Basic Information | |
---|---|
Family ID | F075939 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 118 |
Average Sequence Length | 44 residues |
Representative Sequence | MARAAVKAKQAQKAKAQPASKARARGRRKHAGGGNPNQQLFFV |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 118 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 61.74 % |
% of genes near scaffold ends (potentially truncated) | 96.61 % |
% of genes from short scaffolds (< 2000 bps) | 91.53 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (61.864 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (10.169 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.339 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.390 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.72% β-sheet: 0.00% Coil/Unstructured: 80.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 118 Family Scaffolds |
---|---|---|
PF00902 | TatC | 83.90 |
PF02416 | TatA_B_E | 5.93 |
PF00005 | ABC_tran | 4.24 |
PF00106 | adh_short | 0.85 |
PF01794 | Ferric_reduct | 0.85 |
PF13428 | TPR_14 | 0.85 |
PF07228 | SpoIIE | 0.85 |
PF01458 | SUFBD | 0.85 |
COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
---|---|---|---|
COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 83.90 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 5.93 |
COG0719 | Fe-S cluster assembly scaffold protein SufB | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 61.86 % |
Unclassified | root | N/A | 38.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459016|G1P06HT02H6SOW | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100741831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
3300003324|soilH2_10108271 | All Organisms → cellular organisms → Bacteria | 2307 | Open in IMG/M |
3300005179|Ga0066684_10771715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
3300005327|Ga0070658_10074734 | All Organisms → cellular organisms → Bacteria | 2779 | Open in IMG/M |
3300005330|Ga0070690_100944030 | Not Available | 677 | Open in IMG/M |
3300005332|Ga0066388_102966514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 867 | Open in IMG/M |
3300005332|Ga0066388_108053653 | Not Available | 527 | Open in IMG/M |
3300005435|Ga0070714_101420218 | Not Available | 678 | Open in IMG/M |
3300005439|Ga0070711_100928744 | Not Available | 744 | Open in IMG/M |
3300005445|Ga0070708_101546768 | Not Available | 618 | Open in IMG/M |
3300005556|Ga0066707_10618901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
3300005557|Ga0066704_10977081 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005559|Ga0066700_10783512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
3300005569|Ga0066705_10143821 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
3300005614|Ga0068856_101663598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
3300005718|Ga0068866_10213010 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300005764|Ga0066903_107194371 | Not Available | 576 | Open in IMG/M |
3300005841|Ga0068863_100433274 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300005893|Ga0075278_1042591 | Not Available | 670 | Open in IMG/M |
3300005894|Ga0075270_1034436 | Not Available | 705 | Open in IMG/M |
3300005897|Ga0075281_1033094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 766 | Open in IMG/M |
3300005901|Ga0075274_1005852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1439 | Open in IMG/M |
3300005903|Ga0075279_10069378 | Not Available | 615 | Open in IMG/M |
