Basic Information | |
---|---|
Family ID | F076069 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 118 |
Average Sequence Length | 45 residues |
Representative Sequence | MKILKSIYNFLGDMGKARAATHLAQRGDHKGAKRLMMEDFKGWI |
Number of Associated Samples | 59 |
Number of Associated Scaffolds | 118 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 71.79 % |
% of genes near scaffold ends (potentially truncated) | 7.63 % |
% of genes from short scaffolds (< 2000 bps) | 47.46 % |
Associated GOLD sequencing projects | 41 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (83.051 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (71.186 % of family members) |
Environment Ontology (ENVO) | Unclassified (84.746 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (95.763 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 118 Family Scaffolds |
---|---|---|
PF12086 | DUF3563 | 5.93 |
PF00149 | Metallophos | 2.54 |
PF05050 | Methyltransf_21 | 2.54 |
PF00182 | Glyco_hydro_19 | 2.54 |
PF03477 | ATP-cone | 1.69 |
PF13517 | FG-GAP_3 | 1.69 |
PF02668 | TauD | 1.69 |
PF14235 | DUF4337 | 1.69 |
PF01223 | Endonuclease_NS | 1.69 |
PF13392 | HNH_3 | 1.69 |
PF00565 | SNase | 0.85 |
PF12708 | Pectate_lyase_3 | 0.85 |
PF03851 | UvdE | 0.85 |
PF05292 | MCD | 0.85 |
PF10431 | ClpB_D2-small | 0.85 |
PF00574 | CLP_protease | 0.85 |
PF13394 | Fer4_14 | 0.85 |
PF01521 | Fe-S_biosyn | 0.85 |
PF01227 | GTP_cyclohydroI | 0.85 |
PF13385 | Laminin_G_3 | 0.85 |
PF16363 | GDP_Man_Dehyd | 0.85 |
PF00535 | Glycos_transf_2 | 0.85 |
PF13186 | SPASM | 0.85 |
PF13476 | AAA_23 | 0.85 |
PF03480 | DctP | 0.85 |
PF13203 | DUF2201_N | 0.85 |
PF06094 | GGACT | 0.85 |
PF00730 | HhH-GPD | 0.85 |
PF13609 | Porin_4 | 0.85 |
COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
---|---|---|---|
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 2.54 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 2.54 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.69 |
COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 1.69 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.69 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.85 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.85 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.85 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.85 |
COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.85 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.83 % |
Unclassified | root | N/A | 10.17 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10003303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6461 | Open in IMG/M |
3300004095|Ga0007829_10014137 | All Organisms → Viruses → Predicted Viral | 1533 | Open in IMG/M |
3300004772|Ga0007791_10001919 | Not Available | 7588 | Open in IMG/M |
3300006484|Ga0070744_10133510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300009068|Ga0114973_10000060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 65737 | Open in IMG/M |
3300009068|Ga0114973_10064105 | All Organisms → Viruses → Predicted Viral | 2140 | Open in IMG/M |
3300009068|Ga0114973_10149445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
3300009068|Ga0114973_10563198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300009151|Ga0114962_10005807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9621 | Open in IMG/M |
