 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F075899 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MGVHGAPGQPDATLEEDGGAPKRGRGVQQHATYSILFESFIVNTGDL |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.54 % |
| % of genes near scaffold ends (potentially truncated) | 66.95 % |
| % of genes from short scaffolds (< 2000 bps) | 95.76 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.356 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.254 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.186 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.915 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.67% β-sheet: 0.00% Coil/Unstructured: 85.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF13655 | RVT_N | 2.54 |
| PF03400 | DDE_Tnp_IS1 | 1.69 |
| PF02201 | SWIB | 0.85 |
| PF00501 | AMP-binding | 0.85 |
| PF13565 | HTH_32 | 0.85 |
| PF00496 | SBP_bac_5 | 0.85 |
| PF00078 | RVT_1 | 0.85 |
| PF13358 | DDE_3 | 0.85 |
| PF00589 | Phage_integrase | 0.85 |
| PF02558 | ApbA | 0.85 |
| PF13683 | rve_3 | 0.85 |
| PF03050 | DDE_Tnp_IS66 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 1.69 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.85 |
| COG5531 | DNA-binding SWIB/MDM2 domain | Chromatin structure and dynamics [B] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.36 % |
| All Organisms | root | All Organisms | 18.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.08% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.24% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.54% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.85% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
| 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Host-Associated | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010106 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030634 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034675 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ARcpr5oldR_0039313 | 3300000041 | Arabidopsis Rhizosphere | MVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYTIPFESFVMNTGDL* |
| ARcpr5yngRDRAFT_0041402 | 3300000043 | Arabidopsis Rhizosphere | MVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYTIPFESFVMNTGDL*GIAREVESR* |
| JGI25390J43892_101063942 | 3300002911 | Grasslands Soil | MVAHGAPGQPDCTLEEDGGAPKRGWGVQQHATYSIPFESFIVNTGDL* |
| Ga0066396_101219901 | 3300004267 | Tropical Forest Soil | MGVYGAPGQPDFTLEEDRGAPERGRGVQQHATYSIQFESSLVNTGDL* |
| Ga0066397_101770851 | 3300004281 | Tropical Forest Soil | MGVYGAPGQPDFTLEEDRGAPERGRGVQQHATYSILFESSLVNTGDL* |
| Ga0066672_109644711 | 3300005167 | Soil | MVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESFIMNTGDL* |
| Ga0066683_100826444 | 3300005172 | Soil | MGAPGAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESYPVNTGEPARDAKDSGE* |
| Ga0066678_110329401 | 3300005181 | Soil | MGVHGAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESSTVNTGSFLKDVKGSGK* |
| Ga0065704_100061873 | 3300005289 | Switchgrass Rhizosphere | MVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYSIPFESFMMNTGDFLVDAKGSGE* |
| Ga0065705_101159383 | 3300005294 | Switchgrass Rhizosphere | MGVHGAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESSTVNTGSFLEDAKGSGE* |
| Ga0065705_108529691 | 3300005294 | Switchgrass Rhizosphere | MVAYGAPGQPDATLEEDGGAPERGRGVQQHATYSILLESFIVNTGDL* |
| Ga0065705_110823671 | 3300005294 | Switchgrass Rhizosphere | GQPDATLEEDGGAPERGWGVQQHATYSILFESFIVNTGDL* |
| Ga0065707_100481901 | 3300005295 | Switchgrass Rhizosphere | MVAYGAPGQPDATLEEDGGAPERGXGVQQHATYSILXESFIVNTGXL* |
| Ga0065707_103428433 | 3300005295 | Switchgrass Rhizosphere | MGAHGAPGQPDFTLEEDGGAPERGRGVQQHATYSIPFESCIVNTGDL* |
| Ga0065707_104720912 | 3300005295 | Switchgrass Rhizosphere | MGAHGAPGQPDSTLEEDGGAPERGRGVQQHATYSILFESSTVNTGSFLEDAKGSGE* |
| Ga0070690_1006483701 | 3300005330 | Switchgrass Rhizosphere | MGVYGAPGQPDSTLEEDGGAPKRGRGVQQHATYRILFESFIVNTGAL* |
| Ga0066388_1034203572 | 3300005332 | Tropical Forest Soil | MVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYSIPFESFMMNTGDFLLDAKGSGE* |
| Ga0066388_1079233321 | 3300005332 | Tropical Forest Soil | MGAHGAPGQPDFTLEEDGGAPKRGRGVQQHATYSILFESSFVNTGDL* |
| Ga0070705_1013901142 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MVGYWAPGQPDVTLEEDGGAPERGRGVQQHATYSIPFESFMMNTGDFLLDAKGSGE* |
| Ga0070708_1004021121 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAHGAPGQPDSTLEEDGGAPERGRGVQQHATYSILFESSTVNTGSFLKDVKGSGK* |
| Ga0066689_104233282 | 3300005447 | Soil | MGAHGAPGQPDSTLEEDGGAPKRGRGVQQHATYSILVESSLVNTGAL* |
| Ga0066681_107062951 | 3300005451 | Soil | MGAHGAPGQPEFTLEEDGGAPKRGWGVQQHATYSMLFESFMVNTGDL* |
| Ga0066687_105595961 | 3300005454 | Soil | MVVHGAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESFIMNTGDL* |
| Ga0070706_1002884911 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAHGAPGQPDATLEEDGGAPERGRGVQQHATYSILLESFIVNTGDL* |
| Ga0070697_1010071992 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAHGAPGQPDATLEEDGGAPERGRGVQQHATYSILLESFIVNTGDL*GMLREVESREARAQRN |
| Ga0058697_103766473 | 3300005562 | Agave | MVGYWAPGQPDTTLEEDGGAPERGRGVQQHATYSIPFESFM |
| Ga0066905_1006392102 | 3300005713 | Tropical Forest Soil | CLLHRMGAHGAPGQPDATLEEDGGAPKRGWGVQQHATYSILLESSLVNTGDL* |
| Ga0066905_1021527952 | 3300005713 | Tropical Forest Soil | MGVHGAPGQPDFTLEEDGGAPERGWGVQQHATYSIPFESCIVNMGDL* |
| Ga0068861_1019182861 | 3300005719 | Switchgrass Rhizosphere | MGAHGAPGQPDSTLEEDGGAPKRGWGVQQHATYSILLESFIVNT |
| Ga0066903_1019391282 | 3300005764 | Tropical Forest Soil | MGAHGAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESYTVNTGEPARDAKDSGE* |
| Ga0075417_104986682 | 3300006049 | Populus Rhizosphere | MGAHGAPGQPDSTLEEDGGAPERGRGVQQHATYSILSESYTVNTGEPARDAKDSGE* |
| Ga0075028_1002327012 | 3300006050 | Watersheds | MVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESFIMNTGAL* |
| Ga0075432_100795463 | 3300006058 | Populus Rhizosphere | MTLHRMVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATSSIPFESFMMNTGDFLVDAKGSGE* |
