 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F076049 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRMSQPGPPGQANAAPWRRWLLPAAIAAGFVTELALPRGAA |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.07 % |
| % of genes from short scaffolds (< 2000 bps) | 89.83 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.356 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.492 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.729 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.525 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF04264 | YceI | 8.47 |
| PF00004 | AAA | 0.85 |
| PF14690 | zf-ISL3 | 0.85 |
| PF02467 | Whib | 0.85 |
| PF01435 | Peptidase_M48 | 0.85 |
| PF03109 | ABC1 | 0.85 |
| PF06745 | ATPase | 0.85 |
| PF04545 | Sigma70_r4 | 0.85 |
| PF09995 | MPAB_Lcp_cat | 0.85 |
| PF04542 | Sigma70_r2 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 8.47 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.85 |
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.85 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.85 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.85 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.36 % |
| All Organisms | root | All Organisms | 18.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.17% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 10.17% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.08% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.69% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.69% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.85% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028867 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_06808240 | 2189573001 | Grass Soil | MRTSSPGPPGRADAAQWRRWVFPAAIGAGLVTLLALPRGAAPGM |
| Ga0066688_106147942 | 3300005178 | Soil | MRMSSPGPPGQANVAPWRRWLLPGIVVAFFVALFALPRGAAQGPALS |
| Ga0070690_1001523501 | 3300005330 | Switchgrass Rhizosphere | MRTSSPGPPGRAGAAPWRRWVFPAAIAAGFVTLLVLPRAAAP |
| Ga0070660_1002940043 | 3300005339 | Corn Rhizosphere | MRTSSPGPPGRADAAQWRRWVFPAAIAAGFVTLLVLPRAAAP |
| Ga0070659_1014374382 | 3300005366 | Corn Rhizosphere | MRTSSPGPPGRADAAQWRRWVFPAVIAAGFVTLLVLPRAA |
| Ga0070713_1003241723 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMSQPGPPGQANAAPWRRWLFPGIFAAFFVVLLGLPRGAAP |
| Ga0070713_1006005661 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRASSPGPPGRAGAAPWRRWVFPAAIAAGFVTLLVLPRAAAP |
| Ga0070694_1017745491 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTSSPGPPGRADAAQWRRWVFPAAIAAGFVTLLVLPRGA |
| Ga0070662_1009216922 | 3300005457 | Corn Rhizosphere | MRMSQPGPGGQANVAPWRRWLLPAAVTAGLVALLALPRGAAP |
| Ga0070681_100988001 | 3300005458 | Corn Rhizosphere | MRTSSPGPPGRADAAPWRRWVFPAAIAAGFVTLLVLPRAAAPSMALSY |
