NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076030

Metagenome / Metatranscriptome Family F076030

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076030
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 155 residues
Representative Sequence MDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKATKS
Number of Associated Samples 98
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 38.14 %
% of genes from short scaffolds (< 2000 bps) 77.12 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.746 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(27.119 % of family members)
Environment Ontology (ENVO) Unclassified
(66.102 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(83.898 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 60.25%    β-sheet: 0.00%    Coil/Unstructured: 39.75%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF05063MT-A70 2.54
PF13481AAA_25 0.85
PF10926DUF2800 0.85
PF11753DUF3310 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG4725N6-adenosine-specific RNA methylase IME4Translation, ribosomal structure and biogenesis [J] 5.08


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.44 %
UnclassifiedrootN/A13.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10067539All Organisms → cellular organisms → Bacteria → Proteobacteria1469Open in IMG/M
3300000947|BBAY92_10000076Not Available20017Open in IMG/M
3300000947|BBAY92_10076804All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium897Open in IMG/M
3300000973|BBAY93_10000166Not Available15559Open in IMG/M
3300005239|Ga0073579_1549075All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium876Open in IMG/M
3300006027|Ga0075462_10104554All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium878Open in IMG/M
3300006637|Ga0075461_10170384All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005660Open in IMG/M
3300006735|Ga0098038_1103280All Organisms → cellular organisms → Bacteria → Proteobacteria981Open in IMG/M
3300006735|Ga0098038_1169067All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium720Open in IMG/M
3300006737|Ga0098037_1004436Not Available5839Open in IMG/M
3300006749|Ga0098042_1066485All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005951Open in IMG/M
3300006789|Ga0098054_1285931All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium591Open in IMG/M
3300006802|Ga0070749_10385535All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005775Open in IMG/M
3300006810|Ga0070754_10024050All Organisms → cellular organisms → Bacteria3499Open in IMG/M
3300006868|Ga0075481_10038045All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1864Open in IMG/M
3300006919|Ga0070746_10287856All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella bronchiseptica758Open in IMG/M
3300006919|Ga0070746_10513407All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella bronchiseptica524Open in IMG/M
3300006921|Ga0098060_1026449All Organisms → cellular organisms → Bacteria → Proteobacteria1782Open in IMG/M
3300006922|Ga0098045_1080055All Organisms → cellular organisms → Bacteria → Proteobacteria781Open in IMG/M
3300006922|Ga0098045_1142730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005554Open in IMG/M
3300006924|Ga0098051_1047156All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1197Open in IMG/M
3300006924|Ga0098051_1101894All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium JCVI-SC AAA005770Open in IMG/M
3300006990|Ga0098046_1052139All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium955Open in IMG/M
3300007234|Ga0075460_10029698All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2122Open in IMG/M
3300007344|Ga0070745_1340444All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium528Open in IMG/M
3300007538|Ga0099851_1235173All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium659Open in IMG/M
3300007539|Ga0099849_1119567All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1037Open in IMG/M
3300007540|Ga0099847_1187768All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium605Open in IMG/M
3300007778|Ga0102954_1082725All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium896Open in IMG/M
3300007778|Ga0102954_1139311All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium692Open in IMG/M
3300009000|Ga0102960_1018515All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.2613Open in IMG/M