| Ga0066665_109126631 | 3300006796 | Soil | MGAHGAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESSTVN |
| Ga0075421_1019941241 | 3300006845 | Populus Rhizosphere | MGAHGAPGQPDATLEEDGGAPKRGWGVQQHATYSILLE |
| Ga0075430_1016312211 | 3300006846 | Populus Rhizosphere | LHRMGAHGAPGQPDSTLEEDGGAPERGRGVQQHATYSILSESYTVNTGEPARDAKDSGE* |
| Ga0075433_111677802 | 3300006852 | Populus Rhizosphere | MGAHGAPGQPDSTLEEDGGAPERGWGVQQHATYSILLESSTVNTGSFLEDAKGSGE* |
| Ga0075433_119559901 | 3300006852 | Populus Rhizosphere | MVGYWAPGQPESTLEEDGGAPKRGRGVQQHATYSILLESFIVN |
| Ga0075420_1009817132 | 3300006853 | Populus Rhizosphere | MGAHGAPGQPDFTLEEDGGAPKRGWGVQQHATYSIPLESFMMNTGDL* |
| Ga0075425_1027822322 | 3300006854 | Populus Rhizosphere | GAPGQPDSTLEEDGGAPKRGRGVQQHATYRILFESSTVNTGAL* |
| Ga0075424_1019935692 | 3300006904 | Populus Rhizosphere | MVGYWAPGQPESTLEEDGGAPKRGRGVQQHATYSILFESSIVN |
| Ga0099793_102836592 | 3300007258 | Vadose Zone Soil | FTLEEDGGAPKRGRGVQQHATYSILFESFIVNTGAR* |
| Ga0099795_106115002 | 3300007788 | Vadose Zone Soil | MVAYGAPGQPAFTLEEDGGAPKRGRGVQQHATYSILFESFIVN |
| Ga0099829_110907621 | 3300009038 | Vadose Zone Soil | MGAYGAPGQPALTLEEDGGAPKRGRGVQQHATYSILCESS |
| Ga0099827_102094081 | 3300009090 | Vadose Zone Soil | LHRMVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESFMMNTGDL* |
| Ga0099827_118967031 | 3300009090 | Vadose Zone Soil | CLLHRMGAPGAPGQPDSTLEEDGGAPKRGWGVQQHATYSMLLESFMMNTGDL* |
| Ga0111539_129447332 | 3300009094 | Populus Rhizosphere | MGAYGAPDQPDATLEEDGGAPERGRSVQQHATYSIPFESFIMNTGDFLWMRRG |
| Ga0099792_102037473 | 3300009143 | Vadose Zone Soil | APGQPDSTLEEDGGAPKRGRGVQQHATYSILFESFMMNTGDL* |
| Ga0114129_102037011 | 3300009147 | Populus Rhizosphere | QPDATLEEDGGAPERGRGVQQHATYSILLESAIVNTGDL* |
| Ga0075423_109966952 | 3300009162 | Populus Rhizosphere | MVAYGAPDQPDATLEEDGGAPERGRGVQQHATYSILLESFIVNPGDL* |
| Ga0105249_122195761 | 3300009553 | Switchgrass Rhizosphere | MGAHGAPGQPDATLEEDGGAPKRGWGVQQHATYSILLESFIVNTGD |
| Ga0126384_116056551 | 3300010046 | Tropical Forest Soil | MGVHGAPGQPDATLEEDGGAPKRGRGVQQHATYSILFESCIVNTG |
| Ga0126384_116756591 | 3300010046 | Tropical Forest Soil | MVDHWAPGQPDSTLEEDGGATKRGWGIQQHATYSIPFESFMVNTGDL |
| Ga0126382_116289341 | 3300010047 | Tropical Forest Soil | APGQPDATLEEDGGAPERGRGVQQHATYSILFESFIVNTGAL* |
| Ga0127492_10097821 | 3300010087 | Grasslands Soil | HRMGVHGAPGQPDFTLEEDGGAPKRGRGVQQHATYSILFASSLVNTGDL* |
| Ga0127473_11254241 | 3300010096 | Grasslands Soil | MVAHGAPGQPDSTLEEDGGAPKRGRGVQQHATYRILFE |
| Ga0127472_10301381 | 3300010106 | Grasslands Soil | RLHRMVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESFIMNTGDL* |
| Ga0127486_10995521 | 3300010128 | Grasslands Soil | VVHGAPGQPDATLEEDGGAPERGRGVQPHATYSLLLESFIVHTGDL* |
| Ga0134071_107251351 | 3300010336 | Grasslands Soil | MVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYSIL |
| Ga0126376_130358362 | 3300010359 | Tropical Forest Soil | RMGAHGAPGQPDSTLEEDGGAPERGRGAQQHATATMLFASYPVNTGEPARDAKDSGE* |