3300006032|Ga0066696_10281567 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300006034|Ga0066656_10497556 | Not Available | 795 | Open in IMG/M |
3300006791|Ga0066653_10168445 | Not Available | 1086 | Open in IMG/M |
3300006791|Ga0066653_10494925 | Not Available | 619 | Open in IMG/M |
3300006794|Ga0066658_10479525 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300006800|Ga0066660_10481522 | Not Available | 1042 | Open in IMG/M |
3300006806|Ga0079220_10191774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1171 | Open in IMG/M |
3300006806|Ga0079220_11635375 | Not Available | 560 | Open in IMG/M |
3300006953|Ga0074063_14030687 | Not Available | 630 | Open in IMG/M |
3300006954|Ga0079219_10464435 | Not Available | 870 | Open in IMG/M |
3300006954|Ga0079219_10981774 | Not Available | 697 | Open in IMG/M |
3300009617|Ga0116123_1035513 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
3300009700|Ga0116217_10412942 | Not Available | 855 | Open in IMG/M |
3300010043|Ga0126380_11251038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
3300010048|Ga0126373_12495854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300010152|Ga0126318_10255308 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300010301|Ga0134070_10296861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
3300010321|Ga0134067_10196657 | Not Available | 739 | Open in IMG/M |
3300010325|Ga0134064_10292943 | Not Available | 617 | Open in IMG/M |
3300010329|Ga0134111_10141304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
3300010333|Ga0134080_10429161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
3300010359|Ga0126376_11301039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
3300010366|Ga0126379_10536479 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300010376|Ga0126381_104814933 | Not Available | 519 | Open in IMG/M |
3300011269|Ga0137392_11232229 | Not Available | 607 | Open in IMG/M |
3300011271|Ga0137393_10859812 | Not Available | 774 | Open in IMG/M |
3300012201|Ga0137365_10183959 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
3300012201|Ga0137365_10444126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
3300012203|Ga0137399_11076325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
3300012210|Ga0137378_11355316 | Not Available | 626 | Open in IMG/M |
3300012361|Ga0137360_11566257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300012948|Ga0126375_10724414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 777 | Open in IMG/M |
3300012951|Ga0164300_10779131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
3300012955|Ga0164298_10193010 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300012955|Ga0164298_11048360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300012960|Ga0164301_10412794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 949 | Open in IMG/M |
3300012971|Ga0126369_10229449 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
3300012976|Ga0134076_10416989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
3300012984|Ga0164309_10139352 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
3300012985|Ga0164308_12226429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
3300013104|Ga0157370_11319577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
3300013105|Ga0157369_10600213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1136 | Open in IMG/M |
3300013765|Ga0120172_1141299 | Not Available | 573 | Open in IMG/M |
3300015373|Ga0132257_100866113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1131 | Open in IMG/M |
3300016404|Ga0182037_10764921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
3300017924|Ga0187820_1106690 | Not Available | 810 | Open in IMG/M |
3300017947|Ga0187785_10693464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300017974|Ga0187777_10291162 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300018061|Ga0184619_10393412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
3300018089|Ga0187774_10720045 | Not Available | 663 | Open in IMG/M |
3300018433|Ga0066667_10031699 | All Organisms → cellular organisms → Bacteria | 2980 | Open in IMG/M |
3300018433|Ga0066667_11104896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 686 | Open in IMG/M |
3300020070|Ga0206356_10946977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
3300021445|Ga0182009_10815567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300025906|Ga0207699_10932028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
3300025912|Ga0207707_11039790 | Not Available | 670 | Open in IMG/M |
3300025915|Ga0207693_11040370 | Not Available | 624 | Open in IMG/M |
3300025916|Ga0207663_10786626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
3300025921|Ga0207652_11872739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300025929|Ga0207664_11179790 | Not Available | 683 | Open in IMG/M |
3300026555|Ga0179593_1069542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4293 | Open in IMG/M |
3300027371|Ga0209418_1088303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
3300027568|Ga0208042_1137763 | Not Available | 613 | Open in IMG/M |
3300027706|Ga0209581_1014334 | All Organisms → cellular organisms → Bacteria | 4589 | Open in IMG/M |
3300027738|Ga0208989_10027476 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
3300027765|Ga0209073_10358785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
3300028556|Ga0265337_1115629 | Not Available | 728 | Open in IMG/M |
3300028666|Ga0265336_10080085 | Not Available | 974 | Open in IMG/M |
3300028666|Ga0265336_10104492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
3300028800|Ga0265338_10843353 | Not Available | 626 | Open in IMG/M |
3300028828|Ga0307312_10429717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
3300031249|Ga0265339_10336832 | Not Available | 713 | Open in IMG/M |
3300031250|Ga0265331_10230764 | Not Available | 831 | Open in IMG/M |
3300031344|Ga0265316_11226187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300031595|Ga0265313_10129133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1096 | Open in IMG/M |
3300031671|Ga0307372_10095277 | All Organisms → cellular organisms → Bacteria | 2411 | Open in IMG/M |
3300031716|Ga0310813_10447948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1120 | Open in IMG/M |
3300031890|Ga0306925_11247461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
3300031910|Ga0306923_12008191 | Not Available | 587 | Open in IMG/M |
3300031938|Ga0308175_102713104 | Not Available | 554 | Open in IMG/M |
3300031954|Ga0306926_11936624 | Not Available | 665 | Open in IMG/M |
3300032075|Ga0310890_10859806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
3300032160|Ga0311301_10692210 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300032174|Ga0307470_11331956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
3300032770|Ga0335085_10008597 | All Organisms → cellular organisms → Bacteria | 15559 | Open in IMG/M |
3300032770|Ga0335085_10405941 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
3300032892|Ga0335081_10497538 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
3300032893|Ga0335069_11253238 | Not Available | 809 | Open in IMG/M |
3300032897|Ga0335071_10473324 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300033004|Ga0335084_11199935 | Not Available | 758 | Open in IMG/M |
3300033803|Ga0314862_0199089 | Not Available | 500 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.78% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.78% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 6.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.08% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.08% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.08% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 4.24% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.39% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.54% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.69% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.69% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.69% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.69% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.69% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.85% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.85% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.85% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.85% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.85% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.85% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.85% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
3300005894 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 | Environmental | Open in IMG/M |
3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
3300005903 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2ZMR_00976180 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MARAAVKAKQQAKAKAAQPAKTRARGRRRHSGGGNPNQDLFFVRLRRHQKW |
INPhiseqgaiiFebDRAFT_1007418311 | 3300000364 | Soil | MARAAVKAKQQATAKDQATARARARGRRKHSGGGNPNQELFFMR |
soilH2_101082712 | 3300003324 | Sugarcane Root And Bulk Soil | MARAAVKAKQQAKAKAQPTKAARKRGRRGHSGGGNPNQDLFF |
Ga0062591_1007081941 | 3300004643 | Soil | MARAAVKAKQQARAKAQPAKAARTRGRRRHSGGGNPNQQLFFMKLRRGQKWLY |
Ga0066684_107717151 | 3300005179 | Soil | MARGAVKAKQAQKRGAQPAKAAPRRARGRRRHAGGGNPNQQLFFMRL |
Ga0070658_100747345 | 3300005327 | Corn Rhizosphere | MARAAVKAKQAERAKAAPAKARPHGRRKHAGGGNPNQQLFFMKLRRKAKWIYVLLAV |
Ga0070690_1009440301 | 3300005330 | Switchgrass Rhizosphere | MARAAVRAKQAQRAQAQAAANASRKQRKHASGGNPNQDLFF |
Ga0066388_1029665141 | 3300005332 | Tropical Forest Soil | MARAAVKAKQQATAKAQATARARERGRRKHSGGGNPNQELFFVRLR |
Ga0066388_1080536531 | 3300005332 | Tropical Forest Soil | MARAAVKAKQAQKAKAQPAQKRTRGRRKHAGGGNPNQQLFFVRMRR |
Ga0070714_1014202181 | 3300005435 | Agricultural Soil | MARAAVKAKQAQKAKAQPAPKARARGRRKHASGGNPNQQLFFVR |
Ga0070711_1009287442 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAVKAKQAQKAKAQPAPKTRARGRRKHASGGNPNQQLFFVRMRKRAK |
Ga0070708_1015467682 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAVKAKQQAKAKAAQSTKTRARGRRRHSGGGNPNQDLF |
Ga0070731_108206431 | 3300005538 | Surface Soil | VARAAVKAKQQQRAKAQPAKAARGRRRRGSGGGGHQNQQLFFMRLRRSAKWAYVVL |
Ga0066707_106189011 | 3300005556 | Soil | MARAAVKAKQQAAKAKAQPAKARARGRRRHSGGGNPNQQLFF |
Ga0066704_109770812 | 3300005557 | Soil | MARGAVKAKQVQKRGAQPAKAAPRARGRRRHAGGGNPNQQLF |
Ga0066700_107835122 | 3300005559 | Soil | MARAAVKAKQAQKKAAQPAKAAARRQGRRRHAAGGNPNQQLF |
Ga0066705_101438211 | 3300005569 | Soil | MARAAVKAKQAQKAKAQPAPKARARGRRRHAGGGNPNQ |
Ga0068856_1016635982 | 3300005614 | Corn Rhizosphere | MARGAVKAKQAQKRGAQPAKAAPRRTSGRRRHAGGGNPNQQLFFMRLRRQAK |
Ga0068866_102130103 | 3300005718 | Miscanthus Rhizosphere | MARAAVKAKQQAKKAAQPTKTRARGRRRHSGGGNPNQDLFFVRL |
Ga0066903_1071943712 | 3300005764 | Tropical Forest Soil | MARAAVKAKQQAKAKVQPAKPARSRGRRRHSGGGNPNQD |
Ga0068863_1004332741 | 3300005841 | Switchgrass Rhizosphere | MARAAVKAKQQAKKAAQPTKTRARGRRRHSGGGNPNQ |
Ga0075278_10425911 | 3300005893 | Rice Paddy Soil | MARAAVKAKQQAKAQATKPARPRGRRRHSGGGNPNQ |
Ga0075270_10344361 | 3300005894 | Rice Paddy Soil | MARAAVKAKQLQKAKTQPAKPPARRGRRKHAGGGNPNQQLFF |
Ga0075281_10330942 | 3300005897 | Rice Paddy Soil | MARAAVKAKQQAKAKVQPTKARARGRRRHSGGGNPNQ |
Ga0075274_10058523 | 3300005901 | Rice Paddy Soil | MARAAVKAKQQARAQAQPQTTRALKRRSGRKRHAGGGNPNQDLFFM |
Ga0075279_100693781 | 3300005903 | Rice Paddy Soil | MARAAVKAKQQARAKAQPRTPKHGGRRRGSGGGNPNQ |
Ga0066696_102815673 | 3300006032 | Soil | MARAAVKAKQQAKAQAQPAKARARGRRRHSGGGNPNQDLFFVRLR |
Ga0066656_104975562 | 3300006034 | Soil | MARAAVKAKQAEKAKAQTAKPVVRRQRRRGHSGGGNPNQQLFF |
Ga0066653_101684453 | 3300006791 | Soil | MARAAVKAKQQAQKQKKAAQPAPRRAGRRGHASGGNPNQALFFIRMRRKA |
Ga0066653_104949251 | 3300006791 | Soil | MARAAVKAKQAQKAKAQAQPAPKARSRGRRKHASGGNPNQQL |
Ga0066658_104795253 | 3300006794 | Soil | MARAAVKAKQAQKAKTAPAKARPHGRRRHASGGTPNQQL |
Ga0066660_104815223 | 3300006800 | Soil | MARAAVKAKQAQKAKAQPAPKARARGRRRHAGGGNPNQQLFSVRMRRRAKPMYFIL |
Ga0079220_101917741 | 3300006806 | Agricultural Soil | MARAAVKAKQAQKAKAQPAPKARARGRRKHASGGNPNQQLF |
Ga0079220_105853852 | 3300006806 | Agricultural Soil | MARAAVKAKQQQAKAKTQPSRARKRGRRGHSGGGNPNQDLFFVRLRRRQKW |
Ga0079220_116353752 | 3300006806 | Agricultural Soil | MARAAVKAKQAQKAQKAKASPAKAAPRRGRRRHAS |
Ga0074063_140306871 | 3300006953 | Soil | MARAAVKAKQAQAAQAQLAVKPSRKQRKHASGGNPN |
Ga0079219_104644351 | 3300006954 | Agricultural Soil | MARAAVKAKQQAKKATVAPQRARQQRGRRKHAGGG |
Ga0079219_109817741 | 3300006954 | Agricultural Soil | MARAAVKAKQAQRAKAPSPKQRQHGRRRHASGGNPNQDLF |
Ga0116123_10355131 | 3300009617 | Peatland | MARAAVKAKQAQRAKAQPAKPLARRGRRKHAGGGNPNQQLFFSRL |
Ga0116217_104129422 | 3300009700 | Peatlands Soil | MARAAVKAKQAQRAKAQPAPKARARGRRKHAGGGNPNQQLFFVRMR |
Ga0126380_112510382 | 3300010043 | Tropical Forest Soil | MARAAVKAKQQARAKAQPAKHARAHGRRRHSGGGNPNQELFFVKLRR |
Ga0126373_124958541 | 3300010048 | Tropical Forest Soil | MARAAVKAKQQAAAKAQPTKARARGRRKHAGGGNPNQELFFVKLRRHQK |
Ga0126318_102553081 | 3300010152 | Soil | MARAAVKAKQAERAKAAPAKARPHGRRKHAGGGNPNQQL |
Ga0134070_102968611 | 3300010301 | Grasslands Soil | MARAAVKAKQAQRAGAQPAKQAPRRGRRRRHSSGGNPNQQLFFMRLRRQAKFAYVLL |
Ga0134067_101966571 | 3300010321 | Grasslands Soil | MARAAVKAKQAQKAKSQPAPKARARGRRKHASGGNPNQQLFFVRMRKRAKPAYFILAF |
Ga0134064_102929431 | 3300010325 | Grasslands Soil | MARAAVKAKAKAKQPVKAAPRRGRRGHAGGGNPNQALFFNRLRRRAKWVYVLL |
Ga0134111_101413041 | 3300010329 | Grasslands Soil | MARAAVKAKRAQQAKTPTAKPVARRQRRRGHSGGGNPNQQLFFMRL |
Ga0134080_104291611 | 3300010333 | Grasslands Soil | MARAAVKAKQQATKAQASKARARGRRRHGSGGDPNQQ |
Ga0126376_113010391 | 3300010359 | Tropical Forest Soil | MARAAVKAKQAQRAKPAPPKRSAGRRRHAAGGNPNQQLFFMRLRR |