3300009001|Ga0102963_1189405All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium822Open in IMG/M
3300009001|Ga0102963_1233708All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium729Open in IMG/M
3300009071|Ga0115566_10576560All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium632Open in IMG/M
3300009434|Ga0115562_1295824All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium555Open in IMG/M
3300009438|Ga0115559_1221748All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium677Open in IMG/M
3300009495|Ga0115571_1026600Not Available2878Open in IMG/M
3300009495|Ga0115571_1044437All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2088Open in IMG/M
3300009497|Ga0115569_10232469All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium836Open in IMG/M
3300009507|Ga0115572_10092998All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1821Open in IMG/M
3300009529|Ga0114919_10332528All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1063Open in IMG/M
3300010150|Ga0098056_1098232All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1000Open in IMG/M
3300010318|Ga0136656_1057409All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1395Open in IMG/M
3300011118|Ga0114922_10967912All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium692Open in IMG/M
3300011252|Ga0151674_1009560All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium609Open in IMG/M
3300011254|Ga0151675_1045791All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium577Open in IMG/M
3300013010|Ga0129327_10017184All Organisms → cellular organisms → Bacteria3856Open in IMG/M
3300016791|Ga0182095_1336354All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium639Open in IMG/M
3300017727|Ga0181401_1092574All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium775Open in IMG/M
3300017730|Ga0181417_1093046All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium729Open in IMG/M
3300017730|Ga0181417_1181910All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium506Open in IMG/M
3300017733|Ga0181426_1133890All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium500Open in IMG/M
3300017739|Ga0181433_1090433All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium748Open in IMG/M
3300017740|Ga0181418_1018600Not Available1825Open in IMG/M
3300017741|Ga0181421_1149148All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium605Open in IMG/M
3300017755|Ga0181411_1087684All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium928Open in IMG/M
3300017757|Ga0181420_1114820All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium822Open in IMG/M
3300017758|Ga0181409_1231726All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium527Open in IMG/M
3300017771|Ga0181425_1056121Not Available1279Open in IMG/M
3300017772|Ga0181430_1168030All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium634Open in IMG/M
3300017781|Ga0181423_1123921All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1004Open in IMG/M
3300018036|Ga0181600_10073143All Organisms → cellular organisms → Bacteria2105Open in IMG/M
3300018041|Ga0181601_10089988All Organisms → cellular organisms → Bacteria2015Open in IMG/M
3300018041|Ga0181601_10141497All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1486Open in IMG/M
3300018410|Ga0181561_10060786Not Available2261Open in IMG/M
3300018417|Ga0181558_10181555All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1221Open in IMG/M
3300019724|Ga0194003_1046717All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium557Open in IMG/M
3300019742|Ga0193965_1025416Not Available1092Open in IMG/M
3300019765|Ga0194024_1041294All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1014Open in IMG/M
3300020439|Ga0211558_10091690All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1489Open in IMG/M
3300020810|Ga0181598_1018683All Organisms → Viruses → Predicted Viral4172Open in IMG/M
3300021371|Ga0213863_10102746All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1365Open in IMG/M
3300021371|Ga0213863_10427925All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium530Open in IMG/M
3300021373|Ga0213865_10014646Not Available4474Open in IMG/M
3300021379|Ga0213864_10460347All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium639Open in IMG/M
3300021425|Ga0213866_10113638Not Available1465Open in IMG/M
3300021957|Ga0222717_10009051All Organisms → cellular organisms → Bacteria7009Open in IMG/M