3300009151|Ga0114962_10007438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8325 | Open in IMG/M |
3300009151|Ga0114962_10013540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5929 | Open in IMG/M |
3300009151|Ga0114962_10014354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5726 | Open in IMG/M |
3300009151|Ga0114962_10016164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5357 | Open in IMG/M |
3300009151|Ga0114962_10019059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4880 | Open in IMG/M |
3300009151|Ga0114962_10027880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3908 | Open in IMG/M |
3300009151|Ga0114962_10031490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3634 | Open in IMG/M |
3300009151|Ga0114962_10039918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3157 | Open in IMG/M |
3300009151|Ga0114962_10046473 | Not Available | 2881 | Open in IMG/M |
3300009151|Ga0114962_10111712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1686 | Open in IMG/M |
3300009151|Ga0114962_10178119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
3300009151|Ga0114962_10476828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300009151|Ga0114962_10623149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300009151|Ga0114962_10666623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300009151|Ga0114962_10668628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300009154|Ga0114963_10000016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 98763 | Open in IMG/M |
3300009154|Ga0114963_10003731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10420 | Open in IMG/M |
3300009154|Ga0114963_10015202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5183 | Open in IMG/M |
3300009155|Ga0114968_10057836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2472 | Open in IMG/M |
3300009158|Ga0114977_10001430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15669 | Open in IMG/M |
3300009158|Ga0114977_10049019 | Not Available | 2618 | Open in IMG/M |
3300009158|Ga0114977_10074997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2070 | Open in IMG/M |
3300009158|Ga0114977_10496325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300009161|Ga0114966_10023761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4603 | Open in IMG/M |
3300009163|Ga0114970_10331351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300009163|Ga0114970_10464248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300009164|Ga0114975_10000002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 199181 | Open in IMG/M |
3300009164|Ga0114975_10032758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3108 | Open in IMG/M |
3300009164|Ga0114975_10261341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
3300009180|Ga0114979_10175994 | Not Available | 1304 | Open in IMG/M |
3300009182|Ga0114959_10021543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4080 | Open in IMG/M |
3300009183|Ga0114974_10004191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10787 | Open in IMG/M |
3300009185|Ga0114971_10133817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1501 | Open in IMG/M |