| Ga0070707_10000304723 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMSHPGPDGQANAAPWRRWLFPAAAMASLVTLLALSGGPPPACR* |
| Ga0070707_1007386251 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMSQPGPPGHAHPAPWRRWLLPVAVTAGFLALLAVPRGAAAGMTLSYTR |
| Ga0070698_1017980041 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMSQPGPRDHANAAPWRRWLLPGVIAASFVTLLVLPRGAAPGTPLS |
| Ga0070734_103794092 | 3300005533 | Surface Soil | MRTSSPVPPGRANVASWRRWLFPGIIVAFFAALFALPRGAVAGM |
| Ga0068856_1007641111 | 3300005614 | Corn Rhizosphere | MRTSSPVPPGQANAASWRRWLVPGIIAAFFVALFALPRGAAAGVPLTYTQF |
| Ga0074064_116607081 | 3300006603 | Soil | MRTSQPGPPGQATPAPWRRWLLPLGGAAGILALLSLTRGGP |
| Ga0079221_112655502 | 3300006804 | Agricultural Soil | MRASSPGPPGRAGAAPWRRWVFPAAIAAGFVTLLVLPRAA |
| Ga0079221_117131841 | 3300006804 | Agricultural Soil | MRTSSPGPPGRADAARWRRWVFPAAIAAGLVTLLALPRGAAPGTL |
| Ga0073928_109196052 | 3300006893 | Iron-Sulfur Acid Spring | MRTSQPGPPGQATAQWRRWLLPAALAAGFLALATLPRGAALGTAL |
| Ga0114129_106248242 | 3300009147 | Populus Rhizosphere | MRMSQPGPGGQANVAPWRRWLLPAAVTAGLVALLALPRGAAPGMALSY |
| Ga0116106_11858341 | 3300009645 | Peatland | MRMSQPGPPGQANAAPWRWLLPGVIAAFFVTLLVLPRRAAP |
| Ga0116216_102336853 | 3300009698 | Peatlands Soil | MRMSQPGPPGQANAAPWQRWLLPGVIAVFFVTLLVLPRGAAPGTPLTYT |
| Ga0116130_12131881 | 3300009762 | Peatland | MRTSQPGPPGQATAPWRRWLLPAAFAAGLLTLLTLPRGAAPGTAL |
| Ga0134082_102640932 | 3300010303 | Grasslands Soil | MRMSPPGPPGRANVAPWRRWLLPGIIVAFFVALFALPRGAAQ |
| Ga0134125_105417051 | 3300010371 | Terrestrial Soil | MRMSQHGPRGQANVAPWRRWLLPASVTAGLVALLALPRSAAPGMAL |
| Ga0136449_1020952902 | 3300010379 | Peatlands Soil | MRMSQPGPPGQANAAPWQRWLLPGVIAVFFVTLLVLPRGA |
| Ga0134126_105406881 | 3300010396 | Terrestrial Soil | MRMSQPGPPSQANAAPWRRWLLPAAIAAGFVTLLALPRGA |
| Ga0134127_116644731 | 3300010399 | Terrestrial Soil | MRASSPGPPGRAGAAPWRRWVFPAAIAAGFVTLLVLPRAAAPSMALS |
| Ga0134122_103264901 | 3300010400 | Terrestrial Soil | MGMSQPGPGGQANTAPWRRWLLPVAVAAGFVALLAVPRGSPGMPL |
| Ga0134121_131089962 | 3300010401 | Terrestrial Soil | MRASSPGPPGRAGAAPWRRWVFPAAIAAGFVTLLVLPRAAAPG |
| Ga0137391_102569273 | 3300011270 | Vadose Zone Soil | MRMSSPGPPGQANVAPWRRWLLPGIIVAFFVTLFALPRGAAAGMPLT |
| Ga0137393_111942741 | 3300011271 | Vadose Zone Soil | MRTSQPGPPGHANAALWRRWLFPAAISVGFVTLLALPRGAAPAMGLSYTRF |
| Ga0137393_113774992 | 3300011271 | Vadose Zone Soil | MRMSHPGPDGQANAAPWRRWLFPAAAMASLVTLLALSG |
| Ga0137389_113467611 | 3300012096 | Vadose Zone Soil | MRMSSPGPPGRANAASWRRWLFPAPIAAGFVILLTLP |
| Ga0137383_100369347 | 3300012199 | Vadose Zone Soil | MRMSSPGPPGQANVARWLLPGIIVAFFVALFALPRG |
| Ga0137376_108359982 | 3300012208 | Vadose Zone Soil | MRMSQPGPGGQANVAPWRRWLLPAAFSAGLVALLALPRGAAL |