3300021958|Ga0222718_10029694All Organisms → cellular organisms → Bacteria3671Open in IMG/M
3300021958|Ga0222718_10049138All Organisms → cellular organisms → Bacteria2691Open in IMG/M
3300021959|Ga0222716_10350917All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium873Open in IMG/M
3300021959|Ga0222716_10426828All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium763Open in IMG/M
3300021960|Ga0222715_10540982All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium611Open in IMG/M
3300021964|Ga0222719_10142916All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1696Open in IMG/M
3300022050|Ga0196883_1024094All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium736Open in IMG/M
3300022057|Ga0212025_1021028All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1059Open in IMG/M
3300022057|Ga0212025_1058843All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium664Open in IMG/M
3300022068|Ga0212021_1039354All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium942Open in IMG/M
3300022068|Ga0212021_1103726All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium583Open in IMG/M
3300022069|Ga0212026_1051763All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium619Open in IMG/M
3300022071|Ga0212028_1027114All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1031Open in IMG/M
3300022168|Ga0212027_1018274All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium959Open in IMG/M
3300022909|Ga0255755_1248801All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium647Open in IMG/M
3300022925|Ga0255773_10167805Not Available1035Open in IMG/M
3300024301|Ga0233451_10108207All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1366Open in IMG/M
3300025070|Ga0208667_1005773All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3286Open in IMG/M
3300025070|Ga0208667_1034600All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium883Open in IMG/M
3300025083|Ga0208791_1045531All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium779Open in IMG/M
3300025083|Ga0208791_1059197All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium652Open in IMG/M
3300025086|Ga0208157_1042052Not Available1265Open in IMG/M
3300025086|Ga0208157_1106597All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium667Open in IMG/M
3300025098|Ga0208434_1012118All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2345Open in IMG/M
3300025101|Ga0208159_1060054All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium761Open in IMG/M
3300025630|Ga0208004_1016516Not Available2362Open in IMG/M
3300025674|Ga0208162_1093846All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium905Open in IMG/M
3300025687|Ga0208019_1032415All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1936Open in IMG/M
3300025704|Ga0209602_1011858Not Available5044Open in IMG/M
3300025759|Ga0208899_1014198All Organisms → cellular organisms → Bacteria4249Open in IMG/M
3300025759|Ga0208899_1109529All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1013Open in IMG/M
3300025769|Ga0208767_1039905All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2303Open in IMG/M
3300025803|Ga0208425_1022528All Organisms → cellular organisms → Bacteria1668Open in IMG/M
3300025849|Ga0209603_1078435Not Available1567Open in IMG/M
3300025853|Ga0208645_1041545All Organisms → cellular organisms → Bacteria2271Open in IMG/M
3300026125|Ga0209962_1049286All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium708Open in IMG/M
3300026183|Ga0209932_1009550Not Available2665Open in IMG/M
3300034374|Ga0348335_061179All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1378Open in IMG/M
3300034375|Ga0348336_029774All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2596Open in IMG/M
3300034418|Ga0348337_031304All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2441Open in IMG/M
3300034418|Ga0348337_069552All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1287Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous27.12%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine16.95%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater11.02%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh8.47%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.63%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water5.93%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.24%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water3.39%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water2.54%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface2.54%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.69%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.69%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.69%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.85%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat0.85%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.85%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.85%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300011254Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016791Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019724Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_9-10_MGEnvironmentalOpen in IMG/M
3300019742Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_8_MGEnvironmentalOpen in IMG/M
3300019765Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MGEnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020810Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022909Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaGEnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300024301Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026125Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026183Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1006753913300000116MarineTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDXXSXANAXIIDHKPDALAHDAPALDIKQXNKAKNS*
BBAY92_10000076373300000947Macroalgal SurfaceMEKGKRGRKRIKFTDEQVQEACRLAGLGFSEEAICKTVLGCSVSTLQRYKKKNENFEQYIRDAKIKSIATVSSALFDSATGRNGKEPSVSAQIFFLKNKGKQAGNPFSDVQQVEHNLDLKSILTNAKDRLIIDAQATETNERERITNIKQIATDTNE*
BBAY92_1007680413300000947Macroalgal SurfaceMDKKLPKKSNRGRKKILFTDEQLLEARRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIITSANARIIEAPKEALAHAPDAPALDIKQINKAKNS*
BBAY93_10000166283300000973Macroalgal SurfaceLTDEQVQEACRLAGLGFSEEAICKTVLGCSVSTLQRYKKKNENFEQYIRDAKIKSIATVSSALFDSATGRNGKEPSVSAQIFFLKNKGKQAGNPFSDVQQVEHNLDLKSILTNAKDRLIIDAQATETNERERITNIKQIATDTNE*
Ga0073579_154907523300005239MarineMDKKLPKKGTPGRKKILFTDEQLIEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEQVSAALFDSATGNNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIITSANARIIEHKAPAPSPALDIKKLNKATKS*
Ga0075462_1010455423300006027AqueousMEKGKRGRKRIKFTDEQVQEACRLAGLGFSEEAICKTVLGCSVSTLQRYKKKNENFEQYIRDAKIKSIATVSSALFDSATGRNGKEPSVSAQIFFLKNKGKQAGNPFSDVQQVEHNLDLKSILTNAKDRLIIDAQATPTNEQEFKQIATDTNE*
Ga0075461_1017038413300006637AqueousDKKLPKKGTPGRKKIHFSESQLLEAERLSGLGFSEESLCKAVFGCSVSTLQRRKKEFANIEQYIRRGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIITSANSRIIDHKPDALAHDAPALDIKQLNKASKS*
Ga0098038_110328013300006735MarineMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIEHQPDALPTSAREEIDIKQINKATKS*
Ga0098038_116906723300006735MarineGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIEHQPDALPTSAREEIDIKQLNKATKS*
Ga0098037_100443613300006737MarineQKNSNMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQPDALPTSAREEIDIKQLNKATKS*
Ga0098042_106648513300006749MarineMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQPDALPTSAREEIDIKQLNKATKS*
Ga0098054_128593113300006789MarineEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQPDALPTSAREEIDIKQINKATKS*
Ga0070749_1038553513300006802AqueousLPKKGTPGRKKILFTDEQLIEAKRLAGLGFSEESLCKAVYGCSVTTLQRRKKEFANIEQYIRQGKMKSIEQVSAALFDSATGNNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIISSANSRIIEHKAPAPAPALDIKQLNKSKNS*
Ga0070754_1002405033300006810AqueousMDKKLPKKGTPGRKKILFTDEQLIEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEQVSAALFDSATGNNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIISSANSRIIEHKAPAPAPALDIKQLNKSKNS*
Ga0075481_1003804513300006868AqueousMSEKLPKKGTPGRKKIHFSESQLLEAERLSGLGFSEESLCKAVFGCSVSTLQRRKKEFANIEQYIRRGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDAIAHDAPALDIKQLNKASKS*
Ga0070746_1028785613300006919AqueousMEKGKRGRKRIKFTDEQVQEACRLAGLGFSEEAICKTVLGCSVSTLQRYKKKNENFEQYIRDAKIKSIATVSSALFDSATGRNGKEPSVSAQIFFLKNKGKQAGNPFSDVQQVEHNLDLKSILTNAKDRLIIDAQATPTNERERITNIKQIATDTNE*
Ga0070746_1051340713300006919AqueousMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDI
Ga0098060_102644913300006921MarineMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIEHQPDALPTSAREEIDIKQLNKATKS*
Ga0098045_108005523300006922MarineLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHKGEALPSAPKEIDIKQLNKAKNS*
Ga0098045_114273013300006922MarineMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIE
Ga0098051_104715623300006924MarineMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIEHKGEALPSAPKEIDIKQLNKATKS*
Ga0098051_110189413300006924MarineMDKKLPKKGTAGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEAPKDALAHAPKEIDIKQLNKATKS*
Ga0098046_105213923300006990MarineMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHKGEALPSAPKEIDIKQLNKAKNS*
Ga0075460_1002969853300007234AqueousMEKGKRGRKRIKFTDEQVQEACRLAGLGFSEEAICKTVLGCSVSTLQRYKKKNENFEQYIRDAKIKSIATVSSALFDSATGRNGKEPSVSAQIFFLKNKGKQAGNPFSDVQQVEHNLDLKSILTNAKDRLIIDGQATPTNEQEFKQIATDTNE*
Ga0070745_134044413300007344AqueousMDKKLPKKGTPGRKKILFTDEQLIEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEQVSAALFDSATGNNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIISSANSRIIEHKAPAP
Ga0099851_123517313300007538AqueousMDKKLPKKSNRGRKKILFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIITSANSRIIEHQAEALPSAREDIDIKQLNKASKS*
Ga0099849_111956713300007539AqueousMDKKLPKKSNRGRKKILFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIITSANSRIIEHQADALPSAREDIDIKQLNKASKS*
Ga0099847_118776813300007540AqueousMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQI
Ga0102954_108272513300007778WaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKAKNS*
Ga0102954_113931113300007778WaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQINKATKS*
Ga0102960_101851513300009000Pond WaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQADTLPASAPKEIDIKQLNKATKS*
Ga0102963_118940523300009001Pond WaterMDKKLPKKSNRGRKKILFTDEQLLEARRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKAKNS*
Ga0102963_123370813300009001Pond WaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIITSANARIIEHQAEALPTSAREEIDIKQLNKAKNS*
Ga0115566_1057656013300009071Pelagic MarineLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKASKS*
Ga0115562_129582413300009434Pelagic MarineMDKKIPKKSNRGRKKIHFSESQLLEAERLSGLGFSEESLCKAVFGCSVSTLQRRKKEFANIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDA
Ga0115559_122174813300009438Pelagic MarineERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKAKNS*
Ga0115571_102660093300009495Pelagic MarineMDKKLPKKSNRGRKKIHFSESQLLEAERLSGLGFSEESLCKAVFGCSVSTLQRRKKEFANIEQYIRRGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDTLAHDAPALDIKQINKAKNS*
Ga0115571_104443763300009495Pelagic MarineMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIITSANA
Ga0115569_1023246913300009497Pelagic MarineMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKATKS*
Ga0115572_1009299813300009507Pelagic MarineMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQ
Ga0114919_1033252813300009529Deep SubsurfaceGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQADALPTSAREDIDIKQLNKATKS*
Ga0098056_109823223300010150MarineMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIEHKGEALPSAREEIDIKQINKAKNS*
Ga0136656_105740943300010318Freshwater To Marine Saline GradientMDKKLPKKSNRGRKKILFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIITSANSRIIEHQA
Ga0114922_1096791213300011118Deep SubsurfaceMDKKLPKKGTPGRKKILFTDEQLIEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEQVSAALFDSATGNNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIITSANARIIEHKAPAPSPALDIKQI
Ga0151674_100956013300011252MarineMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHKGEALPSAREEIDIKQLNKAKNS*
Ga0151675_104579113300011254MarineMDKKLPKKGTPGRKKIHFTEEQLLEAERFAGFGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHKGEA
Ga0129327_10017184143300013010Freshwater To Marine Saline GradientMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQINKATKS*
Ga0182095_133635413300016791Salt MarshQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQADALPSAREDIDIKQINKATKS
Ga0181401_109257413300017727SeawaterNSNMSEKLPKKSNRGRKKILFTDEQLLEARRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHKGDALPSAREEIDIKQLNKATKS
Ga0181417_109304613300017730SeawaterLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHKGEALPTSAPEEIDIKQLNKAKNS
Ga0181417_118191013300017730SeawaterMDKKLLKKGTAGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARII
Ga0181426_113389013300017733SeawaterELEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHKGEALAHDAREEIDIKQLNKATKS
Ga0181433_109043313300017739SeawaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHKGEALPTSAPEEIDIKQLNKAKNS
Ga0181418_101860013300017740SeawaterMSEKLPKKSNRGRKKILFTDEQLLEARRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQPDALPSSAREEIDIKQLNKATKS
Ga0181421_114914813300017741SeawaterTAGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPEDIDIKQLNKATKS
Ga0181411_108768413300017755SeawaterMSEKLPKKSNRGRKKILFTDEQLLEARRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHKGDALPSAPKEIDIKQLNKATKS
Ga0181420_111482013300017757SeawaterMDKKLLKKGTAGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPEDIDIKQLNKATKS
Ga0181409_123172613300017758SeawaterTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIEHKGDALPSAPEEIDIKQLNKASKS
Ga0181425_105612123300017771SeawaterMDKKLLKKGTAGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPEDIDIKQLNKATKS
Ga0181430_116803013300017772SeawaterMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIEHKGEALAHDAREEIDIKQLNK
Ga0181423_112392123300017781SeawaterMSEKLPKKSNRGRKKILFTDEQLLEARRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEAPKDALAHAPKEIDIKQLNKAKNS
Ga0181600_1007314323300018036Salt MarshMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKASKS
Ga0181601_1008998843300018041Salt MarshMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQADALPSAREDIDIKQINKATKS
Ga0181601_1014149713300018041Salt MarshMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIEHQADALPSAREDIDIKQLNKATKS
Ga0181561_1006078623300018410Salt MarshMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKATKS
Ga0181558_1018155533300018417Salt MarshMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDAL
Ga0194003_104671713300019724SedimentMEKGKRGRKRIKFTDEQVQEACRLAGLGFSEEVICKTVLGCSVSTLQRYKKKNENFEQYIRDAKIKSIATVSSALFDSATGRNGKEPSVSAQIFFLKNKGKQAGNPFSDVQQVEHNLDLKSILTNAKDRLIIDAQATPTNEQEFKQIATDTNE
Ga0193965_102541613300019742Freshwater Microbial MatHKGTQKNSNMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQINKAKNS
Ga0194024_104129433300019765FreshwaterMEKGKRGRKRIKFTDEQVQEACRLAGLGFSEEAICKTVLGCSVSTLQRYKKKNENFEQYIRDAKIKSIATVSSALFDSATGRNGKEPSVSAQIFFLKNKGKQAGNPFSDVQQVEHNLDLKSILTNAKDRLIIDAQATPTNEQEFKQIATDTNE
Ga0211558_1009169043300020439MarineMEKGKRGRKRIKFTDEQIQEACRLAGLGFSEEAICKTVLGCSVSTLQRYKKKNENFEQYIRDAKIKSIATVSSALFDSATGRNGKEPSVSAQIFFLKNKGKQAGNPFSDVQQVEHNLDLKSILTNAKDRLIIDAQATPTNEQEFKQIATDTNE
Ga0181598_1018683163300020810Salt MarshMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQADALPSAREDIDIKQINKATK
Ga0213863_1010274613300021371SeawaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIEHQADALPTSAREDIDIKQLNKAKNS
Ga0213863_1042792513300021371SeawaterLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIITSANSRIIEHQADALPTSAREDIDIRHIKKAKNS
Ga0213865_1001464623300021373SeawaterMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQADALPTSAREEIDIKQINKAKNS
Ga0213864_1046034713300021379SeawaterMEKGKRGRKRIKFTDEQVQEACRLAGLGFSEEAICKTVLGCSVSTLQRYKKKNENFEQYIRDAKIKSIATVSSALFDSATGRNGKEPSVSAQIFFLKNKGKQAGNPFSDVQQVEHNLDLKSILTNAKDRLIIDAQATPTNERERIPGIKTIGAPNEE
Ga0213866_1011363823300021425SeawaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHKGEALPSAREEIDIKQINKAKNS
Ga0222717_1000905123300021957Estuarine WaterMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIEHKGEALAHDAREEIDIKQLNKAKNS
Ga0222718_10029694123300021958Estuarine WaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPSLDIKQINKATKS
Ga0222718_1004913823300021958Estuarine WaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIITSANARIIEAPKEALAHAPDAPALDIKQINKAKN
Ga0222716_1035091713300021959Estuarine WaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQINKAKNS
Ga0222716_1042682813300021959Estuarine WaterMDKKLPKKSNRGRKKILFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQADALPSAREDIDIKQINKAKNS
Ga0222715_1054098213300021960Estuarine WaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKAKNS
Ga0222719_1014291613300021964Estuarine WaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIITSANARIIEHQAEALPTSAREEIDIKQLNKAKNS
Ga0196883_102409413300022050AqueousMSEKLPKKGTPGRKKIHFSESQLLEAERLSGLGFSEESLCKAVFGCSVSTLQRRKKEFANIEQYIRRGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDAIAHDAPALDIKQLNKASKS
Ga0212025_102102813300022057AqueousMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQINKATKS
Ga0212025_105884313300022057AqueousHFSESQLLEAERLSGLGFSEESLCKAVFGCSVSTLQRRKKEFANIEQYIRRGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDAIAHDAPALDIKQLNKASKS
Ga0212021_103935413300022068AqueousMEKGKRGRKRIKFTDEQVQEACRLAGLGFSEEAICKTVLGCSVSTLQRYKKKNENFEQYIRDAKIKSIATVSSALFDSATGRNGKEPSVSAQIFFLKNKGKQAGNPFSDVQQVEHNLDLKSILTNAKDRLIIDGQATPTNERERIPGIKT
Ga0212021_110372613300022068AqueousEKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIITSANSRIIDHKPDALAHDAPALDIKQLNKASKS
Ga0212026_105176313300022069AqueousHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQINKATKS
Ga0212028_102711413300022071AqueousMDKKLPKKSNRGRKKILFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPD
Ga0212027_101827413300022168AqueousMDKKLPKKSNRGRKKILFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRRGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDAIAHDAPALDIKQLNKASKS
Ga0255755_124880113300022909Salt MarshLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKATKS
Ga0255773_1016780523300022925Salt MarshGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKATKS
Ga0233451_1010820713300024301Salt MarshMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKATKS
Ga0208667_1005773103300025070MarineMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANSRIIEHKGDALPSAPKEIDIKQLNKAKNS
Ga0208667_103460013300025070MarineMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANAR
Ga0208791_104553123300025083MarineMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHKGEALPSAPKEIDIKQLNKAKNS
Ga0208791_105919713300025083MarineMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEAPKDALAHAPKEIDIKQLNKATKS
Ga0208157_104205213300025086MarineNMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQPDALPTSAREEIDIKQLNKATKS
Ga0208157_110659713300025086MarineMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVDNNINLSDIISSANARIIEHQPDALPTSAREEIDIKQINKATKS
Ga0208434_101211853300025098MarineMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEAPKDALAHAPKEIDIKQLNKATKS
Ga0208159_106005413300025101MarineMSEKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQPDALPTSAREEIDIKQLNKATKS
Ga0208004_101651613300025630AqueousKGHKGTQKNSNMDKKLPKKGTPGRKKIHFSESQLLEAERLSGLGFSEESLCKAVFGCSVSTLQRRKKEFANIEQYIRRGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIITSANSRIIDHKPDALAHDAPALDIKQLNKASKS
Ga0208162_109384613300025674AqueousMDKKLPKKSNRGRKKILFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIITSANSRIIEHQADALPSAREDIDIKQLNKASKS
Ga0208019_103241563300025687AqueousMDKKLPKKSNRGRKKILFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIITSANSRIIEHQAEALPSAREDIDIKQLNKASKS
Ga0209602_1011858123300025704Pelagic MarineMDKKLPKKSNRGRKKIHFSESQLLEAERLSGLGFSEESLCKAVFGCSVSTLQRRKKEFANIEQYIRRGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDTLAHDAPALDIKQINKAKNS
Ga0208899_101419823300025759AqueousMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIITSANSRIIDHKPDALAHDAPALDIKQLNKASKS
Ga0208899_110952933300025759AqueousMEKGKRGRKRIKFTDEQVQEACRLAGLGFSEEAICKTVLGCSVSTLQRYKKKNENFEQYIRDAKIKSIATVSSALFDSATGRNGKEPSVSAQIFFLKNKGKQAGNPFSDVQQVEHNLDLKSILTNAKDRLII
Ga0208767_103990563300025769AqueousMDKKLPKKGTPGRKKIHFSESQLLEAERLSGLGFSEESLCKAVFGCSVSTLQRRKKEFANIEQYIRRGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIEHQAEALPSAREDIDIKQLNKATKS
Ga0208425_102252813300025803AqueousMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSIEAVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARII
Ga0209603_107843513300025849Pelagic MarineMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIEQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQLNKATKS
Ga0208645_104154533300025853AqueousMDKKLPKKGTPGRKKILFTDEQLIEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEQVSAALFDSATGNNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIISSANSRIIEHKAPAPAPALDIKQLNKSKNS
Ga0209962_104928613300026125WaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQINKATKS
Ga0209932_100955033300026183Pond WaterMDKKLPKKGTPGRKKIHFTEEQLLEAERLAGLGFSEESLCKAVFGCSVSTLQRRKKEFNNIDQYIRRGKIKSITEVSSALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDATALDIKQLNKATKS
Ga0348335_061179_687_11723300034374AqueousMDKKLPKKSNRGRKKILFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDAHAPEAPALDIKQLNKATKS
Ga0348336_029774_1874_23593300034375AqueousMDKKLPKKSNRGRKKILFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQINKATKS
Ga0348337_031304_228_7103300034418AqueousMDKKLPKKSNRGRKKILFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEEVSAALFDSATGRNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENNINLSDIISSANARIIDHKPDALAHDAPALDIKQINKAKN
Ga0348337_069552_1_4263300034418AqueousFTDEQLLEAKRLAGLGFSEESLCKAVFGCSVTTLQRRKKEFANIEQYIRQGKMKSIEQVSAALFDSATGNNGRDPSVSAQIFFLKNKGKEAGNPWADVQQVENSINLSDIISSANSRIIEHKAPAPAPALDIKQLNKSKNS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.