Ga0126379_105364793 | 3300010366 | Tropical Forest Soil | MARAAVKAKQQARAQAQVAKPSRARGRRRHSGGGNPNQDLFFTKLRRR |
Ga0126381_1048149331 | 3300010376 | Tropical Forest Soil | MARAAVKAKQAQKAKAQPAQKRTRGRRKHAVGGNPNQQLFFVR |
Ga0137392_112322292 | 3300011269 | Vadose Zone Soil | MARAAVKAKQAQKQKTPAKASRQGRRGHSSGGNPNQQLFFSRLRRK |
Ga0137393_108598122 | 3300011271 | Vadose Zone Soil | MARAAVKAKQQAKKNAAPPAKPARSGRRGHAAGGNPNQQLFFIRLRRK |
Ga0137365_101839594 | 3300012201 | Vadose Zone Soil | MARAAVKAKQQAKQKAQPKKAAPSRRGGGRRKHASGGNPNQQLFFMKLR |
Ga0137365_104441262 | 3300012201 | Vadose Zone Soil | MARAAVKAKQQAKQQAKRGAQPSKAVAARRGGGRRKHAAGGNPNQQLFFMRLRRRAKI |
Ga0137399_110763252 | 3300012203 | Vadose Zone Soil | MARGAVKAKQAQKRGAQPAKAAPRRARGRKRHAGGGNPNQQLFFMRLRRQAKPMYVILA |
Ga0137378_113553162 | 3300012210 | Vadose Zone Soil | MARAAVKAKQQAKAKAQPTKARARGRRRHSGGGNPNQEL |
Ga0137360_115662572 | 3300012361 | Vadose Zone Soil | MARAAVKAKQAQKKAAQPAKAAPRRQRGRRKHAGGGNPNQQLFFMRLRRKA |
Ga0126375_107244142 | 3300012948 | Tropical Forest Soil | MARAAVKAKQAQKAKAQAPAKQRQHGRRRHAAGGNPNQQLFF |
Ga0164300_107791311 | 3300012951 | Soil | MARGAVKAKQAQKRGAQPAKAAPRRATRGRKRHAGGGNPNQQLFFMRLRRQAK |
Ga0164298_101930101 | 3300012955 | Soil | MARAAVKAKQQAKAQAAQPAKKRAHGRRRHSGGGN |
Ga0164298_110483601 | 3300012955 | Soil | MARAAVKAKQAAHPKPKPHGRRKHAGGGNPNQQLFFVRMRRKAKPA |
Ga0164301_104127941 | 3300012960 | Soil | MARAAVKAKQQAKAKAAQPAKTRARGRRRHSGGGNPNQDLFFVR |
Ga0126369_102294494 | 3300012971 | Tropical Forest Soil | MARAAVKAKQQAKAQAQPAKARTRGRRRHSGGGNPNQELFFVRLRRH |
Ga0134076_104169893 | 3300012976 | Grasslands Soil | MARAAVKAKQAQKAKSQPAPKARARGRRKHASGGNPNQ |
Ga0164309_101393521 | 3300012984 | Soil | MARAAVKAKQQAKKAAQPSKTRARGRRRHSGGGNPNQDLFFVRLRR |
Ga0164308_122264292 | 3300012985 | Soil | MARGAVKAKQAQKRGAQPAKAAPRRASRGRKRHAGGGNP |
Ga0157370_113195771 | 3300013104 | Corn Rhizosphere | MARGAVKAKQAQAQKRGAQAAKTAPRRARGRRGHAGGGNPNQQLFFMRLRRQAKLMYVLL |
Ga0157369_106002131 | 3300013105 | Corn Rhizosphere | MARAAVKAKQAQRAKAAPAKARPHGRRRHSGGGNPNQQLFF |
Ga0120172_11412992 | 3300013765 | Permafrost | MARAAVKAKQAQKKAAQPAKAAPRRQGGRRKHAGGGNPNQQLCFM |
Ga0132257_1008661133 | 3300015373 | Arabidopsis Rhizosphere | MARAAVKAKQQAKKAAQPTKTRARGRRRHSGGGNPNQELFFVRLRRHQ |
Ga0182037_107649212 | 3300016404 | Soil | MARAAVKAKQQAAAKAQPPKSRARGRKRHGGGNPN |
Ga0187820_11066901 | 3300017924 | Freshwater Sediment | MARAAVKAKQAARQAQQAKAPSPKPRARGRRKHASGGNPNQQLFFVRMRRSAKPM |
Ga0187785_106934641 | 3300017947 | Tropical Peatland | MARAAVKAKQQAKASAQPAKTSRRSSRGRRHASGGNPNQQLFFTR |
Ga0187777_102911623 | 3300017974 | Tropical Peatland | MARAAVKAKQQAKAQAAKPARARGRRRHSGGGNPNQ |
Ga0184619_103934121 | 3300018061 | Groundwater Sediment | MARAAVKAKQQAAKQQAKRGAQSSKAVSARRSSGRRKHAAGGNPNQQLF |
Ga0187774_107200452 | 3300018089 | Tropical Peatland | MARAAVKAKQQAKASAQPAKTSRRGRRHASGGNPNQQLFFSRMRR |
Ga0066667_100316995 | 3300018433 | Grasslands Soil | MARAAVKAKQQAKAKAQPAKAVRGRRRRGHSGGGNPN |
Ga0066667_111048961 | 3300018433 | Grasslands Soil | GYSGRLMARAAVKAKQQAKAKAQPTKSARGRGRRRGHSGGGNPDQAV |
Ga0206356_109469772 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAVKAKQAERAKAAPPKARPHGRRRHAGGGNQ |
Ga0182009_108155672 | 3300021445 | Soil | MARAAVKAKQAQRAKAAPPKQRQHGRRRHAAGGNPNQDLFFIRI |
Ga0207699_109320281 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAVKAKQQAAAKAQPSKARGRGRRKHSGGGNPNQQLFF |
Ga0207707_110397901 | 3300025912 | Corn Rhizosphere | MARAAVKAKQQARAKAQQPTKARARGRRRHAGGGNPNQ |
Ga0207693_110403702 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAVKAKQAQQAKAQPPKARARGRRKHASGGNPNQQLFFVRM |
Ga0207663_107866262 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MARAAVKAKQQAKAKAAQPAKTRARGRRRHSGGGNPN |
Ga0207652_118727391 | 3300025921 | Corn Rhizosphere | MARGAVKAKQAQAQKRGAQAAKTAPRRARGRRGHAGGGNPNQQLFFMRLRRLAKLMY |
Ga0207664_111797902 | 3300025929 | Agricultural Soil | MARAAVKAKQAQRAKAAPPKQRQSGRRRHASGGNPNQ |
Ga0179593_10695421 | 3300026555 | Vadose Zone Soil | MARAAVKAKQAAQKKTAQPAKAPRRQGRRKHAAGGNPNQQLFFMRLR |
Ga0209418_10883032 | 3300027371 | Forest Soil | MARAAVKAKQQATAKAQAQARARERGRRKHSGGGNPNQQLFFMRLR |
Ga0208042_11377631 | 3300027568 | Peatlands Soil | MARAAVKAKQAQRAKAQPAPKARARGRRKHAGGGNPNQQLFFVRM |
Ga0209581_10143347 | 3300027706 | Surface Soil | VARAAVKAKQQAQAPQARPAKTARRRRRGGGNPNEQLFFMRL |
Ga0208989_100274764 | 3300027738 | Forest Soil | MARAAVKAKQAEKKTAQPAKAAARRQRRRGHSAGGNPNQQLFFMRLRRKAKLAYLVLA |
Ga0209073_103587851 | 3300027765 | Agricultural Soil | MARAAVKAKQQAKAKAQQPTKARARGRRRHAGGGNPNQELFFVK |
Ga0265337_11156291 | 3300028556 | Rhizosphere | MARAAVKAKQAQKAKTHPAQKARARGRRKHAGGGNPNQQLFFVRMRR |
Ga0265336_100800852 | 3300028666 | Rhizosphere | MARAAVKAKQAQRAKAQPAKSAVRRGRRKHSGGGNPNQQLF |
Ga0265336_101044922 | 3300028666 | Rhizosphere | MARAAVKAKQAQRAKTQPAKSAARRGRRKHSGGGNPNQQLFFSRL |
Ga0265338_108433531 | 3300028800 | Rhizosphere | MARAAVKAKQAQRAKAQPAKSAVRRGRRKHSGGGNPNQQLFF |
Ga0307312_104297172 | 3300028828 | Soil | MARAAVKAKQQAAKQQAKRGAQPSKAVSARRSGGRRKH |
Ga0265339_103368322 | 3300031249 | Rhizosphere | MARAAVKAKQSQRATAQQPSKQGGRRGGRRKHASGGNPNQQLFFSRLRRRAK |
Ga0265331_102307642 | 3300031250 | Rhizosphere | MARAAVKAKQAQRAAAKPKTPARARRHHKSGGNPTQQLFFERMRRKAKFVYFL |
Ga0265316_112261871 | 3300031344 | Rhizosphere | MARAAVKAKQAQAAQAQAAAKPSRKQRKHASGGNP |
Ga0265313_101291333 | 3300031595 | Rhizosphere | MARAAVKAKQAQKAKAQPASKARARGRRKHAGGGNPNQQLFFV |
Ga0307372_100952771 | 3300031671 | Soil | MARAAVKAKQAQAKKAQPGSGKSRAVSKGRRGHAAGGNPNQQLFFSRLRRKAKFAYLLLA |
Ga0310813_104479481 | 3300031716 | Soil | MARAAVKAKQAQRAKAAPPKQRQHGRRRHAAGGNPNQDLF |
Ga0306925_112474611 | 3300031890 | Soil | MARAAVKAKQQAAAKAQPAKARTRGRRRHSGGGNPNQ |
Ga0306923_120081911 | 3300031910 | Soil | MARAAVKAKQAQKAKAHPAPKPRARGRRKHASGGNPNQQLFFVRMRRKAKPM |
Ga0308175_1027131042 | 3300031938 | Soil | MARAAVKAKQAQKAKAQPQKARPHGRRRHASGGNPNQQL |
Ga0306926_119366242 | 3300031954 | Soil | MARAAVKAKQAQKAKAHPAPKPRARGRRKHASGGNPNQQLFFVRMRR |
Ga0310890_108598062 | 3300032075 | Soil | MARAAVKAKQQAKAKAAQPAKTRARGRRRHSGGGNPNQELF |
Ga0311301_106922104 | 3300032160 | Peatlands Soil | MARAAVKAKQAQRAKAQAAKPPARRGRRKHAGGGNPNQQLF |
Ga0307470_113319561 | 3300032174 | Hardwood Forest Soil | MARAAVKAKQQAQKQKQAAQPAPRRRGRRGHASGGNPNQQLFFIRLRRKAKPAYLVL |
Ga0335085_100085971 | 3300032770 | Soil | MARAAVKAKQQAKAQAQPAKPRRVRGRRRHSGGGNPNQDL |
Ga0335085_104059414 | 3300032770 | Soil | MARAAVKAKQAQKAKAQPQKAAPRRGRRKHAGGGNPNQQLFFVRMRR |
Ga0335081_104975381 | 3300032892 | Soil | MARAAVKAKQAQKAKAHPAPKPRTRGRRKHASGGNPNQQLFFV |
Ga0335069_112532382 | 3300032893 | Soil | MARAAVKAKQQQKASAKPTKAAARPRGRHHKSGGNPNQQLFFSRMRRKA |
Ga0335071_104733243 | 3300032897 | Soil | MARAAVKAKQQARAKAQPQQHALKRRHGRRRGASGGNPNQDL |
Ga0335084_111999352 | 3300033004 | Soil | MARAAVKAKQQAAAKAQPTKARGRGRRKHAGGGNP |
Ga0314862_0199089_3_143 | 3300033803 | Peatland | MARAAVKAKQQERAKAAQQAKPRTRARRSHASGGNPNQQLFFMRLRR |
⦗Top⦘ |