| Basic Information | |
|---|---|
| Family ID | F075957 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 46 residues |
| Representative Sequence | AALESYQQALAGGTPGDTITQRAHEKINALGKADAPSPAPPNQP |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.54 % |
| % of genes near scaffold ends (potentially truncated) | 97.46 % |
| % of genes from short scaffolds (< 2000 bps) | 77.97 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (26.271 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.237 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.712 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.11% β-sheet: 0.00% Coil/Unstructured: 63.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF13525 | YfiO | 43.22 |
| PF01467 | CTP_transf_like | 19.49 |
| PF07517 | SecA_DEAD | 11.86 |
| PF13432 | TPR_16 | 7.63 |
| PF14559 | TPR_19 | 6.78 |
| PF13414 | TPR_11 | 4.24 |
| PF08309 | LVIVD | 0.85 |
| PF01960 | ArgJ | 0.85 |
| PF13174 | TPR_6 | 0.85 |
| PF00115 | COX1 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 11.86 |
| COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 0.85 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10028137 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300002561|JGI25384J37096_10031013 | All Organisms → cellular organisms → Bacteria | 2084 | Open in IMG/M |
| 3300002561|JGI25384J37096_10092329 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300002562|JGI25382J37095_10098390 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300002562|JGI25382J37095_10103094 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1004 | Open in IMG/M |
| 3300005167|Ga0066672_10010979 | All Organisms → cellular organisms → Bacteria | 4370 | Open in IMG/M |
| 3300005172|Ga0066683_10218636 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300005180|Ga0066685_10705986 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 691 | Open in IMG/M |
| 3300005440|Ga0070705_101868124 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| 3300005444|Ga0070694_100011654 | All Organisms → cellular organisms → Bacteria | 5445 | Open in IMG/M |
| 3300005446|Ga0066686_10885597 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
| 3300005552|Ga0066701_10101177 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300005552|Ga0066701_10862669 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
| 3300005553|Ga0066695_10732059 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 576 | Open in IMG/M |
| 3300005555|Ga0066692_11041505 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 500 | Open in IMG/M |
| 3300005557|Ga0066704_11004642 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005560|Ga0066670_10488414 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 758 | Open in IMG/M |
| 3300005561|Ga0066699_10963562 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300005575|Ga0066702_10786343 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
| 3300005576|Ga0066708_10361085 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 933 | Open in IMG/M |
| 3300005888|Ga0075289_1028120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 828 | Open in IMG/M |
| 3300006049|Ga0075417_10046615 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300006755|Ga0079222_11019059 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 714 | Open in IMG/M |
| 3300006794|Ga0066658_10077465 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300006796|Ga0066665_10884655 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 694 | Open in IMG/M |
| 3300006797|Ga0066659_10941173 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 722 | Open in IMG/M |
| 3300006804|Ga0079221_10070489 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300006903|Ga0075426_10811816 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 704 | Open in IMG/M |
| 3300006914|Ga0075436_101083746 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 603 | Open in IMG/M |
| 3300006954|Ga0079219_10166814 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300009012|Ga0066710_104582511 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
| 3300009088|Ga0099830_10198084 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300009137|Ga0066709_100285854 | All Organisms → cellular organisms → Bacteria | 2231 | Open in IMG/M |
| 3300009143|Ga0099792_10390832 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 849 | Open in IMG/M |
| 3300009162|Ga0075423_11511510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 720 | Open in IMG/M |
| 3300009808|Ga0105071_1055132 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 651 | Open in IMG/M |
| 3300009814|Ga0105082_1126265 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
| 3300010303|Ga0134082_10083030 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300010322|Ga0134084_10014049 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
| 3300010326|Ga0134065_10005966 | All Organisms → cellular organisms → Bacteria | 3099 | Open in IMG/M |
| 3300010335|Ga0134063_10091821 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300010337|Ga0134062_10009892 | All Organisms → cellular organisms → Bacteria | 3490 | Open in IMG/M |
| 3300010373|Ga0134128_10271974 | All Organisms → cellular organisms → Bacteria | 1899 | Open in IMG/M |
| 3300010397|Ga0134124_13133917 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
| 3300011269|Ga0137392_10296021 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300011271|Ga0137393_11474238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
| 3300012198|Ga0137364_10197488 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300012198|Ga0137364_10200227 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300012203|Ga0137399_10181081 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300012205|Ga0137362_10403363 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300012205|Ga0137362_11265670 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 623 | Open in IMG/M |
| 3300012206|Ga0137380_10200634 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300012206|Ga0137380_11332516 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 603 | Open in IMG/M |
| 3300012206|Ga0137380_11334683 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 602 | Open in IMG/M |
| 3300012206|Ga0137380_11440246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 573 | Open in IMG/M |
| 3300012207|Ga0137381_10229834 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300012209|Ga0137379_10918325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 780 | Open in IMG/M |
| 3300012210|Ga0137378_10470223 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300012210|Ga0137378_11148469 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 692 | Open in IMG/M |
| 3300012211|Ga0137377_10167930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2105 | Open in IMG/M |
| 3300012211|Ga0137377_11122653 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012351|Ga0137386_10968149 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 607 | Open in IMG/M |
| 3300012353|Ga0137367_10014668 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6218 | Open in IMG/M |
| 3300012393|Ga0134052_1027011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
| 3300012401|Ga0134055_1229011 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300012532|Ga0137373_10048258 | All Organisms → cellular organisms → Bacteria | 3976 | Open in IMG/M |
| 3300012927|Ga0137416_11166940 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 693 | Open in IMG/M |
| 3300012972|Ga0134077_10085301 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300012975|Ga0134110_10043910 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| 3300012976|Ga0134076_10344818 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
| 3300012977|Ga0134087_10403664 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 666 | Open in IMG/M |
| 3300014154|Ga0134075_10473178 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 559 | Open in IMG/M |
| 3300014157|Ga0134078_10016514 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
| 3300014157|Ga0134078_10192890 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 827 | Open in IMG/M |
| 3300015052|Ga0137411_1113961 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300015052|Ga0137411_1276977 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300015054|Ga0137420_1479547 | All Organisms → cellular organisms → Bacteria | 2524 | Open in IMG/M |
| 3300015358|Ga0134089_10349950 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
| 3300017656|Ga0134112_10294304 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 651 | Open in IMG/M |
| 3300017659|Ga0134083_10368108 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
| 3300018433|Ga0066667_11095449 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 689 | Open in IMG/M |
| 3300018468|Ga0066662_10094974 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
| 3300020170|Ga0179594_10018175 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300024178|Ga0247694_1010874 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300024219|Ga0247665_1005337 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300025159|Ga0209619_10212883 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300025319|Ga0209520_10147556 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300026296|Ga0209235_1032798 | All Organisms → cellular organisms → Bacteria | 2661 | Open in IMG/M |
| 3300026297|Ga0209237_1244998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
| 3300026298|Ga0209236_1013862 | All Organisms → cellular organisms → Bacteria | 4676 | Open in IMG/M |
| 3300026298|Ga0209236_1034155 | All Organisms → cellular organisms → Bacteria | 2685 | Open in IMG/M |
| 3300026301|Ga0209238_1243989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
| 3300026306|Ga0209468_1022027 | All Organisms → cellular organisms → Bacteria | 2271 | Open in IMG/M |
| 3300026313|Ga0209761_1232784 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 755 | Open in IMG/M |
| 3300026313|Ga0209761_1301368 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 558 | Open in IMG/M |
| 3300026317|Ga0209154_1010052 | All Organisms → cellular organisms → Bacteria | 4663 | Open in IMG/M |
| 3300026317|Ga0209154_1126138 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300026325|Ga0209152_10007612 | All Organisms → cellular organisms → Bacteria | 3840 | Open in IMG/M |
| 3300026325|Ga0209152_10270406 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300026325|Ga0209152_10421844 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300026331|Ga0209267_1004346 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 8639 | Open in IMG/M |
| 3300026331|Ga0209267_1184677 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 818 | Open in IMG/M |
| 3300026334|Ga0209377_1016231 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3937 | Open in IMG/M |
| 3300026523|Ga0209808_1046073 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
| 3300026527|Ga0209059_1174850 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 751 | Open in IMG/M |
| 3300026529|Ga0209806_1029200 | All Organisms → cellular organisms → Bacteria | 2751 | Open in IMG/M |
| 3300026547|Ga0209156_10006694 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7989 | Open in IMG/M |
| 3300026547|Ga0209156_10283192 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 754 | Open in IMG/M |
| 3300026548|Ga0209161_10079775 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
| 3300027669|Ga0208981_1136595 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 624 | Open in IMG/M |
| 3300027725|Ga0209178_1035667 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300027873|Ga0209814_10043281 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1876 | Open in IMG/M |
| 3300027882|Ga0209590_10158540 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300028881|Ga0307277_10566663 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| 3300031720|Ga0307469_11789314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 593 | Open in IMG/M |
| 3300031753|Ga0307477_10665875 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300032180|Ga0307471_104171524 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300033433|Ga0326726_11001195 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100281371 | 3300002558 | Grasslands Soil | DVRLAQGDVPGALESYQQALVGGAPGDTITQRAHAKINALGKADAPATPPNQP* |
| JGI25384J37096_100310134 | 3300002561 | Grasslands Soil | GDVTAALESYQQALAGGTPGDTITLRAQQKINALGKADAPAPPPKP* |
| JGI25384J37096_100923291 | 3300002561 | Grasslands Soil | VKLAQGDVAAALESYQQALAGGTPGDTITQRAHEKINALGKADAPSPPPPNQP* |
| JGI25382J37095_100983901 | 3300002562 | Grasslands Soil | YQQALVGGTPGDTITQRAHEKINALGKADAPSPVPPPNQP* |
| JGI25382J37095_101030942 | 3300002562 | Grasslands Soil | KLAQGDITDALDNYQQVLSGGRAGDTLSQRAHEKINALGKADAPSTTPPKL* |
| Ga0066672_100109791 | 3300005167 | Soil | DVPGALESYQQALVAGAPGDTITQRAQAKINALGKADAPTAPPNQP* |
| Ga0066683_102186363 | 3300005172 | Soil | LAQGDIPAALESYQQALAGGTSGDTLAQRAHEKINALGKADAPSPAPPKLP* |
| Ga0066685_107059862 | 3300005180 | Soil | AALESYQQALAGGTPGDTITQRAHEKINALGKADASSPAPPNQP* |
| Ga0070705_1018681242 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LAQGDVAAALESYQQALVGGTPGDTITQRAHEKINALGKADAPSPAPQNQP* |
| Ga0070694_1000116541 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLAQGDVAAALESYQQALVGGTPGDTITQRAHEKINALGKADAPSPAPQNQP* |
| Ga0066686_108855971 | 3300005446 | Soil | AALESYQQALAGGTPGDTITQRAHEKINALGKADAPSPAPPNQP* |
| Ga0066701_101011771 | 3300005552 | Soil | GDIPAALESYQQALAGGTSGDTLAQRAHEKINALGKADAPSPAPPKLP* |
| Ga0066701_108626692 | 3300005552 | Soil | LAQGDVAAALESYQQALAGGTPGDTITQRAHEKINALGKADAPSPGPPKQP* |
| Ga0066695_107320591 | 3300005553 | Soil | ALAGGTPGDTITQRAHEKINALGKADAPSPAPPNQP* |
| Ga0066692_110415052 | 3300005555 | Soil | YQQALAGGTPGDTITQRAHEKINALGKADAPSPGPPKQP* |
| Ga0066704_110046422 | 3300005557 | Soil | GDVKLAQGDVAAALESYQQALAGGTPGDTITQRAHEKINALGKADAPSPVPPPNQP* |
| Ga0066670_104884141 | 3300005560 | Soil | QALSGGTPGDTLTQRAQEKINALGKADAPSPAPPKQP* |
| Ga0066699_109635622 | 3300005561 | Soil | KLAQGDVAGALESYQQALAGGTPGDTLTQRVQDKINALGKADAPSPNPPKQP* |
| Ga0066702_107863431 | 3300005575 | Soil | GALESYQQALSGGTPGDTLTQRAQDKINALGKADAPSPAPPKQP* |
| Ga0066708_103610852 | 3300005576 | Soil | QALSGGTPGDTLTQRAQDKINALGKADAPSPPKQP* |
| Ga0075289_10281201 | 3300005888 | Rice Paddy Soil | AALESYQQALAGGTPGDTLTERAQQKINALGRADAPTPVPPKQL* |
| Ga0075417_100466151 | 3300006049 | Populus Rhizosphere | ALAGGTPGDTITQRAHEKINALGKADAPSPTPPNQP* |
| Ga0079222_110190592 | 3300006755 | Agricultural Soil | AQGDVAAALESYQQALAGGTPGDTITQRAHEKINALGKADAPSPTPPNQP* |
| Ga0066658_100774653 | 3300006794 | Soil | VAAALESYQQALVGGTPGDTITQRAHEKINALGKADAPSPVPPPNQP* |
| Ga0066665_108846551 | 3300006796 | Soil | QQALAGGTPGDTITQRAHEKINALGKADAPSPAPPNQP* |
| Ga0066659_109411732 | 3300006797 | Soil | LSGGTPGDTLTQRAQDKINALGKADAPSPAPPKQP* |
| Ga0079221_100704891 | 3300006804 | Agricultural Soil | DVAGALESYQQALAGGTPGDTLTQRAQEKINALGKADAPSPAQPPQP* |
| Ga0075426_108118161 | 3300006903 | Populus Rhizosphere | GDIPAALESYQQALAGGTPGDTLAQRAHEKINALGKADAPSTTPPKLP* |
| Ga0075436_1010837461 | 3300006914 | Populus Rhizosphere | ALDSYQQALAGGSPGDTINVKAQAKINALGRAADSTSPPKP* |
| Ga0079219_101668141 | 3300006954 | Agricultural Soil | QQALAGGTPGDTLTQRAQEKINALGKADAPSPAQPPQP* |
| Ga0066710_1045825112 | 3300009012 | Grasslands Soil | ALESYQQALAGGTPGDTITQRAHEKINALGKADAPSPAPPKQP |
| Ga0099830_101980841 | 3300009088 | Vadose Zone Soil | GLGDVKLAQGDVAGALDSYQQALAGGAPGDTLTRRAQDKINALGKADAPSPAPPKQP* |
| Ga0066709_1002858541 | 3300009137 | Grasslands Soil | VAAALESYQQALVGGTPGDTITQRAHEKINAVGKADAPASPAPPPNQP* |
| Ga0099792_103908322 | 3300009143 | Vadose Zone Soil | VKLAQGDVAAALESYQQALAGGTPGDTITQRAHEKINALGKADAPPPAPPNQP* |
| Ga0075423_115115102 | 3300009162 | Populus Rhizosphere | ESYQQALAGGTPGDTLTQRAHEKINALGKADAPSSASPNKP* |
| Ga0105071_10551321 | 3300009808 | Groundwater Sand | GDVAGALESYQQALGGGAPGDTIAQHAQQKINALGKADAAAPPLPQP* |
| Ga0105082_11262651 | 3300009814 | Groundwater Sand | LGLGDVKLAQGDVAGALESYQQALGGGAPVDTIAQHAQQKINALGKADAAAPPLPQP* |
| Ga0134082_100830303 | 3300010303 | Grasslands Soil | DNYQQVLSSGRAGDTLSQRAHEKINALGKADAPSTTPPKL* |
| Ga0134084_100140491 | 3300010322 | Grasslands Soil | LAGGTPGDTLTQRVQDKINALGKADAPSPNPPKQP* |
| Ga0134065_100059664 | 3300010326 | Grasslands Soil | AAALESYQQALVGGTPGDTITQRAHEKINALGKADAPSPVPPPNQP* |
| Ga0134063_100918213 | 3300010335 | Grasslands Soil | DVPGALESYQQALVGGAAGDTITQRAQAKIKALGKADAPTAPPNQP* |
| Ga0134062_100098924 | 3300010337 | Grasslands Soil | GGAPGDTIAQRAQQKIDALGKADAPSPTPPPKQP* |
| Ga0134128_102719744 | 3300010373 | Terrestrial Soil | GLGDVRLAQGDVAAALESYQQALVGGTPGDTITQRAHEKINALGKADAPSPAPQNQP* |
| Ga0134124_131339172 | 3300010397 | Terrestrial Soil | GDVRLAQGDVAAALESYQQALVGGTPGDTITQRAHEKINALGKADAPSAAPQNEP* |
| Ga0137392_102960211 | 3300011269 | Vadose Zone Soil | VLLAQGDLTGALNSYQQALAGGSPGDTITVKAQAKINALGRAADSTSPPKP* |
| Ga0137393_114742382 | 3300011271 | Vadose Zone Soil | GDVRLAQGDVAAALESYQQALVGGAPGDTITQRAHEKINALGKADAPSPAPPNDQ* |
| Ga0137364_101974883 | 3300012198 | Vadose Zone Soil | ALESYQQALVGGTPGDTITQRAHEKINAVGKADAPASPAPPPNQP* |
| Ga0137364_102002273 | 3300012198 | Vadose Zone Soil | GALENYQQAVTGGNPGDSITVRAQQKINALGKADAPGGPPQQL* |
| Ga0137399_101810814 | 3300012203 | Vadose Zone Soil | VGGTPGDTITQRAHEKINALGKADAPSPAPQNEP* |
| Ga0137362_104033633 | 3300012205 | Vadose Zone Soil | ENYQLALAGGNPGDSITVRAQQKINALGKADAPGGPPQQL* |
| Ga0137362_112656702 | 3300012205 | Vadose Zone Soil | ALESYQQALVGGTPGDTITQRAHEKINALGKADAPSPAPQNEP* |
| Ga0137380_102006344 | 3300012206 | Vadose Zone Soil | VAAALESYQQALAGGTPGDTITQRAQEKINALGKADAPPPPNQP* |
| Ga0137380_113325162 | 3300012206 | Vadose Zone Soil | GLGDVKLAQGDVAAALESYQQALAGGTPGDTITQRAHEKINALGKADAPSTAPPNQP* |
| Ga0137380_113346831 | 3300012206 | Vadose Zone Soil | ALESYQQALVGGTPGDTITQRAHEKINALGKADAPSPAPPNQP* |
| Ga0137380_114402462 | 3300012206 | Vadose Zone Soil | VKLAQGDVAAALESYQQALAGGTPGDTITQRAHEKINALGKADAPAPAPPNQP* |
| Ga0137381_102298341 | 3300012207 | Vadose Zone Soil | QGDVPGALESYQQALSGGNPGDSIAVRAQQKINALGKADAPSPTPPQQL* |
| Ga0137379_109183252 | 3300012209 | Vadose Zone Soil | LESYQQALAGGTPGDTITQRAHEKINALGKADAPLPAPPNQP* |
| Ga0137378_104702233 | 3300012210 | Vadose Zone Soil | PGALESYQQAIAGGNPGDSITVRAQQKINALGKADAPGAAPPQQL* |
| Ga0137378_111484691 | 3300012210 | Vadose Zone Soil | ALVGGAPGDTITRRAQAKINGLGKADAPTTPPNQP* |
| Ga0137377_101679304 | 3300012211 | Vadose Zone Soil | QGDMTGALDSYQQALAGGSPGDTITVKAQAKINALGRAADTSPPTP* |
| Ga0137377_111226531 | 3300012211 | Vadose Zone Soil | ENYQLAVAGGSPGDSIAVRAQQEINSLGKADAPGGPPQQL* |
| Ga0137386_109681491 | 3300012351 | Vadose Zone Soil | LGDVKLAQGDITDALDNYQQVLSGGRAGDTLSQRAHEKINALGKADAPSTTPPKL* |
| Ga0137367_100146681 | 3300012353 | Vadose Zone Soil | KLAQGDVAGALEGYQQAMTGGSPGDTIAQQAQQKINALGKADAPEPPRQP* |
| Ga0134052_10270112 | 3300012393 | Grasslands Soil | AAALESYQQALAGGTPGDTITQRAHEKINALGKADAPSPAPPNQP* |
| Ga0134055_12290112 | 3300012401 | Grasslands Soil | LESYQQALAGGTPGDTITQRAHEKINALGKADAPSPAPPNQP* |
| Ga0137373_100482584 | 3300012532 | Vadose Zone Soil | LGLGDVKLAQGDLAGALESYQQALAGGTPGDTITHRAQEKINALGKADAPPAGPPNNP* |
| Ga0137416_111669401 | 3300012927 | Vadose Zone Soil | LESYQQALVGGAAGDTITQRAHEKINALGKADAPSPAPPNDQ* |
| Ga0134077_100853011 | 3300012972 | Grasslands Soil | QQVLSGGRAGDSLSQRAHEKINALGKADAPSTTPPKL* |
| Ga0134110_100439104 | 3300012975 | Grasslands Soil | LESYQQALAGGTPGDTLTQRVQDKINALGKADAPPPNPPKQP* |
| Ga0134076_103448181 | 3300012976 | Grasslands Soil | FLGLGDVRLAQGDVPRALESYQQALVGGAAGDTITQRAQAKINALGKADAPTAPPNQP* |
| Ga0134087_104036642 | 3300012977 | Grasslands Soil | GDIPAALESYQQALAGGTSGDTLAQRAHEKINALGKADVPSPAPPKLP* |
| Ga0134075_104731781 | 3300014154 | Grasslands Soil | LGDVKLAQGDLVGALESYRQALAGGTPGDTITQRAQQKINALGKADVAPAGPPNNP* |
| Ga0134078_100165141 | 3300014157 | Grasslands Soil | GNVGAALESYQQALVGGTPGDTITQRAHEKINALGKADAPSPVPPPNQP* |
| Ga0134078_101928901 | 3300014157 | Grasslands Soil | LGGTPGDTLTQRAQDKINALGKADAPSPAPPKQP* |
| Ga0137411_11139611 | 3300015052 | Vadose Zone Soil | PAGAALVGGTPGDTITQRAHEKINALGKADAPSPAPQNEP* |
| Ga0137411_12769771 | 3300015052 | Vadose Zone Soil | KLAQGAQGDVAAALESYQQALVGGTPGDTITQRAHEKINALGKADAPSPGPQNEP* |
| Ga0137420_14795476 | 3300015054 | Vadose Zone Soil | VAAALESYQQALVGGAPGDTITQRAHEKINALGKADAPSSAPPNDQ* |
| Ga0134089_103499502 | 3300015358 | Grasslands Soil | LESYQQALAGGAPGDTIAQRAQQKIDALGKADAPSPTPPPKQP* |
| Ga0134112_102943042 | 3300017656 | Grasslands Soil | AALESYQQALAGGTPGDTITQRAHEKINALGKADAPSPAPPNQP |
| Ga0134083_103681082 | 3300017659 | Grasslands Soil | AGALESYQQALTGGTPGDTLTQRAQEKINALGKADAPASGPPHDP |
| Ga0066667_110954491 | 3300018433 | Grasslands Soil | QALAGGTPGDTITQRAHEKINALGKADAPSPAPPNQP |
| Ga0066662_100949741 | 3300018468 | Grasslands Soil | QQALAGGTPGDTITQRAHEKINALGKADAPSPAPPNQP |
| Ga0179594_100181754 | 3300020170 | Vadose Zone Soil | YQQALVGGAPGDTITQRAHEKINALGKADAPSPAPPNDQ |
| Ga0247694_10108741 | 3300024178 | Soil | GDVQLAQGDVAAALESYQQALTGGTPGDTITQRAQAKINALGKADAPSSAAPPKQE |
| Ga0247665_10053371 | 3300024219 | Soil | YQQALTGGTPGDTITQRAQAKINALGKADAPSSAAPPKQE |
| Ga0209619_102128833 | 3300025159 | Soil | YHDEDEVALIESYQQARGGGAPGDTIAQRAQQRINALGKADAAAPPPPQP |
| Ga0209520_101475561 | 3300025319 | Soil | ALESYQQALGGGAPGDTIAQRAQQRINALGKADAAAPPPPQP |
| Ga0209235_10327981 | 3300026296 | Grasslands Soil | AQGDVAAALESYQQALVGGAPGDTITQRAHEKINALGKADAPSPARPNDQ |
| Ga0209237_12449982 | 3300026297 | Grasslands Soil | VKLAQGDVAAALESYQQALAGGTPGDTITQRAHEKINALGKADAPSPGPPKQP |
| Ga0209236_10138621 | 3300026298 | Grasslands Soil | YQQALAGGTPGDTITLRAQQKINALGKADAPAPPPKP |
| Ga0209236_10341551 | 3300026298 | Grasslands Soil | GALESYQQALVGGAPGDTITQRAHAKINALGKADAPATPPNQP |
| Ga0209238_12439891 | 3300026301 | Grasslands Soil | YQQALSGGTPGDTLTQRAQDKINALGKADAPSPAPPKQP |
| Ga0209468_10220271 | 3300026306 | Soil | IPDALDNYQQVLSGGRPGDTLSQRAHEKINALGKADAPSTTPPKP |
| Ga0209761_12327842 | 3300026313 | Grasslands Soil | GLGDVKLAQGDIPDALDNYQQVLSGGRPGDTLSQRAHEKINALGKADAPSTTPPKP |
| Ga0209761_13013681 | 3300026313 | Grasslands Soil | AALESYQQALAGGTPGDTITQRAQEKINALGKADAPSPPNQP |
| Ga0209154_10100521 | 3300026317 | Soil | GDVRLAQGDVPGALESYQQALVAGAPGDTITQRAQAKINALGKADAPTAPPNQP |
| Ga0209154_11261383 | 3300026317 | Soil | ALSGGTPGDTLTQRAQDKINALGKADAPSPAPPKQP |
| Ga0209152_100076123 | 3300026325 | Soil | VAAALESYQQALVGGTPGDTITQRAHEKINALGKADAPSPVPPPNQP |
| Ga0209152_102704061 | 3300026325 | Soil | YLGLGDVRLAQGDVPGALENYQLAITGGNPGDSITVRAQQKINALGKADAPGGPPQQL |
| Ga0209152_104218442 | 3300026325 | Soil | QGDVPGALESYQQALVAGAPGDTITQRAQAKINALGKADAPTAPPNQP |
| Ga0209267_10043461 | 3300026331 | Soil | LSGGTPGDTLTQRAQDKINALGKADAPSPAPPKQP |
| Ga0209267_11846772 | 3300026331 | Soil | AAALESYQQALVGGAPGDTITQRAQEKINALGKADAPSPPNQP |
| Ga0209377_10162314 | 3300026334 | Soil | HGDVPGALESYQQALVGGAAGDTITQRAQAKINALGKADAPTAPPNQP |
| Ga0209808_10460731 | 3300026523 | Soil | GDVKLAQGDVAGALESYQQALSGGTPGDTLTQRAQDKINALGKADAPSPPKQP |
| Ga0209059_11748502 | 3300026527 | Soil | LESYQQALAGGTPGDTITQRAHEKINALGKADAPSPAPPNQP |
| Ga0209806_10292004 | 3300026529 | Soil | LAGGTPGDTITQRAHEKINALGKADAPSPAPPNKP |
| Ga0209156_100066945 | 3300026547 | Soil | VKLAQGDVAGALESYQQALSGGTPGDTLTQRAQDKINALGKADAPSPAPPKQP |
| Ga0209156_102831921 | 3300026547 | Soil | VKLAQGDITDALDNYQQVLSGGRAGDTLSQRAHEKINALGKADAPSTTPPKL |
| Ga0209161_100797754 | 3300026548 | Soil | VAAALESYQQALVGGAPGDTITQRAQEKINALGKADAPSPPNQP |
| Ga0208981_11365951 | 3300027669 | Forest Soil | GDVAAALESYQQALVGGTPGDTITQRAQEKINALGKADAPSPPNQP |
| Ga0209178_10356671 | 3300027725 | Agricultural Soil | QQALAGGTPGDTLTQRAQEKINALGKADAPSPAQPPQP |
| Ga0209814_100432814 | 3300027873 | Populus Rhizosphere | ALAGGTPGDTITQRAHEKINALGKADAPSPTPPNQP |
| Ga0209590_101585401 | 3300027882 | Vadose Zone Soil | QGDVAAALESYQQALVGGAAGDTITQRAHEKINALGKADAPSPAPPNDQ |
| Ga0307277_105666631 | 3300028881 | Soil | YQQALVGGAPGDTIMQRAQEKINALGKAEAPSPPQQP |
| Ga0307469_117893142 | 3300031720 | Hardwood Forest Soil | GDVAAALESYQQALTGGTPGDTITQRAQAKINALGKADAPSSAAPPKQE |
| Ga0307477_106658751 | 3300031753 | Hardwood Forest Soil | LANYQQALVGGSPGDSLTARAQEKINALGKADAPGAQPPQLK |
| Ga0307471_1041715241 | 3300032180 | Hardwood Forest Soil | ALARGDVSEALVNYQQALVGGSPGDSLTARAQQKINALGKADAPSGPVPNLE |
| Ga0326726_110011952 | 3300033433 | Peat Soil | QALVGGNPGDSITVRAQQKINALGKAESPGAPSAPAKQL |
| ⦗Top⦘ |