| Ga0137376_116489521 | 3300012208 | Vadose Zone Soil | MRMSQPGPPGHAHPAPWRRWLLPAAVTAGLVALLALPRGAAPGMALSY |
| Ga0137372_103710162 | 3300012350 | Vadose Zone Soil | VRMFQPGPTGHAHPAPWRRWLLPAAAMASFVTLLILP |
| Ga0137385_112790311 | 3300012359 | Vadose Zone Soil | MRTSSPGPPGRADAAQWRRWVFPAAIGAGLVTLLALPRGAA |
| Ga0157350_10573981 | 3300012499 | Unplanted Soil | MRTSSPGPPGRADAAQWRRWVFPAAIAAGLVTLLVLPRGAARGMTLS |
| Ga0164300_104946772 | 3300012951 | Soil | MRASSPGPPGQANAASWRRWLIPGIIVAFFVALFALPRGSAPGPALS |
| Ga0164298_116642862 | 3300012955 | Soil | MRTSSPGPPGRADAAHWRRWVFPAAIAAGFVTLLVLPRA |
| Ga0164301_100659234 | 3300012960 | Soil | MRTSSPGPSGRADAAQWRRWMFPAAIAAGLVTLLVLPRAAAP |
| Ga0164302_106046232 | 3300012961 | Soil | MRASSPGPPGQANAASWRRWLIPGIIVAFFVALFALPRGSAPGPAL |
| Ga0164307_109494622 | 3300012987 | Soil | MRTSSPGPPGRADAAPWRRWVFPAAIAAGFVTLLVLPRAAAPSMALSYT |
| Ga0157378_108454711 | 3300013297 | Miscanthus Rhizosphere | MRMSQPGPGGQANVAPWRRWLLPAAVMAGLVALLALPRGAAPDMALS |
| Ga0157376_117920721 | 3300014969 | Miscanthus Rhizosphere | MRMSQPGPGGQANVAPWRRWLLPAAVTAGLVALLALPRG |
| Ga0187820_10026321 | 3300017924 | Freshwater Sediment | MRTSSPVPPGQANAAPWRRWLLPGIVVAFFVALLALPRGTAAGVLLTY |
| Ga0210405_104178171 | 3300021171 | Soil | MRMSEPGPPGQANAAPWRRWLLPGIIAAFFVTLFALPRGAAPGMP |
| Ga0210408_108207862 | 3300021178 | Soil | MRMSQPGPPGQANAAPWRRWLLPAAIAAGFVTELALPRGAA |
| Ga0210388_102136671 | 3300021181 | Soil | MRISQPGPPGQANAAPWRHWLLPAAIGVGFLALLVLPRGAA |
| Ga0210385_107174111 | 3300021402 | Soil | MRISQSGPTGQANTAPWRRWLLPAAIGAVFLALLVLPRGAAPATTL |
| Ga0210397_102504301 | 3300021403 | Soil | MRTSSPGPPGRADAAQWRRWVFPAVIAAGLVTLLVLPRGAARGMT |
| Ga0210397_105266511 | 3300021403 | Soil | MRTSSPGPARRADTTKWRRWVFPAAIAAGLVTLVA |
| Ga0210397_108918342 | 3300021403 | Soil | MRTSSPDPPGRADAAQWRRWVFPAALAAGFVTLLVLPR |
| Ga0210386_107858101 | 3300021406 | Soil | MRISQPGPPGQANAAPWRHWLLPAAIGVGFLALLVLPRGAAPAMT |
| Ga0210386_112048461 | 3300021406 | Soil | MRISQSGPTGQANTAPWRRWLLPAAIGAGFLALLVLPR |
| Ga0210383_105944693 | 3300021407 | Soil | MRTSSPGPPGRADAAQWRRWVFPAAIAAGLVTLLALPRGAAPGTALSY |
| Ga0210383_107552191 | 3300021407 | Soil | MRISQSGPTGQANTAPWRRWLLPAAIGAGFLALLVLPRGAAPAMTLSYT |
| Ga0210394_118455351 | 3300021420 | Soil | VRMSHPGPSGHAPAAPWRRWLLPAAVTASFVTLLVLPRGAAPGTALS |
| Ga0210384_101896871 | 3300021432 | Soil | MRTSSPGPPGRADAAQWRRWVFPAAIAAGLVTLLVLPR |
| Ga0210384_107490512 | 3300021432 | Soil | MRASSPGPPGHANAVSWRRWLFPAAIAAGLVTLLAWPRGA |
| Ga0210391_111085061 | 3300021433 | Soil | MRTSTPGPPGRADAASWRRWLFPAALAAGLVTLLA |
| Ga0210409_108098032 | 3300021559 | Soil | MRTSSPGPPGRADAAQWRRWVFPAAIAAGLVTLLVLPRGTAPGIAL |