3300009684|Ga0114958_10000730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 27741 | Open in IMG/M |
3300010157|Ga0114964_10176479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
3300010157|Ga0114964_10231948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300010157|Ga0114964_10621979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300010158|Ga0114960_10043819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | 2698 | Open in IMG/M |
3300010158|Ga0114960_10142000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1297 | Open in IMG/M |
3300010158|Ga0114960_10251972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
3300010158|Ga0114960_10485901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300010160|Ga0114967_10000171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 53372 | Open in IMG/M |
3300010334|Ga0136644_10615110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300010885|Ga0133913_10210313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5182 | Open in IMG/M |
3300010885|Ga0133913_10590528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2917 | Open in IMG/M |
3300010885|Ga0133913_11252374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1898 | Open in IMG/M |
3300010885|Ga0133913_12651702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1214 | Open in IMG/M |
3300011114|Ga0151515_10085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 38381 | Open in IMG/M |
3300011115|Ga0151514_10411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18868 | Open in IMG/M |
3300011335|Ga0153698_1004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 113802 | Open in IMG/M |
3300012345|Ga0157139_1015336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300012773|Ga0138290_1209881 | Not Available | 757 | Open in IMG/M |
3300012778|Ga0138269_1120983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300013006|Ga0164294_10548587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300013286|Ga0136641_1000743 | Not Available | 13834 | Open in IMG/M |
3300013295|Ga0170791_12070290 | Not Available | 513 | Open in IMG/M |
3300013295|Ga0170791_12075298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300013295|Ga0170791_13552115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
3300019784|Ga0181359_1077423 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
3300020141|Ga0211732_1513884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300020151|Ga0211736_10622745 | All Organisms → Viruses → Predicted Viral | 2201 | Open in IMG/M |
3300020205|Ga0211731_10182299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300020205|Ga0211731_11491920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300021516|Ga0194045_1121448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300021519|Ga0194048_10143152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300023184|Ga0214919_10004146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21323 | Open in IMG/M |
3300023184|Ga0214919_10019135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7752 | Open in IMG/M |
3300023184|Ga0214919_10020207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7484 | Open in IMG/M |
3300023184|Ga0214919_10052144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3899 | Open in IMG/M |