| Ga0134122_117722411 | 3300010400 | Terrestrial Soil | SRDSWLLHRMGAHEAPGQPDFTLEEDGRAPKRGRGVQQHATYSMLLESSTVNTGSFLKDVKGSGK* |
| Ga0137391_105065191 | 3300011270 | Vadose Zone Soil | MGAYGAPGQPDFTLEEDGGAPKRGRGVQQHATSSMLFES |
| Ga0137391_114963731 | 3300011270 | Vadose Zone Soil | MVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATSSMLFESFMMNT |
| Ga0137388_120427031 | 3300012189 | Vadose Zone Soil | MGAHGAPGQPDSTLEEDGGAPKRGRGVQQHATYSMLFESSTVNTGSFL |
| Ga0137383_103152892 | 3300012199 | Vadose Zone Soil | MGVHGAPGQPDSTLEEDGGAPKRGRGVQQHATYSMLFESSTVNTGSFLEDAK |
| Ga0137363_101047901 | 3300012202 | Vadose Zone Soil | MVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESFI |
| Ga0137380_107257791 | 3300012206 | Vadose Zone Soil | MGVHGAPGQPDSTLEEDGGAPKRGRGVQQHATYSM |
| Ga0137378_117162082 | 3300012210 | Vadose Zone Soil | MGAYGAPGQPDSTLEEDGGAPKRGRGVQQHATSSIPFESFMMNTGGFLLDAKG |
| Ga0137360_104699521 | 3300012361 | Vadose Zone Soil | APGQPDATLEEDGGAPKRGRGVQQHATYSILFESFIVNTGAR* |
| Ga0137390_113144751 | 3300012363 | Vadose Zone Soil | GAPGQPDATLEEDGGAPKRGRGIQQHATSTIPFESFIVNTGDL* |
| Ga0134060_10353621 | 3300012410 | Grasslands Soil | QPDFTLEEDGGAPKRGRGVQQHATYSIPFESFIVNTGAL* |
| Ga0157347_10386241 | 3300012502 | Arabidopsis Rhizosphere | HGATGQPDATLEEDGGAPERGRGVQQHATYSIPFESFIMNTGAL* |
| Ga0157315_10150761 | 3300012508 | Arabidopsis Rhizosphere | MVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYTIPFESFVM |
| Ga0137395_106150991 | 3300012917 | Vadose Zone Soil | MGAHGAPGQPDFTLEEDGGAPERGRGVQQHATYSIPFESFIVNT |
| Ga0137407_103979341 | 3300012930 | Vadose Zone Soil | HRMGVYGAPGQPDSTLEEDGGAPKRGRGVQQHATYSMLFESSLVNTGDL* |
| Ga0164302_115998921 | 3300012961 | Soil | PGQPDFTLEEDGGAPKRGRGVQQHATYSILFESFIVNTGDL* |
| Ga0126369_116445631 | 3300012971 | Tropical Forest Soil | RDSCLLHRMGAHGAPGQPDSTLEEDGGAPERGRGVQQHAAYSILFESATVNTGSFLKDVKGSGK* |
| Ga0134077_103233331 | 3300012972 | Grasslands Soil | MGASGAPGQPDSTLEEDGGAPKRGWGVQQHATYSILFESS |
| Ga0137403_102230881 | 3300015264 | Vadose Zone Soil | LEEDGGAPERGRGVQQHATYSMLFESFIVNTGDL* |
| Ga0182033_104669801 | 3300016319 | Soil | APCLLPRMGAHGAPGQPACTLEEDGGAPQRGRGVQQHATYSMPFESCIVNMGDL |
| Ga0182039_112817801 | 3300016422 | Soil | RMGAHGAPGPPDATLEEDGGAPERGRGVQQHATYSILLESFMVNTGDL |
| Ga0134069_13227991 | 3300017654 | Grasslands Soil | MGAHGAPGQPDSTLEEDGGAPERGRGVQQHATYRIPFESFLMNTGDFLL |
| Ga0190266_110269411 | 3300017965 | Soil | MGVHGAPGQPDATLEEDGGAPKRGRGVQQHATYSIPFESF |
| Ga0066667_104134522 | 3300018433 | Grasslands Soil | DPGLLPRMVAHGAPGPPDATLEEDGGAPERGRGVQQHATSSIPFESFMMNTGDFLLDAKGSGE |
| Ga0184646_14671332 | 3300019259 | Groundwater Sediment | TLEEDGGAPKRGRGVQQHATYTIPFESFMMNTGDL |
| Ga0180113_13190771 | 3300020065 | Groundwater Sediment | MGVHGAPGQPDFTLEEDGGAPKRGRGIQQHATYSILPESFLVNTGDL |
| Ga0126371_132260312 | 3300021560 | Tropical Forest Soil | CLLHRMGAHGAPGQPDSTLEEDGGAPERGRGVQQHAAYSMLLESSTVNTGSFLKDVKGSG |
| Ga0207684_113540931 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAHGAPGQPDSTLEEDGGAPERGRGVQQHATYSILFESSTVNTGSFLKDVKGSGK |