| Ga0210409_108126492 | 3300021559 | Soil | MRTSSPGPPGRADAAQWRRWVFPAAIAAGLVTLLALPRGAAPGM |
| Ga0179589_102876801 | 3300024288 | Vadose Zone Soil | MRMSQPGPPGQANAAPWQRWLLPAAMVGFLVLLTLPRGAAPARC |
| Ga0247668_10110764 | 3300024331 | Soil | MRTSSPGPPGRAGAAPWRRWVFPAAIAAGFVTLLVLPRAAAPGT |
| Ga0179591_10198782 | 3300024347 | Vadose Zone Soil | MRTSLNPSPPGRANAAPWRRWLVPGGLSQRFFVALLALPRGGG |
| Ga0209171_105026911 | 3300025320 | Iron-Sulfur Acid Spring | MRTSQPGPPGQATAQWRRWLLPAALAAGFLALATLPRGAALGTALT |
| Ga0207653_100877431 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMSQHGPRGQANVAPWRRWLLPAAVMAGLVALLA |
| Ga0207699_100918381 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTSQPGPPGQAAGQWRRWLLPAAFAASFLTLLSL |
| Ga0207684_111696112 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMSHPGPDGQANAAPWRRWLFPAAAMASLVTLLALSGGPPPTCR |
| Ga0207684_113253662 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTSSPGPPGRADAAQWRRWVFPAAIGAGLVTLLALPRGAAPGMAL |
| Ga0207663_104884021 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTSSPVPPGQANAASWRRWLVPGIIAAFFVALFALPRGA |
| Ga0207663_108984511 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMSQPGPGGQANVAPWRRWLLPASVTAGLVALLR |
| Ga0207663_110226561 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRASSPGPPGQANAASWRRWLIPGIIVAFFVALFALPRAAAP |
| Ga0207646_100555762 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMSHPGPDGQANAAPWRRWLFPAAAMASLVTLLALSGGPPPACR |
| Ga0207646_104584343 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRISQPGQPGQGPAAGWRRWLLPAAGAAGILTLLALPRGAAPG |
| Ga0207659_116090111 | 3300025926 | Miscanthus Rhizosphere | MRASSPGPPGRADAAPWRRWVFPAAIAAGFVTLLVLPRAAAPS |
| Ga0207687_106711242 | 3300025927 | Miscanthus Rhizosphere | MRTSSPVPPGQANAASWRRWLVPGIIAAFFVALFA |
| Ga0207700_109130632 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMSSPGPPGRADAASWRRWVFPAAIGAGLVTLLAL |
| Ga0207664_102264011 | 3300025929 | Agricultural Soil | MRTSSPVPPGQANAASWRRWLVPGIIAAFFVALFALPRGAAA |
| Ga0207706_108466692 | 3300025933 | Corn Rhizosphere | MRMSQPGPGGQANVAPWRRWLLPAAVTAGLVALLALPRGSAPGMALSYTQF |
| Ga0207670_100239186 | 3300025936 | Switchgrass Rhizosphere | MRTSSPGPPGRAGAAPWRRWVFPAAIAAGFVTLLVL |
| Ga0207679_115799302 | 3300025945 | Corn Rhizosphere | MRTSSPGPPGRADAAPWRRWVFPAAIAAGFITLLVLPRAA |
| Ga0207641_112095881 | 3300026088 | Switchgrass Rhizosphere | MRTSSPVPPGQANAASWRRWLVPGIIAAFFVALFALPRGAAAGVPL |
| Ga0257178_10246202 | 3300026446 | Soil | MRTSSPVPPGRANAAPWRRWLVPGIIAAFFVALLALPRGAVAGVPLT |
| Ga0257153_10727812 | 3300026490 | Soil | MRMSHPGPGGQANTAPWRRWVLPAAVGAGFLALLAVPHGAPVMP |
| Ga0257156_11106091 | 3300026498 | Soil | MRMSQPGPGGQANVAPWRRWLLPAAFSAGLVALLALR |
| Ga0208890_10430991 | 3300027523 | Soil | MRTSSPGPPGRADAAQWRRWVFPAAIAAGFVTLLVL |
