYGLGGNRPQTFGVNPIPPNSLHLKYSTDGAPNITWRTINGTGPVPMPSRLDINDSKDKYTPKNKYNG*
Ga0177922_1086998223300013372FreshwaterMKISTILGLGGKKPSNFGVDPTPPDSLHLNYSTDGQPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKNKYSK*
Ga0119952_114698123300014050FreshwaterMGLLDKLKSSILGLGGNKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGVGPKPQPSRLDIGDTKDTYKPGFKYSDNKPR*
Ga0181350_104541123300017716Freshwater LakeMKISTILGLGGKKPSNFGVDPTPPDSLHLNYSTDGQPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKNKYNG
Ga0181347_100980543300017722Freshwater LakeGNKPSQFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYIGK
Ga0181347_102964423300017722Freshwater LakeMGLLDKLKTGILGLKGGKPQQFGVNPTPPDSLHLTYSTDGKPDVTWRTISGVGPKPLPSRLDVGETKDKFKPSFKYSDNKPK
Ga0181347_105954023300017722Freshwater LakeMKISTILGLGGNKPSNFGVDPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKNKYSK
Ga0181365_101464623300017736Freshwater LakeMKISTILGLGGKKPSNFGVDPTPPDSLHLNYSTDGQPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKNKYIK
Ga0181365_114598613300017736Freshwater LakeMSLLTKLKNSILGLAGNKPSQFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTG
Ga0181356_107102913300017761Freshwater LakePTTFGVDPLPPGSLHDEFSTTGKPNVTWRKISGGGTKPQPSRLDIGDSKDKYNPTSKYTG
Ga0181356_107192023300017761Freshwater LakeMKISTILGLGGKNPSNFGVDPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKNKYNG
Ga0181356_111111123300017761Freshwater LakeMGLLDKLKTGILGLKGAKPQQFGVNPVPPDSLHLNYSTDGKPNVTWRTISGTGQKPQPSRLDVGDTKDKFKPSFKYSDNKPK
Ga0181358_102516523300017774Freshwater LakeMSLLTKLKNSILGLAGNKPSQFGVDPTPPDSLHYTYSTNGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK
Ga0181358_106861113300017774Freshwater LakeMKISTILGLGGKKPSNFGVDPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKNKYS
Ga0181357_122403513300017777Freshwater LakeMKISTILGLGGKKPSNFGVDPIPPDSLHLNYSTDGKPDVKWRTISGNGPKPSPSRLDINDSKSKYTPKNKYGK
Ga0181357_125043423300017777Freshwater LakeMGLLDKLKSSILGLGGSKPSSFGVDPVPPDSLHDTFSTTGAPNVKWRTISGGGPKPAPSRLDIGDTKSTFRPTYKYSDHKPK
Ga0181349_124117223300017778Freshwater LakeLTKLKNSILGLAGNKPSQFGVDPIPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK
Ga0181346_102306933300017780Freshwater LakeMKISTILGLGGKKPSNFGVDPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKN
Ga0181348_100389253300017784Freshwater LakeFGVNPVPPDSLHLNYSTDGKPNVTWRTISGTGQKPQPSRLDVGDTKDKFKPSFKYSDNKP
Ga0169931_1006954933300017788FreshwaterMGLLDKLKSSILSLRGEKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGVGPKPQPSRLDIGESKDKYSPKKKYNG
Ga0181359_100030663300019784Freshwater LakeMSLLSKLFSKTSSILGLKGNTPLQFGVDPVPPDTLHYHYSTDGTPNIKWRTISGVGPKPRPSRLDINDSKSKFTPSKKYTGK
Ga0181359_103340623300019784Freshwater LakeMKISTILGLGGKKPSNFGVDPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPEPSRLDINDSKSKYTPKNKYIK
Ga0181359_104158623300019784Freshwater LakeMGLLDKLKTGILGLKGGKPQQFGVNPVPPDSLHLTYSTDGKPDVTWRTISGVGPKPLPSRLDVGETKDKFKPSFKYSDNKPK
Ga0181359_111374523300019784Freshwater LakeMSLLTKLKNSILGLAGNKPSQFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK
Ga0181359_112148923300019784Freshwater LakeMKISTILGLGGKNPSNFGVDPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKNKYIK
Ga0181359_118183913300019784Freshwater LakeMGLLDKLTSSILGLKGEKPANFGVDPLPPGSLHDEFSTTGKPNVTWRKISGGGTKPQPSRLDIGDSKDKYNPTSKYTG
Ga0181359_119454123300019784Freshwater LakeMKISTILGLGGNKPTQFGVDPTPPDSLHLNYSTDGKPDVKWRTISGAGMKPSPSRLDINDSKSKYTPKNKYKG
Ga0181359_123776813300019784Freshwater LakeLTKLKDSILGLAGNKPSQFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYIGK
Ga0211732_133087613300020141FreshwaterMKISTILGLGGNKPTQFGVDPTPPDSLHLNYSTDGKPDVKWRTISGAGMKPSPSRLDINDSKSKYTPKNKY
Ga0211736_1078386613300020151FreshwaterPSSFGVDPVPPDSLHDTFSTTGAPNVKWRTISGAGPKPSPSRLDIGDTKATFKPTYKYSDHKPK
Ga0211734_1136180723300020159FreshwaterMGLLDKLKTGILGLKGTKPQQFGVNPVPPDSLHLTYSTDGKPNVTWRTISGVGPKPLPSRLDVGETKDKFKPSFKYSDNKPK
Ga0211733_1113830923300020160FreshwaterMNLLSKLFSKTSSILGLKGNTPSQFGVDPVPPDTLHYHYSTDGTPNIKWRTISGVGPKPRPSRLDVNDSKDKFTPSKKYTGK
Ga0211726_1072464323300020161FreshwaterMGLFDKLKTGILGLKGTKPQQFGVNPVPPDSLHLTYSTDGKPNVTWRTISGVGPKPLPSRLDVGETKDKFKPSFKYSDNKPK
Ga0211735_1091044523300020162FreshwaterMKISTILGLGGNKPTQFGVDPTPPDSLHLNYSTNGTPEIKWRTIGGTGMKPQPSRLDINDSKDKYSPKNKYGK
Ga0211729_1109697313300020172FreshwaterMKISTILGLGGKKPSNFGVDPTPPNSLHLNYSTDGKPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKNKYGK
Ga0194134_1003120923300020179Freshwater LakeMRLLDKLKSSILSLKGEKPQQFGVNPVPPDSIHLTYSTDGKPNVSWRTISGTGMKPQPSRLDIGESKNKYSPKNKYSGK
Ga0194115_1016556823300020183Freshwater LakeLDKLKSSILSLKGEKPQQFGVNPVPPDSIHLTYSTDGKPNVSWRTISGTGMKPQPSRLDIGESKNKYSPKNKYSGK
Ga0194121_1009040223300020200Freshwater LakeMRLLDKLKSSILSLKGEKPQQFGVNPVPPDSIHLTYSTDGKPNVSWRTISGTGMKPQPSRLDVGESKDKYSPKNKYSGK
Ga0222714_1040197213300021961Estuarine WaterMGLLDKLKSSVFGLKGNKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGNGPKPQPSRLDIGETKDKFKPSFKYSDNKPR
Ga0222713_1025790323300021962Estuarine WaterMGLLDKLKSSVFGLKGNKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGNGPKPQPSRLDIGETKDKFKPSFKYSDNKPK
Ga0222713_1064660413300021962Estuarine WaterMGLLDKLKSSILGLGGNKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGVGPKPQPSRLDIG
Ga0222712_1008600123300021963Estuarine WaterMGLLDKLKSSILGLGGNKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGVGPKPQPSRLDIGETKDKFKPSFKYSDNKPR
Ga0181354_101804223300022190Freshwater LakeMSLLTKLKDSILGLAGNKPSQFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYIGK
Ga0181354_118897223300022190Freshwater LakeMKISTILGLGGNKPTQFGVDPTPPDSLHLNYSTDGKPDVKWRTISGAGMKPSPSRLDINDSKSKYTPKNKYSK
Ga0181354_119939023300022190Freshwater LakePTTFGVDPLPPGSLHDEFSTTGKPNVKWRKISGGGTKPQPSRLDIGDSKDKYNPTSKYTG
Ga0214921_1003319823300023174FreshwaterMNLLTKLKTSILSLAGNKPSKFGVDPIPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK
Ga0214921_1032600523300023174FreshwaterMGLLDKLKSSILGLGGGKPASFGVDPVPPNSLHNTFSTTGAPNVKWRTISGNGPKPEPSRLDIGDTKDAFRPTYKYSDHKPK
Ga0214921_1035629123300023174FreshwaterMKISTILGLGGNKPTQFGVDPIPPNSLHLNYSTDGTPEVKWRTISGNGPKPSPSRLDINDSKSKYTPKNKYGK
Ga0214923_1034612423300023179FreshwaterMGLLDKLKSSILGLGGSKPSSFGVDPVPPDSLHNTFSTTGAPNVKWRTISGNGPKPEPSRLDIGDTKDAFRPTYKYSDHKPK
Ga0214919_1014369323300023184FreshwaterMGLLDKLKSSILGLGGNKPTQFGVDPTPPESLHLTYSTTGKPDVKWRTISGTGPKPQPSRLDINDSKDKYGPTNKYGK
Ga0214919_1033063623300023184FreshwaterMGLLDKLKSSVLGLGGSKPAKFGVDPIPPDSLHLNYSTDGKPSVTWRTISGTGPKPQPSRLDINDSKDKYTPNKKYKG
Ga0214919_1052316123300023184FreshwaterMSLLTKLKTSILGLAGNKPSQFGVDPVPPDSLHYTYSVSGKPNVKWRTISGSGMKPQPSRLDVGNDKYNSKKKYTGK
Ga0244775_1005312323300024346EstuarineMKISTILGLGGKKPSNFGVDPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPEPSRLDINDSKSKYTPKNKYSK
Ga0244775_1017558113300024346EstuarineMGLLDKLKSSILGLGGSKPASFGVDPVPPNSLHITYSTDGNPSVKWRTISGTGPKPEPSRLDIGDTKSTFRPTYKYSDHKPK
Ga0244775_1024541723300024346EstuarineMSLLTKLKTSILGLAGNKPSKFGVDPTPPDSLHYTYSVSGKPNVKWRTISGEGMKPQPSRLDVGNDKYNSKKKYTGK
Ga0244775_1035678623300024346EstuarineMGLLDKLKNSVLGLGGSKPAKFGVDPIPPDSLHLNYSTDGKPDVTWRTISGTGPKPQPSRLDINDSKDKYTPRKKYSGK
Ga0244775_1137570513300024346EstuarineMSLLSKLFSKTSSILGLKGNTPLQFGVDPVPPDTLHYHYSTDGTPNIKWRTISGVGPKPRPSRLDINDSKSKFTPSKKYTG
Ga0244775_1141038823300024346EstuarineGSNKPTQFGVDPTPPDSLHLNYSTDGKPDVKWRTISGAGMKPSPSRLDINDSKSKYTPKNKYKG
Ga0209443_116095423300027707Freshwater LakeMKISTILGLGGKKPSNFGVDPTPPDSLHLNYSTDGKPDVKWRTISGNGPKPTPSRLDINDSKSKYTPKNKYSK
Ga0209768_1025673523300027772Freshwater LakeMGLLDKLKTGILGLKGGKPQQFGVNPVPPDSLHLTYSTDGKPNVTWRTISGVGPKPLPSRLDVGETKDKFKPSFKYSDNKPK
Ga0209768_1033399213300027772Freshwater LakeTMSLLSKLFSKTSSILGLKGNTPLQFGVDPVPPDALHYHYSTDGTPNIKWRTISGVGPKPRPSRLDINDSKSKFTPSKKYTGK
Ga0247723_103223123300028025Deep Subsurface SedimentMGLLDKIKSSVLGLGGEKPANFGVDPLPPGSLHDEFSTTGKPNVTWRTIKGNGPKPQPSRLDIGDSKDKYRPTSKYTG
Ga0315899_1071745123300031784FreshwaterMGLLDKLKSSILGLGGNKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGVGPKPQPSRLDIGETKDKFKPNFKYSDNKPK
Ga0315900_10001354453300031787FreshwaterMSQLLSKIKSSLLGLKGEKPARFGVDPVPPDSLHLTYSTTGTPKIKWRKISGEDTKPTPSRLDINDSKDKYGPNKKYGK
Ga0315900_1006145223300031787FreshwaterMGLLDKLKSSILGLGGTKPSQFGVDPVPPGSLHDEYSTNGEPNIRWRNIKGEGPKPSPSKLDIGDTKDTWRPRKKYIDNKPR
Ga0315900_1006197333300031787FreshwaterMGLLDKLKSSILGLGGNKPQQFGVNPVPPDSLHLTYSTDGKPDVTWRTISGNGPKPQPSRLDIGETKDKFKPSFKYSDNKPK
Ga0315900_1033395023300031787FreshwaterMGLLDKLKTGVLGLKGAKPQQFGVNPVPPDSLHLTYSTDGKPDVTWRTISGTGQKPKPSRLDIGDTKDKFKPNFKYSDNKPR
Ga0315900_1062037323300031787FreshwaterIYIKHTIMGLLDKLKSSILGLGGNKPQQFGVNPVPPDSLHLNYSTDGKPDVTWRTISGVGPKPQPSRLDIGETKDKFKPNFKYSDNKPK
Ga0315902_1103306923300032093FreshwaterILGLGGNKPQQFGVNPVPPDSLHLTYSTDGKPDVTWRTISGNGPKPQPSRLDIGETKDKFKPSFKYSDNKPK
Ga0334987_0469095_568_7743300034061FreshwaterILGLKGETPVNFGVDPLPPGSLHDEFSTTGKPNVKWRTISGNGPKPQPSRLDIGDSKDKYKPTSKYTG
Ga0335010_0524039_343_5793300034092FreshwaterMGLLDKLKASILSLKGEKPANFGVDPLPPGSLHDEFSTTGKPNVKWRTISGNGPKPQPSRLDIGDSKDKYKPTSKYTG
Ga0335031_0441822_319_5553300034104FreshwaterMGLLDKLTSSILGLKGETPVNFGVDPLPPGSLHDEFSTTGKPNVKWRTISGNGPKPQPSRLDIGDSKDKYKPTSKYTG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.