3300023184|Ga0214919_10212590 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
3300023184|Ga0214919_10446038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300023184|Ga0214919_10787344 | Not Available | 522 | Open in IMG/M |
3300024346|Ga0244775_10158713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1907 | Open in IMG/M |
3300024346|Ga0244775_10821406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
3300024346|Ga0244775_11272263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300025466|Ga0208497_1018079 | All Organisms → Viruses → Predicted Viral | 1659 | Open in IMG/M |
3300025578|Ga0208864_1006179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3840 | Open in IMG/M |
3300027631|Ga0208133_1102898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300027708|Ga0209188_1000071 | Not Available | 122586 | Open in IMG/M |
3300027708|Ga0209188_1003043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11877 | Open in IMG/M |
3300027708|Ga0209188_1025613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2914 | Open in IMG/M |
3300027712|Ga0209499_1000579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 26990 | Open in IMG/M |
3300027712|Ga0209499_1100303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
3300027733|Ga0209297_1000309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 32722 | Open in IMG/M |
3300027734|Ga0209087_1012691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4268 | Open in IMG/M |
3300027734|Ga0209087_1142700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
3300027736|Ga0209190_1024109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3360 | Open in IMG/M |
3300027736|Ga0209190_1081666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1534 | Open in IMG/M |
3300027741|Ga0209085_1004342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7638 | Open in IMG/M |
3300027741|Ga0209085_1164667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
3300027741|Ga0209085_1275824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300027746|Ga0209597_1093202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1378 | Open in IMG/M |
3300027747|Ga0209189_1272208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300027749|Ga0209084_1000214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 55651 | Open in IMG/M |
3300027749|Ga0209084_1000254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 51863 | Open in IMG/M |
3300027749|Ga0209084_1003002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12596 | Open in IMG/M |
3300027749|Ga0209084_1005498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8589 | Open in IMG/M |
3300027749|Ga0209084_1036100 | Not Available | 2493 | Open in IMG/M |
3300027749|Ga0209084_1060035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1791 | Open in IMG/M |
3300027754|Ga0209596_1299472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300027759|Ga0209296_1004778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8804 | Open in IMG/M |
3300027770|Ga0209086_10024317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3732 | Open in IMG/M |
3300027777|Ga0209829_10001563 | Not Available | 18332 | Open in IMG/M |
3300027797|Ga0209107_10000758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18379 | Open in IMG/M |
3300027969|Ga0209191_1028616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2692 | Open in IMG/M |
3300028393|Ga0304728_1099951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | 1111 | Open in IMG/M |
3300028394|Ga0304730_1000237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 49231 | Open in IMG/M |
3300028394|Ga0304730_1001184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20342 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 71.19% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.47% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.78% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.24% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.39% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.69% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.69% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.69% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
3300012345 | Freshwater microbial communities from Burnt River, Ontario, Canada - S22 | Environmental | Open in IMG/M |
3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012778 | Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300021516 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L626-11m | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_100033036 | 3300000756 | Freshwater And Sediment | MKIVKAIYNFFGAMAQANTAANMARNGDHKGAQRLMMQDFKGWI* |
Ga0007829_100141372 | 3300004095 | Freshwater | MFVVKSIYNFLEHVGRVRACTYFAHKGDYASAERVLLEEFKGWI* |
Ga0007791_1000191913 | 3300004772 | Freshwater | MTILKSIYNFLENYGRCRAAVHLTSIGDHAGAQRIMMEDFQGWI* |
Ga0070744_101335102 | 3300006484 | Estuarine | MVIVKIVKAIYNFLGEVGRVRAASYLARRGDHKGAQRLMMEDFKGWI* |
Ga0114973_10000060105 | 3300009068 | Freshwater Lake | MITILKFIYNLLAQMGRARSAAHLAALGDHAGAKRLMMEDFRGWI* |
Ga0114973_100641051 | 3300009068 | Freshwater Lake | MVMTILKSIYNFFGAMAQANTAANMARNGDHAGAQRLMMEDFRGWI* |
Ga0114973_101494456 | 3300009068 | Freshwater Lake | MVMTILKSIYNFFGAMAQANTAANMARNGDHKGAQRLMMEDFRGWI* |
Ga0114973_105631982 | 3300009068 | Freshwater Lake | MKTILKSIYNFLEQAGRVRAATHLANRGDHAGAKRLMMEDFKGWI* |
Ga0114962_1000580713 | 3300009151 | Freshwater Lake | MSILKAIYNFLCEVGRVRAASHLARLGDHEAARRVMLMDLK* |
Ga0114962_1000743812 | 3300009151 | Freshwater Lake | MKLLKSIYNFLGDMGKARAATHLAQRGDHVGAKRLMMEDFKGWI* |
Ga0114962_1001354012 | 3300009151 | Freshwater Lake | MVIMKVLKAIYNFLGEVGRVRAAAHLAHKGDHAGAQRIMSLKEFKGWI* |
Ga0114962_100143546 | 3300009151 | Freshwater Lake | MSILQAIYNFLSEVGRARAASHLARLGDHEAARRVMLMDLK* |
Ga0114962_1001616413 | 3300009151 | Freshwater Lake | MVIMKIIKAIYNFLGEMGKVRAATHFAQRGDHDSARRVMMQEFKGWI* |
Ga0114962_100190593 | 3300009151 | Freshwater Lake | MKILKSIYNFLGDMGKARAATHLAQRGDHRGAKRLMMEDFKGWI* |
Ga0114962_1002788010 | 3300009151 | Freshwater Lake | MVIMKIVKAIYNFLGAMGLAHAASNLARSGDHKGAKRLMMQDFKGWI* |
Ga0114962_1003149010 | 3300009151 | Freshwater Lake | MVIMQVLKAIYNFLGEMGKARAATHLAHQGDYAGAQRLLMEDFKGWI* |
Ga0114962_100399186 | 3300009151 | Freshwater Lake | MVIMRVLKAIYNFLGEVGRVRAATHLAHKGDHAGAQRIMSMKEFKGWI* |
Ga0114962_100464733 | 3300009151 | Freshwater Lake | MKIVKAIYNFFEDMGRARAAAHLARQGDHAGAQRIMTEDFKGWI* |
Ga0114962_101117125 | 3300009151 | Freshwater Lake | MVIMKVIKAIYNFLGDIGRVRAAAHLARNGDHAGAQRIMMTEFKGWI* |
Ga0114962_101781192 | 3300009151 | Freshwater Lake | MDMIIIKSIYNFLAEMGRARAATHLARSGDYAGARRIMMEDFKGWI* |
Ga0114962_104332482 | 3300009151 | Freshwater Lake | MVIMKIVKAIYNFFGDIGRVRAAAHLARSGDHKGAQRLMMQDFKGWI* |
Ga0114962_104768283 | 3300009151 | Freshwater Lake | MKILKSIYNFLGEVGRVRAASHLARSGDHAGARRVMMEDFKGWI* |
Ga0114962_106231492 | 3300009151 | Freshwater Lake | MVMTILKSIYNFLGTMGRVRAAAHLARHGDHAGAQRLMMEDFRGWI* |
Ga0114962_106666231 | 3300009151 | Freshwater Lake | MVIMKVIKAIYNFLGEMGKAHAASNLARSGDHKAAKKLMMEDFKGWI* |
Ga0114962_106686281 | 3300009151 | Freshwater Lake | MVIMKIVKAIYNFLGEMGKAHAASNLARSGDYKGAKRLMMEDFKGWI* |
Ga0114963_100000165 | 3300009154 | Freshwater Lake | MIILKSIYNFLESYGRCRAAAYLASHGDTAGAHRIMMEDFRGWI* |
Ga0114963_100037318 | 3300009154 | Freshwater Lake | MKVILKSIYNFLEDVGRVRAATYFAQRGDHAGAQRVMMEDFKGWI* |
Ga0114963_100152026 | 3300009154 | Freshwater Lake | MKAILKSIYNFLEDFGRVRAATYFAQRGDHASAHRVMMEDFKGWI* |
Ga0114968_100578368 | 3300009155 | Freshwater Lake | MKILKSIYNFLGQMARAHAAANLARSGDHRAAKRLMMEDFRGWI* |
Ga0114977_1000143031 | 3300009158 | Freshwater Lake | MKILKFIYNFLLQVGRAHAAANLARNGDHKAAKRLMMEDFRGWV* |
Ga0114977_100490192 | 3300009158 | Freshwater Lake | MITILKSIYNFLAQVGRAHAASNMARSGDHKGAKRLMMEDFRGWI* |
Ga0114977_100749971 | 3300009158 | Freshwater Lake | ILKSIYNFFGAMSQANTAANMARNGDHKGAQRLMMEDFRGWI* |
Ga0114977_104963252 | 3300009158 | Freshwater Lake | MKILKSIYNFLGQMGRAHAASNMARSGDHKGARRLMMEDFKGWI* |
Ga0114966_100237611 | 3300009161 | Freshwater Lake | MKVVKAIYNFFGAMAQANTAANMARNGDHKGAKRLMMEDFKGWI* |
Ga0114970_103313514 | 3300009163 | Freshwater Lake | MVMTILKSIYNFFGAMAQANTAANMARNGDYKGAQRLMMEDFRGWI* |
Ga0114970_104642482 | 3300009163 | Freshwater Lake | MTILKSIYNFFGAMAQANTAANMARNGDHKGAQRLMMEDFRGWI* |
Ga0114975_1000000243 | 3300009164 | Freshwater Lake | MKLLKSIYNFLGDMGKARAATHLAQRGDHAGAKRIMMEDFKGWI* |
Ga0114975_100327585 | 3300009164 | Freshwater Lake | MVIMKVLKSIYNFLAQMGRANAAANMARNGDHKGAQRLMMQDFKGWI* |
Ga0114975_102613411 | 3300009164 | Freshwater Lake | ILKSIYNFLEQAGRVRAATHLANRGDHAGAKRLMMEDFKGWI* |
Ga0114979_101759941 | 3300009180 | Freshwater Lake | MITILKSIYNFLAQVGRAHAASNMARSGDHEGAKRLMMEDFRG |
Ga0114959_100215434 | 3300009182 | Freshwater Lake | MKAILKSIYNFLEDFGRVRAATYFAQRGDHASARRVMMEDFKGWI* |
Ga0114974_1000419111 | 3300009183 | Freshwater Lake | MDMKILKSIYNFFGAMSQANTAANMARNGDHKGAQRLMMEDFRGWI* |
Ga0114971_101338171 | 3300009185 | Freshwater Lake | MSVLKSIYNFLGEMGKARAATHLAHQGDYAGAKRLMMEDFKGWI* |
Ga0114958_1000073011 | 3300009684 | Freshwater Lake | MVIMKVILTSIYNFLENIGRVRAATHLAQSGDYAGAKRVMMEDFKGWI* |
Ga0114964_101764794 | 3300010157 | Freshwater Lake | MKIIKAIYNFLGEMGKVRAATHFAQRGDHDSARRVMMQEFKGWI* |
Ga0114964_102319482 | 3300010157 | Freshwater Lake | MVIMKILKSIYNFLGDMGKARAATHLAQRGDHRGAKRLMMEDFKGWI* |
Ga0114964_106219791 | 3300010157 | Freshwater Lake | LKSIYNFLEDFGRVRAATYFAQRGDHASAHRVMMEDFKGWI* |
Ga0114960_100438193 | 3300010158 | Freshwater Lake | MRVLKAIYNFLGEVGRVRAATHLAHKGDHAGAQRIMSMKEFKGWI* |
Ga0114960_101420004 | 3300010158 | Freshwater Lake | MDMIIIKSIYNFLAEMGRARAATHLAQRGDHRGAKRLMMEDFKGWI* |
Ga0114960_102519722 | 3300010158 | Freshwater Lake | MKILQAIYNFLGDMGRARAATHLAHRGDYAGAQRIMKIEFK* |
Ga0114960_104859013 | 3300010158 | Freshwater Lake | MVMTILKSIYNFLGEMGRVRAAAHLARHGDHAGAQRLMMQDFRGWI* |
Ga0114967_1000017128 | 3300010160 | Freshwater Lake | MLKAIYNFLGEMGKAHAASNLARSGDYKGAKRLMMEDFKGWI* |
Ga0136644_106151102 | 3300010334 | Freshwater Lake | MKIVKAIYNFLGEMGKAHAASNLARSGDYKGAKRLMMEDFKGWI* |
Ga0133913_102103136 | 3300010885 | Freshwater Lake | MKVILKSIYNFLEDFGRVRAATYFAQRGDHASARRVMMEDFKGWI* |
Ga0133913_105905282 | 3300010885 | Freshwater Lake | MVIMKVILTSIYNFLEHIGRVRAATHLAQSGDYAGAKRVMMEDFKGWI* |
Ga0133913_112523741 | 3300010885 | Freshwater Lake | KSIYNFFGAMAQANTAANMARNGDHKGAQRLMMEDFRGWI* |
Ga0133913_126517023 | 3300010885 | Freshwater Lake | MKVVKAIYNFFGAIAQANAAANMARNGDHKGAHRLMMQDFKGWI* |
Ga0151515_1008551 | 3300011114 | Freshwater | MVMTILKSIYNFFGAMALANTAANMARNGDHKGAQRLMMEDFRGWI* |
Ga0151514_104115 | 3300011115 | Freshwater | MKIIKATYNFLMQMGRAHAAAHLARSGDHKAATRLMMEDFRGWV* |
Ga0153698_1004112 | 3300011335 | Freshwater | MTVFKSFYNFLGNYGRCCVAVHLTALGDHAGAQRIMMEDFQGWI* |
Ga0157139_10153362 | 3300012345 | Freshwater | MVIMRLLKSIYNFLGEVGRIRAASHLARQGDHASAQKLMMEDFKGWI* |
Ga0138290_12098813 | 3300012773 | Freshwater Lake | MITILKSIYNFLAQVGRAHAASNMARSGDHEGAKRLMMEDFRGWI* |
Ga0138269_11209832 | 3300012778 | Freshwater Lake | MVIMKIVKAIYNFLGEMGKAHAASNLARSGDHKAAKKLMMEDFKGWI* |
Ga0164294_105485872 | 3300013006 | Freshwater | MITILKFIYNLLAQMGHARSAAHLAALGDHAGAKRLMMEDFRGWI* |
Ga0136641_10007434 | 3300013286 | Freshwater | MKIVKAIYNFLGEVGRVRAATHLARRGDHQGAKRLMMEDFKGWI* |
Ga0170791_120702902 | 3300013295 | Freshwater | MKILKSIYNFLGQMARAHAAANLARSGDHRAAKRLMMEDFR |
Ga0170791_120752982 | 3300013295 | Freshwater | MVMTILKSIYNFFGAMAQANTAANMARNGDHKGAQRLMMEDFR |
Ga0170791_135521153 | 3300013295 | Freshwater | MKVILKSIYNFLEDFGRVRAATYFAQRGDHAGAQRVMMEDFKGWI* |
Ga0181359_10774234 | 3300019784 | Freshwater Lake | MQILKLIYNFLGEIGRVRAASHLARYGDHAAAKRIMMEDFKGWI |
Ga0211732_15138841 | 3300020141 | Freshwater | MTILKSIYNFFGAMAQANTAANMARNGDHKGAKQLMMEDFRGWI |
Ga0211736_106227453 | 3300020151 | Freshwater | MTILKSIYNFFGAMAQANTAANMARNGDHKGAQRLMMEDFRGWI |
Ga0211731_101822991 | 3300020205 | Freshwater | MKVVKAIYNFFGAIAQANAAANMARNGDHKGAQRLMMQDFKGWI |
Ga0211731_114919202 | 3300020205 | Freshwater | MTILKSIYNFLAQMGRAHAASNMARNGDHKGARRLMMEDFRGWI |
Ga0194045_11214482 | 3300021516 | Anoxic Zone Freshwater | MKILKSIYNFLGDMGKARAATHLAQRGDHKGAKRLMMEDFKGWI |
Ga0194048_101431521 | 3300021519 | Anoxic Zone Freshwater | MKLLKSIYNFLGDMGRVRAATHLAHRGDHVGAKRLMMQDFKGWI |
Ga0214919_100041467 | 3300023184 | Freshwater | MKILKSIYNFLGEMGRAHAAANMARNGDHKGAQRLMMQDFKGWI |
Ga0214919_1001913512 | 3300023184 | Freshwater | MVIMQILKAIYNFLGDMGRVRAATHLAYRGDHKGAKRLMMEDFKGWI |
Ga0214919_100202077 | 3300023184 | Freshwater | MKLLKSIYNFLGDMGKARAATHLAQRGDHAGAKRLMMEDFKGWI |
Ga0214919_100521446 | 3300023184 | Freshwater | MTILKSIYNFFGAIAQANTAANMARNGDYQGAQRLMMEDFQGWI |
Ga0214919_102125904 | 3300023184 | Freshwater | MNILKSIYNFLGEMGRARAASHLARCGDYNGAQKLIMTEFKGWI |
Ga0214919_104460382 | 3300023184 | Freshwater | MQVLKAIYNFLGEMGKARAATHLAHQGDYAGAQRLLMEDFKGWI |
Ga0214919_107873443 | 3300023184 | Freshwater | MKILKSIFNFLGQMARAHAAAHLARSGDHKAAKRLMMEDFRG |
Ga0244775_101587136 | 3300024346 | Estuarine | MIILKSIYNFFGAMAQANTAANMARNGDHKGAQRLMMEDFRGWI |
Ga0244775_108214061 | 3300024346 | Estuarine | MVMTILKSIYNFFGAMALANTAANMARNGDHKGAQRLMMQDFKGWI |
Ga0244775_112722632 | 3300024346 | Estuarine | MVIVKIVKAIYNFLGEVGRVRAASYLARRGDHKGAQRLMMEDFKGWI |
Ga0208497_10180792 | 3300025466 | Freshwater | MFVVKSIYNFLEHVGRVRACTYFAHKGDYASAERVLLEEFKGWI |
Ga0208864_10061797 | 3300025578 | Freshwater | MTILKSIYNFLENYGRCRAAVHLTSIGDHAGAQRIMMEDFQGWI |
Ga0208133_11028981 | 3300027631 | Estuarine | MIILKSIYNFFGAMAQAKTAANMARNGDHKGAQRLMMEDFRGWI |
Ga0209188_1000071135 | 3300027708 | Freshwater Lake | MSILQAIYNFLSEVGRARAASHLARLGDHEAARRVMLMDLK |
Ga0209188_10030435 | 3300027708 | Freshwater Lake | MKVILKSIYNFLEDVGRVRAATYFAQRGDHAGAQRVMMEDFKGWI |
Ga0209188_10256134 | 3300027708 | Freshwater Lake | MKAILKSIYNFLEDFGRVRAATYFAQRGDHASARRVMMEDFKGWI |
Ga0209499_10005796 | 3300027712 | Freshwater Lake | MVIMKVILTSIYNFLENIGRVRAATHLAQSGDYAGAKRVMMEDFKGWI |
Ga0209499_11003034 | 3300027712 | Freshwater Lake | MIILKSIYNFLESYGRCRAAAYLASHGDTAGAHRIMMEDFRGWI |
Ga0209297_100030927 | 3300027733 | Freshwater Lake | MKILKFIYNFLLQVGRAHAAANLARNGDHKAAKRLMMEDFRGWV |
Ga0209087_10126919 | 3300027734 | Freshwater Lake | MITILKSIYNFLAQVGRAHAASNMARSGDHEGAKRLMMEDFRGWI |
Ga0209087_11427003 | 3300027734 | Freshwater Lake | MKTILKSIYNFLEQAGRVRAATHLANRGDHAGAKRLMMEDFKGWI |
Ga0209190_10241097 | 3300027736 | Freshwater Lake | MKVVKAIYNFFGAIAQANAAANMARNGDHKGAHRLMMQDFKGWI |
Ga0209190_10816667 | 3300027736 | Freshwater Lake | MTILKSIYNFFGAMAQANTAANMARNGDHAGAQRLMMEDFRGWI |
Ga0209085_10043426 | 3300027741 | Freshwater Lake | MKVILKSIYNFLEDFGRVRAATYFAQRGDHASARRVMMEDFKGWI |
Ga0209085_11646673 | 3300027741 | Freshwater Lake | MKILKSIYNFLGDMGKARAATHLAQRGDHRGAKRLMMEDFKGWI |
Ga0209085_12758242 | 3300027741 | Freshwater Lake | MKVLKAIYNFLGEVGRVRAAAHLAHKGDHAGAQRIMSLKEFKGWI |
Ga0209597_10932021 | 3300027746 | Freshwater Lake | KSIYNFLGEMGKARAATHLAHQGDYAGAKRLMMEDFKGWI |
Ga0209189_12722082 | 3300027747 | Freshwater Lake | MKLLKSIYNFLGDMGKARAATHLAQRGDHVGAKRLMMEDFKGWI |
Ga0209084_100021415 | 3300027749 | Freshwater Lake | MVIMRVLKAIYNFLGEVGRVRAATHLAHKGDHAGAQRIMSMKEFKGWI |
Ga0209084_100025415 | 3300027749 | Freshwater Lake | MVIMKIVKAIYNFLGEMGKAHAASNLARSGDYKGAKRLMMEDFKGWI |
Ga0209084_100300217 | 3300027749 | Freshwater Lake | MSILKAIYNFLCEVGRVRAASHLARLGDHEAARRVMLMDLK |
Ga0209084_10054982 | 3300027749 | Freshwater Lake | MKIVKAIYNFFEDMGRARAAAHLARQGDHAGAQRIMTEDFKGWI |
Ga0209084_10361004 | 3300027749 | Freshwater Lake | MKILKSIYNFLGEVGRVRAASHLARSGDHAGARRVMMEDFKGWI |
Ga0209084_10600353 | 3300027749 | Freshwater Lake | MVIMKIIKAIYNFLGEMGKVRAATHFAQRGDHDSARRVMMQEFKGWI |
Ga0209596_12994723 | 3300027754 | Freshwater Lake | MITILKFIYNLLAQMGRARSAAHLAALGDHAGAKRLMMEDFRGWI |
Ga0209296_10047789 | 3300027759 | Freshwater Lake | MKILKSIYNFFGAMSQANTAANMARNGDHKGAQRLMMEDFRGWI |
Ga0209086_1002431710 | 3300027770 | Freshwater Lake | MKVVKAIYNFFGAMAQANTAANMARNGDHKGAKRLMMEDFKGWI |
Ga0209829_1000156310 | 3300027777 | Freshwater Lake | MKVILKSIYNFLEDFGRVRAATYFAQRGDHASAHRVMMEDFKGWI |
Ga0209107_1000075816 | 3300027797 | Freshwater And Sediment | MKIVKAIYNFFGAMAQANTAANMARNGDHKGAQRLMMQDFKGWI |
Ga0209191_10286164 | 3300027969 | Freshwater Lake | MKVLKSIYNFLAQMGRANAAANMARNGDHKGAQRLMMQDFKGWI |
Ga0304728_10999511 | 3300028393 | Freshwater Lake | MRVLKAIYNFLGEVGRVRAATHLAHKGDHAGAQRIMSMKEFKGWI |
Ga0304730_100023729 | 3300028394 | Freshwater Lake | MVIMYMLKAIYNFLGEMGKAHAASNLARSGDYKGAKRLMMEDFKGWI |
Ga0304730_100118412 | 3300028394 | Freshwater Lake | MKILKSIYNFLGQMARAHAAANLARSGDHRAAKRLMMEDFRGWI |
⦗Top⦘ |