| Basic Information | |
|---|---|
| Family ID | F076021 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 37 residues |
| Representative Sequence | VMQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 93.22 % |
| % of genes near scaffold ends (potentially truncated) | 5.93 % |
| % of genes from short scaffolds (< 2000 bps) | 76.27 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.085 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (16.102 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.542 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (61.017 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF14117 | DUF4287 | 45.76 |
| PF00173 | Cyt-b5 | 11.02 |
| PF00578 | AhpC-TSA | 8.47 |
| PF00106 | adh_short | 4.24 |
| PF11253 | DUF3052 | 4.24 |
| PF13527 | Acetyltransf_9 | 2.54 |
| PF10996 | Beta-Casp | 1.69 |
| PF04229 | GrpB | 1.69 |
| PF01523 | PmbA_TldD | 1.69 |
| PF00005 | ABC_tran | 1.69 |
| PF01061 | ABC2_membrane | 0.85 |
| PF01557 | FAA_hydrolase | 0.85 |
| PF02591 | zf-RING_7 | 0.85 |
| PF00528 | BPD_transp_1 | 0.85 |
| PF13456 | RVT_3 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 1.69 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 1.69 |
| COG1579 | Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domain | General function prediction only [R] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.08 % |
| All Organisms | root | All Organisms | 44.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876005|none_p091601 | Not Available | 502 | Open in IMG/M |
| 3300001282|B570J14230_10129923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 733 | Open in IMG/M |
| 3300001282|B570J14230_10222701 | Not Available | 514 | Open in IMG/M |
| 3300001948|GOS2228_1040726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4765 | Open in IMG/M |
| 3300002161|JGI24766J26685_10007656 | All Organisms → cellular organisms → Bacteria | 2976 | Open in IMG/M |
| 3300005517|Ga0070374_10558445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300005517|Ga0070374_10688244 | Not Available | 505 | Open in IMG/M |
| 3300005525|Ga0068877_10315276 | Not Available | 901 | Open in IMG/M |
| 3300005525|Ga0068877_10335575 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005525|Ga0068877_10483985 | Not Available | 686 | Open in IMG/M |
| 3300005525|Ga0068877_10485130 | Not Available | 685 | Open in IMG/M |
| 3300005525|Ga0068877_10566855 | Not Available | 620 | Open in IMG/M |
| 3300005527|Ga0068876_10789024 | Not Available | 502 | Open in IMG/M |
| 3300005583|Ga0049085_10300871 | Not Available | 521 | Open in IMG/M |
| 3300005585|Ga0049084_10078983 | Not Available | 1202 | Open in IMG/M |
| 3300005585|Ga0049084_10149981 | Not Available | 814 | Open in IMG/M |
| 3300005805|Ga0079957_1042388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2871 | Open in IMG/M |
| 3300005805|Ga0079957_1048301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2628 | Open in IMG/M |
| 3300006639|Ga0079301_1012761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3082 | Open in IMG/M |
| 3300006639|Ga0079301_1172192 | Not Available | 631 | Open in IMG/M |
| 3300007547|Ga0102875_1144825 | Not Available | 748 | Open in IMG/M |
| 3300007585|Ga0102916_1227305 | Not Available | 509 | Open in IMG/M |
| 3300007622|Ga0102863_1057550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-5 | 1136 | Open in IMG/M |
| 3300007630|Ga0102903_1061974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans | 1043 | Open in IMG/M |
| 3300007639|Ga0102865_1020607 | All Organisms → cellular organisms → Bacteria | 1884 | Open in IMG/M |
| 3300007644|Ga0102902_1148228 | Not Available | 697 | Open in IMG/M |