| Ga0209073_104653031 | 3300027765 | Agricultural Soil | MRMSQPGPPGHAHPAPWRRWLLPVAVMAGLVALLAVP |
| Ga0209488_107457342 | 3300027903 | Vadose Zone Soil | MRMSQPGPPGHANAAAWRRWLFPAAISVGFVTLLALPRGAAPGMALSYTG |
| Ga0268265_113553342 | 3300028380 | Switchgrass Rhizosphere | MRASSPGPPGRAGAAPWRRWVFPAAIAAGFVTLLVLPRAAAPGMALSYT |
| Ga0302151_101748512 | 3300028562 | Bog | MRMSPPGQATAPWRRWLLPAAFAAFFVTLLILPRRAA |
| Ga0302220_101978722 | 3300028742 | Palsa | MRTSKPGPPGQATGPWRRWLLPAAFAAGLLTLLTLP |
| Ga0302224_102836712 | 3300028759 | Palsa | MRTSQPGPPGHANAAQWRRWVFPAAAAAGFVALLALP |
| Ga0302227_104211841 | 3300028795 | Palsa | MRMSQPGPPGQANVAPWRRWVFPAAIAAGFLTLLVL |
| Ga0302146_101839982 | 3300028867 | Bog | MRMSPPGQATAPWRRWLLPAAFAAFFVTLLILPRRA |
| Ga0311338_102108644 | 3300030007 | Palsa | MRMSEPGPPGQANAAPWRRWVFPAAIAASFVALLAL |
| Ga0302176_101235831 | 3300030057 | Palsa | MRMSPPGQATAPWRRWLLPAAFAAFFVTLLVLPRRAAPG |
| Ga0302179_100345674 | 3300030058 | Palsa | MRTSQPGPPGHANAAQWRRWVFPAAAAAGFVALLALPRGAASGP |
| Ga0302179_101501273 | 3300030058 | Palsa | MRMSPPGPGQANVASWRRWLLPAGVAAGFVALLALPRGAAPGPALS |
| Ga0311353_106484501 | 3300030399 | Palsa | MRMSPPGPGQANVASWRRWLLPAGVAAGFVALLALPRGAAP |
| Ga0311370_123345132 | 3300030503 | Palsa | MRTSQPGPPGHANAAPWVRWLLPAAVAAGFVALLALPRGAAPGPALS |
| Ga0302308_101993231 | 3300031027 | Palsa | MRTSKPGPPGQATGPWRRWLLPAAFAAGLLTLLTLPRS |
| Ga0302308_102087543 | 3300031027 | Palsa | MRISQPGPPGQANAAPWRRWVFPAAIAAGFLTLLVLPRGAAPGPPLSYT |
| Ga0302326_101911554 | 3300031525 | Palsa | MRTSQPGPPGHANAAPWVRWLLPAAVAAGFVALLPHGQ |
| Ga0310686_1165959072 | 3300031708 | Soil | MRTSSPGPPGQANVAPWRRWLLPGIIAAFFVTLFALPRGAA |
| Ga0307476_103676221 | 3300031715 | Hardwood Forest Soil | MRTSSPGPPGQANAAPWRSWLLPGVIAAFFVTLLVLPRGAPAGLPLT |
| Ga0307474_103607782 | 3300031718 | Hardwood Forest Soil | MRTSSPGPPGQANVAPWRRWLFPGIIAAFFVTLLALP |
| Ga0307474_103941661 | 3300031718 | Hardwood Forest Soil | MRMSQPGPSGQANAAPWRRWLLPAAIIGFLALLTVPRGAAP |
| Ga0318547_105082002 | 3300031781 | Soil | MRTSSPGPHGQANVAPWRRWLLPGIIVAFFVTLFALPRGAA |
| Ga0318523_101370563 | 3300031798 | Soil | MRTSSPGPHGQANVAPWRRWLLPGIIVAFFVTLFALPRGAAFGMPL |
| Ga0307478_116330162 | 3300031823 | Hardwood Forest Soil | MRISEPGPPGQANAAPWRRWLLPGIIAAFFVTLLALPR |
| Ga0307479_115706322 | 3300031962 | Hardwood Forest Soil | MRTSSPGPPGRADAAQWRRWVFPAAIAAGLVTLLALPR |
| Ga0307470_113703281 | 3300032174 | Hardwood Forest Soil | MRTSSPGPPGRADAAPWRRWVFPAAIAAGFVTLLVLPRAAAPSM |
| Ga0307471_1020563502 | 3300032180 | Hardwood Forest Soil | MRTSSPGPPGRADAARWRRWVFPAAIAAGFVTLLVLPRGAAPST |
| Ga0373959_0156644_451_579 | 3300034820 | Rhizosphere Soil | MRTSSPGPPGRADAAPWRRWVFPAAIAAGFVTLLVLPRAAAPS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |