Basic Information | |
---|---|
Family ID | F075943 |
Family Type | Metagenome |
Number of Sequences | 118 |
Average Sequence Length | 46 residues |
Representative Sequence | MRCPNCGTLMNRHAEKPVKDAHALEGEVIASIHYCPGCGKVEAEIESPDQ |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 118 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 59.32 % |
% of genes near scaffold ends (potentially truncated) | 18.64 % |
% of genes from short scaffolds (< 2000 bps) | 80.51 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.373 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (20.339 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.966 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.169 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.77% Coil/Unstructured: 69.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 118 Family Scaffolds |
---|---|---|
PF03358 | FMN_red | 40.68 |
PF13450 | NAD_binding_8 | 21.19 |
PF00732 | GMC_oxred_N | 5.08 |
PF01266 | DAO | 2.54 |
PF11412 | DsbC | 1.69 |
PF00903 | Glyoxalase | 1.69 |
PF10517 | DM13 | 1.69 |
PF05199 | GMC_oxred_C | 1.69 |
PF12681 | Glyoxalase_2 | 1.69 |
PF13442 | Cytochrome_CBB3 | 0.85 |
PF00291 | PALP | 0.85 |
PF13531 | SBP_bac_11 | 0.85 |
PF13147 | Obsolete Pfam Family | 0.85 |
PF12704 | MacB_PCD | 0.85 |
PF02371 | Transposase_20 | 0.85 |
PF00578 | AhpC-TSA | 0.85 |
PF08281 | Sigma70_r4_2 | 0.85 |
PF00034 | Cytochrom_C | 0.85 |
PF03703 | bPH_2 | 0.85 |
PF03551 | PadR | 0.85 |
COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
---|---|---|---|
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 6.78 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.85 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.85 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.85 |
COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.85 |
COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.85 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.37 % |
Unclassified | root | N/A | 7.63 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c0880874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 1149 | Open in IMG/M |
3300000363|ICChiseqgaiiFebDRAFT_11156180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100785240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 752 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100787693 | All Organisms → cellular organisms → Bacteria | 6669 | Open in IMG/M |
3300000559|F14TC_103985394 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300000559|F14TC_105341355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300002558|JGI25385J37094_10058506 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300002558|JGI25385J37094_10148684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300003321|soilH1_10289799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1384 | Open in IMG/M |
3300004463|Ga0063356_100169065 | All Organisms → cellular organisms → Bacteria | 2526 | Open in IMG/M |
3300004463|Ga0063356_100318139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1943 | Open in IMG/M |
3300004463|Ga0063356_100918040 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300004463|Ga0063356_105041882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300004633|Ga0066395_10539779 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300005172|Ga0066683_10342154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
3300005175|Ga0066673_10272898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 982 | Open in IMG/M |
3300005177|Ga0066690_10924602 | Not Available | 555 | Open in IMG/M |
3300005186|Ga0066676_10263882 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300005330|Ga0070690_101150682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
3300005332|Ga0066388_101165589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1313 | Open in IMG/M |
3300005332|Ga0066388_103691050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 781 | Open in IMG/M |
3300005332|Ga0066388_105909082 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300005332|Ga0066388_107449443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300005332|Ga0066388_107808489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Pseudanabaenaceae → Pseudanabaena → unclassified Pseudanabaena → Pseudanabaena sp. PCC 6802 | 536 | Open in IMG/M |
3300005336|Ga0070680_100828826 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300005353|Ga0070669_101932512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300005354|Ga0070675_100651485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
3300005446|Ga0066686_10018784 | All Organisms → cellular organisms → Bacteria | 3827 | Open in IMG/M |
3300005447|Ga0066689_10900078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
3300005450|Ga0066682_10467754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
3300005458|Ga0070681_11153503 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300005530|Ga0070679_101355658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300005552|Ga0066701_10780938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300005553|Ga0066695_10111493 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
3300005554|Ga0066661_10161058 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300005574|Ga0066694_10218765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
3300005586|Ga0066691_10186407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1205 | Open in IMG/M |
3300005713|Ga0066905_100739966 | Not Available | 847 | Open in IMG/M |
3300005764|Ga0066903_100947531 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
3300005764|Ga0066903_108286678 | Not Available | 531 | Open in IMG/M |
3300006031|Ga0066651_10249666 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300006791|Ga0066653_10080279 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300006796|Ga0066665_11239711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300006797|Ga0066659_10176918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1541 | Open in IMG/M |
3300006800|Ga0066660_10330505 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300006844|Ga0075428_101758647 | Not Available | 646 | Open in IMG/M |
3300006845|Ga0075421_100641693 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
3300006852|Ga0075433_10066699 | All Organisms → cellular organisms → Bacteria | 3158 | Open in IMG/M |
3300006852|Ga0075433_10086905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2761 | Open in IMG/M |
3300006854|Ga0075425_100012752 | All Organisms → cellular organisms → Bacteria | 9019 | Open in IMG/M |
3300006854|Ga0075425_100214275 | All Organisms → cellular organisms → Bacteria | 2214 | Open in IMG/M |
3300006871|Ga0075434_100007598 | All Organisms → cellular organisms → Bacteria | 10037 | Open in IMG/M |
3300006904|Ga0075424_100377851 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300009012|Ga0066710_100024771 | All Organisms → cellular organisms → Bacteria | 6797 | Open in IMG/M |
3300009012|Ga0066710_100073937 | All Organisms → cellular organisms → Bacteria | 4394 | Open in IMG/M |
3300009012|Ga0066710_100119707 | All Organisms → cellular organisms → Bacteria | 3581 | Open in IMG/M |
3300009094|Ga0111539_10430627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1536 | Open in IMG/M |
3300009147|Ga0114129_10002857 | All Organisms → cellular organisms → Bacteria | 24163 | Open in IMG/M |
3300009147|Ga0114129_11296939 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300009156|Ga0111538_11250214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
3300009792|Ga0126374_10208921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1242 | Open in IMG/M |
3300009792|Ga0126374_10575460 | Not Available | 827 | Open in IMG/M |
3300010043|Ga0126380_10407573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1012 | Open in IMG/M |
3300010043|Ga0126380_10507355 | Not Available | 927 | Open in IMG/M |
3300010043|Ga0126380_11008387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
3300010046|Ga0126384_10208047 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
3300010047|Ga0126382_11065092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
3300010047|Ga0126382_11255730 | Not Available | 667 | Open in IMG/M |
3300010358|Ga0126370_10074301 | All Organisms → cellular organisms → Bacteria | 2259 | Open in IMG/M |
3300010358|Ga0126370_11431372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300010359|Ga0126376_12687830 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300010360|Ga0126372_11060114 | Not Available | 826 | Open in IMG/M |
3300010362|Ga0126377_11395834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
3300010362|Ga0126377_12776120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300010366|Ga0126379_13342733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 537 | Open in IMG/M |
3300010398|Ga0126383_12236812 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300012202|Ga0137363_10048364 | All Organisms → cellular organisms → Bacteria | 3036 | Open in IMG/M |
3300012203|Ga0137399_11299544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
3300012205|Ga0137362_10124614 | All Organisms → cellular organisms → Bacteria | 2187 | Open in IMG/M |
3300012211|Ga0137377_10627511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
3300012514|Ga0157330_1043890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
3300012923|Ga0137359_10234255 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
3300012948|Ga0126375_10355773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
3300012948|Ga0126375_10579233 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300014325|Ga0163163_11168530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
3300015371|Ga0132258_10012723 | All Organisms → cellular organisms → Bacteria | 17742 | Open in IMG/M |
3300015371|Ga0132258_10046851 | All Organisms → cellular organisms → Bacteria | 9864 | Open in IMG/M |
3300015371|Ga0132258_10972082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2145 | Open in IMG/M |
3300015371|Ga0132258_11466389 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
3300015371|Ga0132258_12130277 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300015373|Ga0132257_100796798 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300015374|Ga0132255_100398327 | Not Available | 2004 | Open in IMG/M |
3300015374|Ga0132255_101516054 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300015374|Ga0132255_102453477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
3300016294|Ga0182041_11299789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300016319|Ga0182033_11217368 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300018431|Ga0066655_10591502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
3300018433|Ga0066667_10022623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3379 | Open in IMG/M |
3300021478|Ga0210402_11810540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300021560|Ga0126371_10773472 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300021560|Ga0126371_13347665 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300021560|Ga0126371_13627245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300025580|Ga0210138_1078921 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 783 | Open in IMG/M |
3300025921|Ga0207652_11574429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300025960|Ga0207651_11642827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300025961|Ga0207712_10289596 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300026306|Ga0209468_1127582 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300026324|Ga0209470_1029060 | All Organisms → cellular organisms → Bacteria | 2864 | Open in IMG/M |
3300026332|Ga0209803_1032515 | All Organisms → cellular organisms → Bacteria | 2452 | Open in IMG/M |
3300026343|Ga0209159_1135377 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300027874|Ga0209465_10288857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
3300031057|Ga0170834_101148778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300031231|Ga0170824_106644715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1301 | Open in IMG/M |
3300031446|Ga0170820_12169262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300031716|Ga0310813_10208220 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
3300031720|Ga0307469_11111108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300031954|Ga0306926_11895087 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300032261|Ga0306920_100101538 | All Organisms → cellular organisms → Bacteria | 4259 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.34% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.47% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 7.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.39% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.39% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.39% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.54% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.69% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.85% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_08808742 | 2228664022 | Soil | MNRHAEKPIKDAHALEGEVVASIHYCPGCGKVEAEIESPEQ |
ICChiseqgaiiFebDRAFT_111561802 | 3300000363 | Soil | MHCPNCGTPMNRHAEKPLKTAAEETEVIASIHYCPACGKVEATIEL* |
INPhiseqgaiiFebDRAFT_1007852402 | 3300000364 | Soil | MRCPNCGTLMNRHAEKPIKDAHAFEGEVIASIHYCPXXGKVEAVIEDA* |
INPhiseqgaiiFebDRAFT_1007876935 | 3300000364 | Soil | MNRHAEKPIKDAHALEGEVVASIHYCPGCGKVEAEIESPEQ* |
F14TC_1039853942 | 3300000559 | Soil | MNHHAEKPLKTAEEAEVIASIYYCPACGKVEAAIEG* |
F14TC_1053413552 | 3300000559 | Soil | MNRHAEKAIKDPQVPEGEVIASIYCCPKCGKVEAEIEPQDQQFV* |
JGI25385J37094_100585062 | 3300002558 | Grasslands Soil | MRCPNCGTLMNRHAEKAIKDPHTPEGEVIASIHYCPGCGKIEAEPEPPNDL* |
JGI25385J37094_101486841 | 3300002558 | Grasslands Soil | MNRHAEKAIKDPHTPEGEVIASIHYCPGCGKIEAEPEPPNDL* |
soilH1_102897991 | 3300003321 | Sugarcane Root And Bulk Soil | MNRHAEKLIKDSRAPEGEVLASIHYCPKCGKVEAELERQEE* |
Ga0063356_1001690652 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRCPSCGAPMNRHAEKSIKDPHVPEGEVIASIHYCPKCGKVEAELEGRINNSSPRE* |
Ga0063356_1003181392 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MHCPKCGTLMNRHAEKPLKTAAEETEVIASIHYCPACGKVEATIEP* |
Ga0063356_1009180402 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MHCPGCGTLMNRHAEKLVKDPHVPDGEVVASIYYCPKCGKVEAELEPQDQ* |
Ga0063356_1050418821 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MHCPSCGALMNRHAEKSIKDPNVPEGEVIASIYYCSQCGKVEAELERQDQ* |
Ga0066395_105397792 | 3300004633 | Tropical Forest Soil | MNRHAEKPVKDAHALEGEVIASVHYCPGCGKVEAEIESPDQ* |
Ga0066683_103421542 | 3300005172 | Soil | MNRHAEKAIKDPHTPEGDVIASIHYCPGCGKVEAEPEPPNDL* |
Ga0066673_102728982 | 3300005175 | Soil | MNRHAEKAIKDPHTPKGEVIASIHYCPGCGKIEAEPEPPNDL* |
Ga0066690_109246021 | 3300005177 | Soil | MRCPTCGTVMNRHAEKSVKDPHASEGEAIATIYYCPGCGKVEAEVEPHDP* |
Ga0066676_102638822 | 3300005186 | Soil | MRCPNCGTSMNRHAEKAIKDPHTPEGDVIASIHYCPGCGKIEAEPEPPNDL* |
Ga0070690_1011506822 | 3300005330 | Switchgrass Rhizosphere | MHCPNCGTPMNRHAEKPLKTAAEETEVIASIHYCPACGKVEATIEP* |
Ga0066388_1011655892 | 3300005332 | Tropical Forest Soil | MNRHAEKLIKDSHVPEGEVLASIHYCPKCGKVEAELERQDE* |
Ga0066388_1036910502 | 3300005332 | Tropical Forest Soil | MRCPSCGTLMNRHAEKPVKDPHAPEGEVIASIHYCPGCGKVEAVIELQDQ* |
Ga0066388_1059090822 | 3300005332 | Tropical Forest Soil | MNRHAEKTVKDPHTPEGEVIASIHYCPGCGKVEAEIESADQ* |
Ga0066388_1074494432 | 3300005332 | Tropical Forest Soil | MHCPICGALMNRHAEKPLKSSQASGGEFIASIYYCPQCGK |
Ga0066388_1078084892 | 3300005332 | Tropical Forest Soil | VNCPKCGAVMNHHAEKPVKTIRPEEVITAIYYCPACGKVEAAESA* |
Ga0070680_1008288261 | 3300005336 | Corn Rhizosphere | MAEKTLRCPNCGAAMNRHAEKPVKDPDVPEGEIIIVIYCCPHCGKVEAETAV* |
Ga0070669_1019325122 | 3300005353 | Switchgrass Rhizosphere | MRCPSCDTPMNRHAEKTIKDPHVGEGEGEVVASVYYCPECGKVEAELEREEK* |
Ga0070675_1006514852 | 3300005354 | Miscanthus Rhizosphere | MHCPNCGTPMNRHAEKPLKTAAEEAEVIASIHYCPACGKVEATIEP* |
Ga0066686_100187845 | 3300005446 | Soil | MRCPNCGTLMNRHAEKPIKDPHVPEGEVIASIHYCPRCGKVEAELEPLLNSEINFRE* |
Ga0066689_109000781 | 3300005447 | Soil | MRCPTCGTVMNRHAEKSVKDPHASEGEAIATIYYCPGCGKVEAKVEPQ* |
Ga0066682_104677543 | 3300005450 | Soil | MRCPNCGTLMNRHAEKAIKDPHTPKGEVIASIHYCPGCGK |
Ga0070681_111535032 | 3300005458 | Corn Rhizosphere | MNRHAEKTVKDPHTPEGEVIASIHYCPACGKVEAEIESTDQ* |
Ga0070679_1013556582 | 3300005530 | Corn Rhizosphere | MNRHAEKTVKDPHTPEGEVIASIHYCPACGKVEAEIESTDR* |
Ga0066701_107809382 | 3300005552 | Soil | MRCPNCGTLMNRHAEKPIKDPHVPEGEVIASIHYCPRCGKVEAELEPLLNSEIGVAHQNGTLRF |
Ga0066695_101114932 | 3300005553 | Soil | MRCPNCGTSMNRHAEKAIKDPHTPEGDVIASIHYCPGCGKVEAEPEPPNDL* |
Ga0066661_101610582 | 3300005554 | Soil | MRCPTCGTVMNRHAEKSVKDPHASEGEAMATIYYCPGCGKVEAEVEPHDP* |
Ga0066694_102187651 | 3300005574 | Soil | MNGHAEKAIKDPHTPEGEVIASIHYCPGCGKIEAEPEPPNDL* |
Ga0066691_101864071 | 3300005586 | Soil | CGTVMNRHAEKSVKDPHVSEGEAIATIYYCPGCGKVEAKVEPQ* |
Ga0066905_1007399661 | 3300005713 | Tropical Forest Soil | NRHAEKLVKDAHALEGEVIASIHYCPGCGKVEAEIESPDQ* |
Ga0066903_1009475312 | 3300005764 | Tropical Forest Soil | MRCPDCGTLMNRHAEKPIKDAHALEGEVVASIHYCPGCGKVEAEIESPEQ* |
Ga0066903_1082866782 | 3300005764 | Tropical Forest Soil | MRCPNCGTLMNRHAEKPVKDAHALEGEVIASIHYCPGCGKVEAEIESPDQ* |
Ga0066651_102496661 | 3300006031 | Soil | MRCPNCGTSMNRHAEKAIKDPHTPEGDVIASIHYCPGCGKVEAAPEPPNDL* |
Ga0066653_100802793 | 3300006791 | Soil | MRCPNCGTLMNGHAEKAIKDPHTPEGEVIASIHYCPGCGKIEAEPEPPNDL* |
Ga0066665_112397112 | 3300006796 | Soil | MNRHAEKTVKDAHALEGEVIASIHYCPGCGKVEAEIESPDQ* |
Ga0066659_101769182 | 3300006797 | Soil | MRCPNCGTVMNQHAEKSIKDAHSPEGEAIASIYYCPGCGKVEAEVEPHDR* |
Ga0066660_103305052 | 3300006800 | Soil | MRCPTCGTVMNRHAEKSVKDPHASEGEAIATIYYVPGCGKVEAEVEPHDP* |
Ga0075428_1017586472 | 3300006844 | Populus Rhizosphere | PMNRHAEKPLKTAAEEAEVIASIHYCPACGKVEATIEP* |
Ga0075421_1006416933 | 3300006845 | Populus Rhizosphere | MRCPNCGMLMNLHAEKPVKETDAPEGEIIASIHSCPGCGKVESELNPLHDK* |
Ga0075433_100666996 | 3300006852 | Populus Rhizosphere | MNRHAEKPIKDAHALEGEVIASIHYCPGCGKVEAEIESPEQ* |
Ga0075433_100869053 | 3300006852 | Populus Rhizosphere | MNRHAEKLIKDSHVPEGEVLASIHYCPKCGKVEAELERDDE* |
Ga0075425_10001275214 | 3300006854 | Populus Rhizosphere | MRCPSCGTLMNRHAEKLIKDSHVPEGEVLASIHYCPKCGKVEAELERHDE* |
Ga0075425_1002142752 | 3300006854 | Populus Rhizosphere | MRCPNCGTLMNRHAEKPIKDAHALEGEVIASIHYCPGCGKVEAEIESPEQ* |
Ga0075434_1000075988 | 3300006871 | Populus Rhizosphere | MRCPSCGTLMNRHAEKLIKDSHVPEGEVLASIHYCPKCGKVEAELERDDE* |
Ga0075424_1003778513 | 3300006904 | Populus Rhizosphere | MRCPHCGATMNRHAEKPVKEPHVPEGELIASIYYCPACGKVEAELERESTG* |
Ga0066710_1000247711 | 3300009012 | Grasslands Soil | MRCPNCGTLMNRHAEKPIKDPHVPEGEVIASIHYCPRCGKVEAELEPLLNSE |
Ga0066710_1000739372 | 3300009012 | Grasslands Soil | MRCPSCGTLMNRHAEKLIKDSHAPDGEVLASIHYCPKCGKVETEPERQDE |
Ga0066710_1001197075 | 3300009012 | Grasslands Soil | MNRHAEKAIKDPHVPEGEVIASIHYCPACGKVEAELERQDQ |
Ga0111539_104306272 | 3300009094 | Populus Rhizosphere | MNRHAEKPLKTAAEETEVIASIHYCPACGKVEATIEP* |
Ga0114129_100028577 | 3300009147 | Populus Rhizosphere | MRCPNCGTLMNRHAEKLIKDAHALEGEVVASIHYCPGCGKVEAEIESPEQ* |
Ga0114129_112969392 | 3300009147 | Populus Rhizosphere | MNRHAEKTIKDPHVGEGEVIASVYYCPNCGKVEAELEREEE* |
Ga0111538_112502141 | 3300009156 | Populus Rhizosphere | MNRHAEKPLKTAAEETEVIASIHYCPACGKVEATIE |
Ga0126374_102089213 | 3300009792 | Tropical Forest Soil | MRCPNCGTLMNRHAEKPVKDAHALEGEVIASIHYCPGCGKVEAEIESADQ* |
Ga0126374_105754602 | 3300009792 | Tropical Forest Soil | AEKPVKDAHALEGEVIASVHYCPGCGKVEAEIESPDQ* |
Ga0126380_104075732 | 3300010043 | Tropical Forest Soil | MNRHAEKPVKDTHAFEGEVIASIHYCPGCGKVESEIESPDQ* |
Ga0126380_105073551 | 3300010043 | Tropical Forest Soil | RHAEKPVKDAHALEGEVIAPIHYCPGCGKVEAEIESPDQ* |
Ga0126380_110083872 | 3300010043 | Tropical Forest Soil | MNRHAEKPVKDAHAPEGEVIASIHYCPGCGKVEAEIESPDQ* |
Ga0126384_102080473 | 3300010046 | Tropical Forest Soil | MHCPNCGTLMNRHAEKPVKDAHALEGEVIASIHYCPGCGKVEAEIESPDQ* |
Ga0126382_110650922 | 3300010047 | Tropical Forest Soil | MNRHAEKPLKDSRLPEGEVVTSIYYCPNCGKVEAEAEKTA* |
Ga0126382_112557301 | 3300010047 | Tropical Forest Soil | MRCPDCGTLMNRHAEKLIKDAHALEGEVVASIHYCPGCGIVEAEIESPEQ* |
Ga0126370_100743011 | 3300010358 | Tropical Forest Soil | MNRHAEKPVKDAHAPEGEVIASIHYCPGCGKVEAEI |
Ga0126370_114313722 | 3300010358 | Tropical Forest Soil | MHCPNCGTLMNRHAEKPVKDAHALEGEVIASVHYCPGCGKVEAEIESPDQ* |
Ga0126376_126878302 | 3300010359 | Tropical Forest Soil | MNRHAEKSVKDANAPEGEVLASIHYRPACGKVEAEIESPDQ* |
Ga0126372_110601142 | 3300010360 | Tropical Forest Soil | MNRHAEKPVKDAHALEGEVIASIHYCPGCGKVEAEIESPDQ* |
Ga0126377_113958342 | 3300010362 | Tropical Forest Soil | MRCPECGAPMNRHAEKPVKDSHVPEGEVIASIHFCPKCGKVEAEIEPPGER* |
Ga0126377_127761201 | 3300010362 | Tropical Forest Soil | MRCPNCGALMNRHAEKSVKDPHASEGEVITSIHYCPVCGKVEAEPEPEPNSPRSSQDGVPRHI* |
Ga0126379_133427332 | 3300010366 | Tropical Forest Soil | MRCPDCGTLMNRHAEKPIKDAHALEGEVVASIHYCPGCGKVEAEIESSEQ* |
Ga0126383_122368122 | 3300010398 | Tropical Forest Soil | MNRHAEKPVKDAHAPEGEVIATIHYCPGCGKVEAEIESTDQ* |
Ga0137363_100483642 | 3300012202 | Vadose Zone Soil | MRCPNCGTVMNRHAEKSVKDPHASEGEAIATIYYCPGCGKVEAEVEPHDP* |
Ga0137399_112995441 | 3300012203 | Vadose Zone Soil | MNRHAEKPIKDSRRPEGEVIASIYYCPDCGKVEAETEPAGDLQ |
Ga0137362_101246143 | 3300012205 | Vadose Zone Soil | MNRHAEKSVKDPHASEGEAIATIYYCPGCGKVEAEVEPHDP* |
Ga0137377_106275112 | 3300012211 | Vadose Zone Soil | MNRHAEKAIKDPHTPEGDVIASIHYCPGCGKVEAEPEPP |
Ga0157330_10438902 | 3300012514 | Soil | MRCPNCGTLMNRHAEKTVKDAHALEGEVIASIHYCPGCGKVEAETESPEQ* |
Ga0137359_102342552 | 3300012923 | Vadose Zone Soil | MNRHAEKSVKDPHASEGEAIATIYYCPGCGKVEAKVEPQ* |
Ga0126375_103557732 | 3300012948 | Tropical Forest Soil | MNCHAEKPVKDPHAPEGEVIASIYYCPSCGKVEAVIEKDGQESQPVRPEA* |
Ga0126375_105792332 | 3300012948 | Tropical Forest Soil | MRCPNCGTLMNRHAEKPVKDAHALEGEVIASVHYCPGCGKVEAEIESPDQ* |
Ga0163163_111685303 | 3300014325 | Switchgrass Rhizosphere | MNRHAEKPLKTAAEEAEVIASIHYCPGCGKVEATIEP* |
Ga0132258_100127238 | 3300015371 | Arabidopsis Rhizosphere | MNCPNCGALMNRHAEKPIKDPHAPDGEIIASIHYCPKCAKVEAEIDRKQ* |
Ga0132258_100468514 | 3300015371 | Arabidopsis Rhizosphere | MNRHAEKPLKDSHVPEGEIIASIHYCPKCGKVEAEIEPAGER* |
Ga0132258_109720822 | 3300015371 | Arabidopsis Rhizosphere | MYCPACGALMNWHAEKSIKDPQAPSGEVIASIHYCPECGKVEAEVEPQDQ* |
Ga0132258_114663892 | 3300015371 | Arabidopsis Rhizosphere | MRCPNCGTLMNRHAEKPIKDAHALEGEVVASIHYCPGCGKVEAEIESPEQ* |
Ga0132258_121302772 | 3300015371 | Arabidopsis Rhizosphere | MNKHAEKPVKGAHAPEGEVLASIHYCPGCGKVEVEIESPDQ* |
Ga0132257_1007967982 | 3300015373 | Arabidopsis Rhizosphere | MNRHAEKPIKHAHALEGEVVASIHYCPGCGKVEAEIESPEQ* |
Ga0132255_1003983272 | 3300015374 | Arabidopsis Rhizosphere | MRCPNCGTLMNRHAEKPVKDAHALEGEVIASIHYCPGCGKVEAEIQSPDQ* |
Ga0132255_1015160542 | 3300015374 | Arabidopsis Rhizosphere | MRCPNCGTLMNRHAEKPIKDAHAPEGEVVASIHYCPGCGKVEAEIESPEQ* |
Ga0132255_1024534772 | 3300015374 | Arabidopsis Rhizosphere | MRCPECGALMNRHAEKPLKDSHVPEGEIIASIHYCPKCGKVEAEIEPAGER* |
Ga0182041_112997891 | 3300016294 | Soil | MNRHAEKPVKDAHAPEGEVIASIHYCPGCGKVEAEIESPDQ |
Ga0182033_112173682 | 3300016319 | Soil | MNRHAEKPLKDAHALEGEVIASIHYCPGCGKVEAEIESPDHNSSRSWE |
Ga0066655_105915021 | 3300018431 | Grasslands Soil | MRCPNCGTLMNRHAEKAIKDPHTPEGEVIASIHYCPGCGKIEAEPEPPNDL |
Ga0066667_100226233 | 3300018433 | Grasslands Soil | MRCPNCGTLMNEHAEKAIKDPHTPEGEVIASIHYCPGCGKIEAEPEPPNDL |
Ga0210402_118105401 | 3300021478 | Soil | MICPQCGTLMNRHAEKPLKDPGSPEGEVLASIHYCPGCGKV |
Ga0126371_107734722 | 3300021560 | Tropical Forest Soil | MNRHAEKTVKDPHTPEGEVIASIHYCPGCGKVEAEIESADQ |
Ga0126371_133476652 | 3300021560 | Tropical Forest Soil | MNRHAEKPVKDAHALEGEVIASIHYCPGCGKVEAEIESPDQ |
Ga0126371_136272451 | 3300021560 | Tropical Forest Soil | MNRHAEKSVKDAHAPDGEVLASIHYCPACGKVEAEIESPDQ |
Ga0210138_10789212 | 3300025580 | Natural And Restored Wetlands | MNRHAEKPVKDVHALEGEVIASIHYCPGCGKVEAEIESPDQ |
Ga0207652_115744291 | 3300025921 | Corn Rhizosphere | MAEKTLRCPNCGAAMNRHAEKPVKDPDVPEGEIIIVIYCCPHCGKVEAETAV |
Ga0207651_116428271 | 3300025960 | Switchgrass Rhizosphere | MHCPKCGTLMNRHAEKPLKTAAEEAEVIASIHYCPACGKVEATIE |
Ga0207712_102895961 | 3300025961 | Switchgrass Rhizosphere | MRCPSCGAPMNRHAEKSIKDPHVPEGEVIASIHYCPKCGKVEAEL |
Ga0209468_11275822 | 3300026306 | Soil | MNRHAEKAIKDPHTPEGDVIASIHYCPGCGKVEAEPEPPNDL |
Ga0209470_10290601 | 3300026324 | Soil | MRCPNCGTLMNRHAEKAIKDPHTPKGEVIASIHYCPGCGKIEAEPEPPNDL |
Ga0209803_10325152 | 3300026332 | Soil | MNRHAEKAIKDPHTPEGEVIASIHYCPGCGKIEAEPEPPNDL |
Ga0209159_11353772 | 3300026343 | Soil | MRCPNCGTSMNRHAEKAIKDPHTPEGDVIASIHYCPGCGKVEAEPEPPNDL |
Ga0209465_102888572 | 3300027874 | Tropical Forest Soil | MNRHAEKPVKDAHALEGEVIASVHYCPGCGKVEAEIESPDQ |
Ga0170834_1011487782 | 3300031057 | Forest Soil | MRCPHCGGFMNRHAEKLIPDPLAPEGELIASIHYCPACGKIEAELETS |
Ga0170824_1066447153 | 3300031231 | Forest Soil | MHCPRCGAFMNCHAEKLIPDPLAPEGELITSIHSCPACGKVEAELETSMPQA |
Ga0170820_121692622 | 3300031446 | Forest Soil | MHCPRCGAVMNCHAEKLIPDPLAPEGELITSIHSCPACGKVEAELETSMPQA |
Ga0310813_102082202 | 3300031716 | Soil | MNCPNCGALMNRHAEKPIKDPHAPDGEIIASIHYCPKCGKVEAEIDRKQ |
Ga0307469_111111082 | 3300031720 | Hardwood Forest Soil | MRCPNCGTSMNPHAEKLIKNPQAPEGEVLASIHYCPGCGKVEAETESSD |
Ga0306926_118950872 | 3300031954 | Soil | MRCPNCGTLMNRHAEKPVKDAHALEGEVIASIHYCPACGKVEAEIESTDQ |
Ga0306920_1001015384 | 3300032261 | Soil | MRCPNCGTLMNRHAEKPVKDAHALEGEVIASIHYCPGCGKVEAEIESPDHNSSRSWE |
⦗Top⦘ |