| 3300008107|Ga0114340_1212405 | Not Available | 634 | Open in IMG/M |
| 3300008108|Ga0114341_10076689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3420 | Open in IMG/M |
| 3300008108|Ga0114341_10186147 | Not Available | 1173 | Open in IMG/M |
| 3300008108|Ga0114341_10354879 | Not Available | 734 | Open in IMG/M |
| 3300008111|Ga0114344_1053863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans | 2445 | Open in IMG/M |
| 3300008114|Ga0114347_1115795 | Not Available | 1011 | Open in IMG/M |
| 3300008117|Ga0114351_1098782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1706 | Open in IMG/M |
| 3300008117|Ga0114351_1225976 | Not Available | 952 | Open in IMG/M |
| 3300008117|Ga0114351_1377243 | Not Available | 619 | Open in IMG/M |
| 3300008262|Ga0114337_1301039 | Not Available | 574 | Open in IMG/M |
| 3300008950|Ga0102891_1024025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans | 1935 | Open in IMG/M |
| 3300009050|Ga0102909_1113233 | Not Available | 656 | Open in IMG/M |
| 3300010156|Ga0068873_1008664 | Not Available | 1016 | Open in IMG/M |
| 3300010293|Ga0116204_1186231 | Not Available | 678 | Open in IMG/M |
| 3300010368|Ga0129324_10032482 | Not Available | 2484 | Open in IMG/M |
| 3300011268|Ga0151620_1000094 | All Organisms → cellular organisms → Bacteria | 30393 | Open in IMG/M |
| 3300012970|Ga0129338_1076985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
| 3300013004|Ga0164293_10160978 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10117799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1504 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10228456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1147 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10188333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1305 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10092883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2652 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10611963 | Not Available | 596 | Open in IMG/M |
| 3300014801|Ga0119946_1005350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1459 | Open in IMG/M |
| 3300019122|Ga0188839_1001155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4742 | Open in IMG/M |
| 3300020074|Ga0194113_10007714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13348 | Open in IMG/M |
| 3300020084|Ga0194110_10669275 | Not Available | 647 | Open in IMG/M |
| 3300020159|Ga0211734_10154610 | Not Available | 602 | Open in IMG/M |
| 3300020160|Ga0211733_10374604 | Not Available | 1251 | Open in IMG/M |
| 3300020190|Ga0194118_10504892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 579 | Open in IMG/M |
| 3300020193|Ga0194131_10012852 | All Organisms → cellular organisms → Bacteria | 9668 | Open in IMG/M |
| 3300020200|Ga0194121_10358423 | Not Available | 729 | Open in IMG/M |
| 3300020494|Ga0208326_103399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1475 | Open in IMG/M |
| 3300020499|Ga0208084_1002112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3411 | Open in IMG/M |
| 3300020514|Ga0208202_1011692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1120 | Open in IMG/M |
| 3300020543|Ga0208089_1019321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 997 | Open in IMG/M |
| 3300020570|Ga0208465_1000264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15981 | Open in IMG/M |
| 3300021091|Ga0194133_10254292 | Not Available | 1108 | Open in IMG/M |
| 3300021959|Ga0222716_10218330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1196 | Open in IMG/M |
| 3300021961|Ga0222714_10002765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 18319 | Open in IMG/M |
| 3300021961|Ga0222714_10092552 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300021961|Ga0222714_10127875 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300021962|Ga0222713_10061111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2829 | Open in IMG/M |
| 3300021962|Ga0222713_10090290 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
| 3300021962|Ga0222713_10713100 | Not Available | 570 | Open in IMG/M |
| 3300022556|Ga0212121_10074251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2682 | Open in IMG/M |
| 3300024239|Ga0247724_1001330 | Not Available | 4841 | Open in IMG/M |
| 3300024276|Ga0255205_1046400 | Not Available | 650 | Open in IMG/M |
| 3300024277|Ga0255207_1004929 | Not Available | 2540 | Open in IMG/M |
| 3300024312|Ga0255219_1013331 | Not Available | 1582 | Open in IMG/M |
| 3300024312|Ga0255219_1035323 | Not Available | 842 | Open in IMG/M |
| 3300024346|Ga0244775_10048353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3713 | Open in IMG/M |
| 3300024348|Ga0244776_10485331 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300024492|Ga0255189_1048999 | Not Available | 555 | Open in IMG/M |
| 3300024512|Ga0255186_1028712 | Not Available | 749 | Open in IMG/M |
| 3300024863|Ga0255246_1022647 | Not Available | 1411 | Open in IMG/M |
| 3300025115|Ga0209835_1018673 | Not Available | 2239 | Open in IMG/M |
| 3300026563|Ga0256355_1104483 | Not Available | 502 | Open in IMG/M |
| 3300027205|Ga0208926_1017621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1074 | Open in IMG/M |
| 3300027211|Ga0208307_1044547 | Not Available | 679 | Open in IMG/M |
| 3300027244|Ga0208173_1028000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1079 | Open in IMG/M |
| 3300027488|Ga0255084_1009325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans | 2000 | Open in IMG/M |
| 3300027499|Ga0208788_1052204 | Not Available | 1087 | Open in IMG/M |
| 3300027499|Ga0208788_1118402 | Not Available | 610 | Open in IMG/M |
| 3300027518|Ga0208787_1135613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
| 3300027594|Ga0255120_1023691 | Not Available | 1241 | Open in IMG/M |
| 3300027697|Ga0209033_1042391 | Not Available | 1676 | Open in IMG/M |
| 3300027707|Ga0209443_1029400 | Not Available | 2367 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1101584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1272 | Open in IMG/M |
| 3300027793|Ga0209972_10438582 | Not Available | 547 | Open in IMG/M |
| 3300027804|Ga0209358_10045080 | Not Available | 2632 | Open in IMG/M |
| 3300027806|Ga0209985_10484681 | Not Available | 520 | Open in IMG/M |
| (restricted) 3300028044|Ga0247838_1083733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1401 | Open in IMG/M |
| 3300028067|Ga0255192_1027984 | Not Available | 843 | Open in IMG/M |
| 3300028086|Ga0255201_1061539 | Not Available | 570 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1200140 | Not Available | 682 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1077924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1535 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10184943 | Not Available | 1196 | Open in IMG/M |
| 3300031758|Ga0315907_10176962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 1797 | Open in IMG/M |
| 3300031951|Ga0315904_11122070 | Not Available | 611 | Open in IMG/M |
| 3300031951|Ga0315904_11339582 | Not Available | 538 | Open in IMG/M |
| 3300032093|Ga0315902_10807737 | Not Available | 739 | Open in IMG/M |
| 3300032116|Ga0315903_10356578 | Not Available | 1209 | Open in IMG/M |
| 3300033979|Ga0334978_0214111 | Not Available | 941 | Open in IMG/M |
| 3300033996|Ga0334979_0003052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12035 | Open in IMG/M |
| 3300034064|Ga0335001_0084250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans | 1826 | Open in IMG/M |
| 3300034073|Ga0310130_0053992 | Not Available | 1199 | Open in IMG/M |
| 3300034096|Ga0335025_0087402 | Not Available | 1931 | Open in IMG/M |
| 3300034096|Ga0335025_0138042 | Not Available | 1439 | Open in IMG/M |
| 3300034101|Ga0335027_0174322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1553 | Open in IMG/M |
| 3300034112|Ga0335066_0228879 | Not Available | 1085 | Open in IMG/M |
| 3300034116|Ga0335068_0066663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans | 2072 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.71% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 10.17% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.17% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.47% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.08% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.24% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.24% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.54% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 2.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.69% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.85% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.85% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.85% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.85% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.85% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.85% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.85% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.85% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.85% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876005 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15m | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300001948 | Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012 | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300010156 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014801 | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020499 | Freshwater microbial communities from Lake Mendota, WI - 14SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020514 | Freshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022556 | Kivu_combined assembly | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024276 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300024277 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300024312 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024492 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300024512 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025115 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026563 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027211 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027244 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027488 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027594 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
| 3300028067 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300028086 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_0916012 | 2236876005 | Marine Estuarine | MQAKISNVLVAAQKVIAPAAVVNLKAAVIELQGPAKK |
| B570J14230_101299232 | 3300001282 | Freshwater | VIQAKSLNALVAVQKVIAPAAVVNLKAAVIELQDLAKK* |
| B570J14230_102227012 | 3300001282 | Freshwater | MQAKSLNVLADALKVIAPAAVVNLKAAVIELQDLAKK* |
| GOS2228_10407262 | 3300001948 | Marine | MQAKISNALVAAQKVIAPAAVVILKAVVIELQGPAKK* |
| JGI24766J26685_100076562 | 3300002161 | Freshwater And Sediment | VIQAKILNALVAARKAIAPAAAVSLKAAVIELQGLAKK* |
| Ga0070374_105584451 | 3300005517 | Freshwater Lake | VIQAKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK* |
| Ga0070374_106882442 | 3300005517 | Freshwater Lake | MQAKISNALVAAQKVIAPAAVVILKAAVIELQDLAKK* |
| Ga0068877_103152761 | 3300005525 | Freshwater Lake | VIQAKILNALVAARKAIAPAAAVSLKAAVIELQDLAKK* |
| Ga0068877_103355752 | 3300005525 | Freshwater Lake | VIQAKISNALVVARKAIAPAAAVSLKAAVIELQGLAKK* |
| Ga0068877_104839851 | 3300005525 | Freshwater Lake | VIQAKILNALVVARKAIAPAAAVILKAAVIELQGLAKK* |
| Ga0068877_104851302 | 3300005525 | Freshwater Lake | VIQAKILNALVVARKAIAPAAAVTLKVVVIELQDPAKK* |
| Ga0068877_105668551 | 3300005525 | Freshwater Lake | VIQAKILNALVVARKAIAPAAVVILKAAVIELQGLAKK* |
| Ga0068876_107890242 | 3300005527 | Freshwater Lake | VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQDPAKK* |
| Ga0049085_103008712 | 3300005583 | Freshwater Lentic | KISNALVAAQKVIAPAAVVILKAAVIELQDLAKK* |
| Ga0049084_100789832 | 3300005585 | Freshwater Lentic | VVQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK* |
| Ga0049084_101499812 | 3300005585 | Freshwater Lentic | MQAKISNVLVAAQKVIAPAAVVNLKAAVIELQDLAKK* |
| Ga0079957_10423881 | 3300005805 | Lake | MQAKISNAPVAAQKAIALAAVVTRKAAVIELQGLAKK* |
| Ga0079957_10483013 | 3300005805 | Lake | VIQAKILNALVAVQKAIAPAAVVILKAAVIELQGLAKK* |
| Ga0079301_10127612 | 3300006639 | Deep Subsurface | VMQAKISNAPVAAQKVIALAAAVSLKAAVIELQGLAKKLWQ* |
| Ga0079301_11721922 | 3300006639 | Deep Subsurface | MQAKILNAPVAVQKVIAPAAVVMLKAAVIELQGLAKK* |
| Ga0102875_11448252 | 3300007547 | Estuarine | MQAKISNALVAAQKVIAPAAVVNLKAAVIELQDLAKK* |
| Ga0102916_12273052 | 3300007585 | Estuarine | MQAKISNVLVAAQKVIAPAAVVILKAAVIELQDLAKK* |
| Ga0102863_10575503 | 3300007622 | Estuarine | VIQAKISNALVAARKAIAPAAAVILKAAVIELQGLAKK* |
| Ga0102903_10619742 | 3300007630 | Estuarine | VIQAKSLSVLADALKVIAPAAVVILKAAVIELQDLAKK* |
| Ga0102865_10206074 | 3300007639 | Estuarine | VIQAKISNALVAARKAIAPAAAVILKAAVIELQDPAKK* |
| Ga0102902_11482282 | 3300007644 | Estuarine | VIQAKSLNALVAVQKVIAPAAVVILKAAVIELQDLAKK* |
| Ga0114340_12124052 | 3300008107 | Freshwater, Plankton | VIQAKILNALVVARKAIAPAAAVTLTVVVIELQDPAKK* |
| Ga0114341_100766893 | 3300008108 | Freshwater, Plankton | MQAKISNALVAAQKVIAPAAVVNLKAAVIELQGLAKK* |
| Ga0114341_101861472 | 3300008108 | Freshwater, Plankton | VIQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK* |
| Ga0114341_103548792 | 3300008108 | Freshwater, Plankton | VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQGLAKK* |
| Ga0114344_10538632 | 3300008111 | Freshwater, Plankton | MQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK* |
| Ga0114347_11157953 | 3300008114 | Freshwater, Plankton | MQAKISNALVAAQKAIALAAVVILKVVVIELQDPAKK* |
| Ga0114351_10987822 | 3300008117 | Freshwater, Plankton | VIQAKILNALVVARKAIAPAAAVILKAAVIELQDPAKK* |
| Ga0114351_12259763 | 3300008117 | Freshwater, Plankton | MQAKISNALVAAQKVIALAAVVILKAVVIELQGPAKK* |
| Ga0114351_13772431 | 3300008117 | Freshwater, Plankton | VIQAKILNALVAVQKAIAPAAVVILKAAVIELQDLAKK* |
| Ga0114337_13010391 | 3300008262 | Freshwater, Plankton | VIQAKILNALVAVQKVIAPAAVVSLKAAVIELQGLAKK* |
| Ga0102891_10240254 | 3300008950 | Estuarine | MQAKISNALVAAQKVIAPAAAVILKAAVIELQGPAKK* |
| Ga0102909_11132332 | 3300009050 | Estuarine | MQAKISNALVAAQKVIAPAAVVILKVVAIESQDLAKK* |
| Ga0068873_10086643 | 3300010156 | Freshwater Lake | VIQAKILNALVVARKAIAPAAAVSLKAAVIELQDPAKK* |
| Ga0116204_11862311 | 3300010293 | Anoxic Lake Water | MQAKISNAPVAAQKVIALAAVVILKAAVIELQDPAKK* |
| Ga0129324_100324823 | 3300010368 | Freshwater To Marine Saline Gradient | MQAKILNAPVAAQKVIAPAAVVILKAAVIELQGLAKK* |
| Ga0151620_10000943 | 3300011268 | Freshwater | VIQAKISNALVAARKVIAPAAVVSRKAVVIELQGLAKK* |
| Ga0129338_10769851 | 3300012970 | Aqueous | VIQAKILNALVVVRKVIAPAAAVILKAAVIELQGPAKK* |
| Ga0164293_101609785 | 3300013004 | Freshwater | VIQSKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK* |
| (restricted) Ga0172368_101177993 | 3300013123 | Freshwater | MQAKISNAPVAAQKVIAPAAVVILKAAVIELQDPAKK* |
| (restricted) Ga0172367_102284562 | 3300013126 | Freshwater | MQAKISNAPVAAQKVIAPAAVVILKAAVIELQDHAKK* |
| (restricted) Ga0172370_101883332 | 3300013136 | Freshwater | MQAKISNAPVAAQKVIAFAAVVILKAAVIELQDPAKK* |
| (restricted) Ga0172375_100928832 | 3300013137 | Freshwater | MQAKISNAPVAAQKAIAPAAVVILKAVVIELQGPAKK* |
| (restricted) Ga0172376_106119631 | 3300014720 | Freshwater | MQAKISNAPVAAQKVIEPAAVVILKAAVIELQDPAKK* |
| Ga0119946_10053502 | 3300014801 | Aquatic | MQAKISNAPVAAQKAIALAAVVIRKAAVIELQGLAKK* |
| Ga0188839_10011553 | 3300019122 | Freshwater Lake | VMQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK |
| Ga0194113_1000771412 | 3300020074 | Freshwater Lake | MQAKFSNAPVAAQKVIALAAVVILKAAVIELQDPAKK |
| Ga0194110_106692752 | 3300020084 | Freshwater Lake | MQAKICNALVAAQKVIAPAAVVNLKAAVIELQDPAKK |
| Ga0211734_101546102 | 3300020159 | Freshwater | VVQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK |
| Ga0211733_103746042 | 3300020160 | Freshwater | VVQAKISNALVAAQKLIALAAVVTRKVVAIGLQGPARK |
| Ga0194118_105048921 | 3300020190 | Freshwater Lake | MQAKLSNAPVAAQKVIALSAVVILKAAVIELQDPAKK |
| Ga0194131_100128523 | 3300020193 | Freshwater Lake | VMQAKFSNAPVAAQKVIALAAVVILKAAVIELQDPAKK |
| Ga0194121_103584232 | 3300020200 | Freshwater Lake | MQAKFSNAPVAAHKVIALAAVVILKAAVIELQDPAKK |
| Ga0208326_1033992 | 3300020494 | Freshwater | VIQSKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK |
| Ga0208084_10021123 | 3300020499 | Freshwater | VIQSKSLNALVAVQKVIAPAAVVNLKAAVIELQDLAKK |
| Ga0208202_10116923 | 3300020514 | Freshwater | MQAKSLNVLADALKVIAPAAVVNLKAAVIELQDLAKK |
| Ga0208089_10193211 | 3300020543 | Freshwater | MQAKISNALVAAQKVIAPAAVVNLKAAVIELQGPAKK |
| Ga0208465_10002649 | 3300020570 | Freshwater | VIQAKSLNALVAVQKVIAPAAVVNLKAAVIELQDLAKK |
| Ga0194133_102542922 | 3300021091 | Freshwater Lake | MQAKICNALVAAQKVIAPAAVVNLKPAVIELQDPAKK |
| Ga0222716_102183302 | 3300021959 | Estuarine Water | VIQAKSLNALVAVQKVAAPAAVVILKAAVIELQGLAKE |
| Ga0222714_100027656 | 3300021961 | Estuarine Water | VIQAKISNALVAARKVIAPAAVVSRKAVVIELQGLAKK |
| Ga0222714_100925522 | 3300021961 | Estuarine Water | VIQAKISNAPVAARKVIAPAAVVILKAAVIELQGLAKK |
| Ga0222714_101278751 | 3300021961 | Estuarine Water | VIQAKISNALVAARKAIAPAAAVILKAAVIELQGPAKK |
| Ga0222713_100611116 | 3300021962 | Estuarine Water | VIQAKISNALVVARKAFAPAAVVMLKAAVIELQGPAKK |
| Ga0222713_100902902 | 3300021962 | Estuarine Water | VIQAKILNALVVARKAIAPAAAVILKAAVIELQGLAKK |
| Ga0222713_107131001 | 3300021962 | Estuarine Water | MQAKISNAPVAAQKAIALAAVVTRKAAVIELQGLAKK |
| Ga0212121_100742513 | 3300022556 | Anoxic Lake Water | MQAKISNAPVAAQKVIALAAVVILKAAVIELQDPAKK |
| Ga0247724_10013303 | 3300024239 | Deep Subsurface Sediment | MQAKILNAPVAVQKVIAPAAVVMLKAAVIELQGLAKK |
| Ga0255205_10464002 | 3300024276 | Freshwater | MQAKISNAPVAAQKAIALAAVVIRKAAVIELQGLAKK |
| Ga0255207_10049292 | 3300024277 | Freshwater | VIQAKILNALVVARKAIAPAAAVSLKAAVIELQDPAKK |
| Ga0255219_10133312 | 3300024312 | Freshwater | VMQAKISNAPVAAQKAIALAAVVIRKAAVIELQGLAKK |
| Ga0255219_10353232 | 3300024312 | Freshwater | VIQAKILNALVVARKAIAPAAAVSLKAAVIELQGLAKK |
| Ga0244775_100483535 | 3300024346 | Estuarine | VMQAKISNALVAAQKVIAPAAVVNLKAAVIELQDLAKK |
| Ga0244776_104853312 | 3300024348 | Estuarine | MQAKISNALVAAQKVIAPAAVVILKVVAIESQDLAKK |
| Ga0255189_10489992 | 3300024492 | Freshwater | VIQAKISNALVAARKVIAPAAAVSLKAAVIELQDLAKK |
| Ga0255186_10287121 | 3300024512 | Freshwater | VIQAKILNALVVARKAIAPAAVVILKAAVIELQGLAKK |
| Ga0255246_10226474 | 3300024863 | Freshwater | MQAKISNALVAAQKVIAPAAVVNLKAAVIELQDLAKK |
| Ga0209835_10186732 | 3300025115 | Anoxic Lake Water | VMQAKISNAPVAAQKVIALAAVVILKAAVIELQDPAKK |
| Ga0256355_11044832 | 3300026563 | Freshwater | VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQGPAKK |
| Ga0208926_10176213 | 3300027205 | Estuarine | MQAKISNALVAAQKVAAPAAVVILKAAVIELQGLAKK |
| Ga0208307_10445472 | 3300027211 | Estuarine | VIQAKISNALVAARKAIAPAAAVILKAAVIELQGLAKK |
| Ga0208173_10280001 | 3300027244 | Estuarine | AKISNALVAAQKVIAPAAVVILKAAVIELQDLAKK |
| Ga0255084_10093252 | 3300027488 | Freshwater | MQAKISNVLVAAQKVIAPAAVVILKAAVIELQDLAKK |
| Ga0208788_10522043 | 3300027499 | Deep Subsurface | VIQAKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK |
| Ga0208788_11184021 | 3300027499 | Deep Subsurface | MQAKILNAPVAVQKVIALAAAVSLKAAVIELQGLAKK |
| Ga0208787_11356132 | 3300027518 | Deep Subsurface | MQAKISNAPVAAQKVIALAAAVSLKAAVIELQGLAKK |
| Ga0255120_10236914 | 3300027594 | Freshwater | VMQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK |
| Ga0209033_10423913 | 3300027697 | Freshwater Lake | MQAKISNALVAVQKVIAPAAVVNLKAAVIELQDLAKK |
| Ga0209443_10294005 | 3300027707 | Freshwater Lake | VMQAKISNALVAAQKVIAPAAAVILKAAVIELQDLAKK |
| (restricted) Ga0247833_11015842 | 3300027730 | Freshwater | MQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK |
| Ga0209972_104385822 | 3300027793 | Freshwater Lake | VIQAKISNALVVARKAIAPAAAVSLKAAVIELQGLAKK |
| Ga0209358_100450804 | 3300027804 | Freshwater Lake | VMQAKISNALVAVQKVIAPAAVVNLKAAVIELQDLAKK |
| Ga0209985_104846812 | 3300027806 | Freshwater Lake | VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQDPAKK |
| (restricted) Ga0247838_10837333 | 3300028044 | Freshwater | VQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK |
| Ga0255192_10279842 | 3300028067 | Freshwater | VIQAKISNALVVARKAIAPAAAVTLKVVVIELQDPAKK |
| Ga0255201_10615391 | 3300028086 | Freshwater | MQAKISNALVAAQKVIALAAAVSLKAAVIELQGLAKK |
| (restricted) Ga0247835_12001402 | 3300028114 | Freshwater | MQAKISNALVATQKVIAPAAVVILKAAVIELQGLAKK |
| (restricted) Ga0247831_10779242 | 3300028559 | Freshwater | MQAKILNAPVAAQKVIAPAAVVILKAAVIELQGLAKK |
| (restricted) Ga0247840_101849432 | 3300028581 | Freshwater | MQAKISNAPVAAQKVIAPAAVVILKAAVIELQGLAKK |
| Ga0315907_101769622 | 3300031758 | Freshwater | VIQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK |
| Ga0315904_111220702 | 3300031951 | Freshwater | VQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK |
| Ga0315904_113395822 | 3300031951 | Freshwater | VIQAKILNALVAVQKAIAPAAVVILKAAVIELQGLAKK |
| Ga0315902_108077372 | 3300032093 | Freshwater | QAKILNALVAVQKAIAPAAVVILKAAVIELQGLAKK |
| Ga0315903_103565783 | 3300032116 | Freshwater | VVQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK |
| Ga0334978_0214111_784_894 | 3300033979 | Freshwater | MGELSNALVAAQKVIAPAAVVILKAAVIELQDLAKK |
| Ga0334979_0003052_6038_6154 | 3300033996 | Freshwater | MIQSKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK |
| Ga0335001_0084250_1720_1824 | 3300034064 | Freshwater | MQAKISNALVAAQKVIAPAAVVILKAAVIELQGPA |
| Ga0310130_0053992_4_117 | 3300034073 | Fracking Water | MQAKILNAPVAVQKVIAPAAVVILKAAVIELQGLAKK |
| Ga0335025_0087402_1824_1931 | 3300034096 | Freshwater | AKISNALVAAQKVIAPAAVVILKAAVIELQGPARK |
| Ga0335025_0138042_2_112 | 3300034096 | Freshwater | MMQAKISNALVAAQKVIAPAAVVILKAAVIELQGPAR |
| Ga0335027_0174322_1405_1518 | 3300034101 | Freshwater | MQAKSLNVLADALKVIAPAAVVILKAAVIELQGPAKK |
| Ga0335066_0228879_233_346 | 3300034112 | Freshwater | MQAKSLNVLADALKVIAPAAVVNLKAAVIELQDPAKK |
| Ga0335068_0066663_250_363 | 3300034116 | Freshwater | MQAKISNALVAAQKVIAPAALVILKAAVIELQGAAKK |
| ⦗Top⦘ |