| Ga0207660_114627631 | 3300025917 | Corn Rhizosphere | MGVYGAPGQPDSTLEEDGGAPKRGRGVQQHATYRILFESFIVNTGAL |
| Ga0209877_10079792 | 3300027032 | Groundwater Sand | MGVHGAPGQPDATLEEDGGAPKRGRGVQQHATYSILFESFIVNTG |
| Ga0209886_10278791 | 3300027273 | Groundwater Sand | MGVHGAPGQPDATLEEDGGAPKRGRGVQQHATYSILFESFIVNTGDL |
| Ga0209899_10652051 | 3300027490 | Groundwater Sand | MVGYWAPGQPDSTLEEDGGAPKRGRGVQQHATYTIP |
| Ga0209843_10739641 | 3300027511 | Groundwater Sand | MVAHGAPGQPATTLEEDGGAPKRGRGVQQHATYTMLFESYLVNM |
| Ga0209481_100133812 | 3300027880 | Populus Rhizosphere | MGVYGAPGQPDSTLEEDGGAPKRGRGVQQHATYRILFESSTVNTGAL |
| Ga0209382_113616412 | 3300027909 | Populus Rhizosphere | MGAYGAPDQPDATLEEDGGAPERGRGVQQHATYSILLESFIVNPGDL |
| Ga0209069_104091641 | 3300027915 | Watersheds | AYGAPGQPDATLEEDGGVPKRGRGVQQHATYSMLFESFIVNTGDL |
| Ga0209859_10229681 | 3300027954 | Groundwater Sand | MGVHGAPGQPDATLEEDGGAPKRGRGVQQHATYSIPFESFMM |
| Ga0307312_110331672 | 3300028828 | Soil | AYGAPGQPDFTLEEDGGAPKRGRGVQQHATYSILFESSLVNTGAL |
| Ga0247636_103600591 | 3300030634 | Soil | VPRRDPCLLHRMVAHGAPGQPDSTLEEDGGAPKRGRGVQQHATYSILFESYTVNTGELAR |
| Ga0308198_10635681 | 3300030904 | Soil | PDFTLEEDGGAPKRGRGVQQHATYSILFESFIVNTGAR |
| Ga0308181_11231511 | 3300031099 | Soil | TLEEDGGAPKRGRGVQQHATYSILFESSLVNTGDL |
| Ga0318534_103861272 | 3300031544 | Soil | MVVYGAPGQPEATLEEDGGAPERGRGVQQHATYSILLESSSVNTGDL |
| Ga0318515_106250811 | 3300031572 | Soil | LPRMVVYGAPGQPEATLEEDGGAPERGRGVQQHATYSILLESFMVNTGDL |
| Ga0306917_112477301 | 3300031719 | Soil | DFTLEEDRGAPERGRGVQQHATYSILFESSLVNTGDL |
| Ga0318492_107946991 | 3300031748 | Soil | PEATLEEDGGAPERGRGVQQHATYSILLESFMVNTGDL |
| Ga0318548_103301172 | 3300031793 | Soil | VVYGAPGQPEATLEEDGGAPERGRGVQQHATYSILLESFMVNTGDL |
| Ga0318523_106703032 | 3300031798 | Soil | LHRMGVHGAPGQPDATLEEDGGAPERGRGVQQHATYSILLESFMVNTGDL |
| Ga0306919_114092921 | 3300031879 | Soil | MVVYGAPGQPEATLEEDGGAPERGRGVQQHATYSILFESSLVNTGDL |
| Ga0306923_115487541 | 3300031910 | Soil | STLEEDGGAPKRGRGVQQHATYSILLESSSVNTGDL |
| Ga0310916_104428562 | 3300031942 | Soil | MVVYGAPGQPEATLEEDGGAPERGRGVQQHATYSILLESFMVNTGDL |
| Ga0307414_113367281 | 3300032004 | Rhizosphere | MVAYGAPGQPDATLEEDGGAPERERGVQQHATYSILLESFIVNTGDL |
| Ga0310899_106437871 | 3300032017 | Soil | MGAHGAPGQPDFTLEEDGGAPKRGRGVQQHATYSIPFESFIMNTGSFLTGCEGEWRV |
| Ga0318577_105137521 | 3300032091 | Soil | MVSYWAPGQPDSTLEEDGGAPERGWGVQQHATYSILFESST |
| Ga0364929_0311703_373_537 | 3300034149 | Sediment | MGVHGAPGQPDSILEEDGGAPKRGRGVQQHATYSMLFESYPVNTGEPARDAKDSG |
| Ga0370545_133516_3_161 | 3300034643 | Soil | MGTYGAPGQPDSTLEEDGRAPKRGRGVQQHATYSIPFESFMMNTGGFLLDAKG |
| Ga0314781_108265_1_105 | 3300034660 | Soil | MVGYWAPGQPDFTLEEDGGAPKRGRGVQQHATYSI |
| Ga0314800_059429_2_157 | 3300034675 | Soil | MVGYWAPGQPDFTLEEDGGAPKRGRGVQQHATYSILLESSIVNTGSFLKDAK |
| Ga0370546_022691_724_843 | 3300034681 | Soil | QPESTLEEDGGAPKRGRGVQQHATYTIPFESFMMNTGDL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |