| Basic Information | |
|---|---|
| Family ID | F075876 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 44 residues |
| Representative Sequence | QDLRAIFSRFIDERQQASGGAPLTRQQKDELFGQFELWQKGQLR |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.54 % |
| % of genes near scaffold ends (potentially truncated) | 96.61 % |
| % of genes from short scaffolds (< 2000 bps) | 87.29 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.525 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.898 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.136 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.932 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF00496 | SBP_bac_5 | 70.34 |
| PF08240 | ADH_N | 2.54 |
| PF00375 | SDF | 2.54 |
| PF00072 | Response_reg | 0.85 |
| PF13380 | CoA_binding_2 | 0.85 |
| PF03934 | T2SSK | 0.85 |
| PF14559 | TPR_19 | 0.85 |
| PF13751 | DDE_Tnp_1_6 | 0.85 |
| PF02668 | TauD | 0.85 |
| PF00903 | Glyoxalase | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.85 |
| COG3156 | Type II secretory pathway, component PulK | Intracellular trafficking, secretion, and vesicular transport [U] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.53 % |
| Unclassified | root | N/A | 8.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS401BAWP6 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300000956|JGI10216J12902_108410738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300004091|Ga0062387_100078431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1702 | Open in IMG/M |
| 3300005181|Ga0066678_10289153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1070 | Open in IMG/M |
| 3300005332|Ga0066388_100197206 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
| 3300005332|Ga0066388_107070560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300005332|Ga0066388_107904522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300005439|Ga0070711_100338825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1206 | Open in IMG/M |
| 3300005568|Ga0066703_10332541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 915 | Open in IMG/M |
| 3300005885|Ga0075284_1050830 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300006800|Ga0066660_10999456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300006854|Ga0075425_103034322 | Not Available | 513 | Open in IMG/M |
| 3300009012|Ga0066710_103392062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300009012|Ga0066710_104106186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
| 3300009038|Ga0099829_10482550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1028 | Open in IMG/M |
| 3300010048|Ga0126373_10020993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5523 | Open in IMG/M |
| 3300010339|Ga0074046_10355752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 891 | Open in IMG/M |
| 3300010361|Ga0126378_10680548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1141 | Open in IMG/M |
| 3300010361|Ga0126378_10964207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 957 | Open in IMG/M |
| 3300010361|Ga0126378_11743147 | Not Available | 708 | Open in IMG/M |
| 3300010361|Ga0126378_11918370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300010361|Ga0126378_13452513 | Not Available | 501 | Open in IMG/M |
| 3300010376|Ga0126381_100351918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2037 | Open in IMG/M |
| 3300010376|Ga0126381_102910353 | Not Available | 682 | Open in IMG/M |
| 3300010376|Ga0126381_103857301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 585 | Open in IMG/M |
| 3300010376|Ga0126381_103935888 | Not Available | 579 | Open in IMG/M |
| 3300010376|Ga0126381_104160582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300010398|Ga0126383_10218863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1843 | Open in IMG/M |
| 3300010398|Ga0126383_11189636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 852 | Open in IMG/M |
| 3300011120|Ga0150983_16120255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300012200|Ga0137382_10998572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300012202|Ga0137363_11084209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300012209|Ga0137379_11024780 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300012211|Ga0137377_11013079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300012212|Ga0150985_100319053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300012361|Ga0137360_11255562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300012362|Ga0137361_10455060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1175 | Open in IMG/M |
| 3300012362|Ga0137361_10533126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1078 | Open in IMG/M |
| 3300012362|Ga0137361_11478657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300012363|Ga0137390_11596100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
| 3300012971|Ga0126369_10451702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1334 | Open in IMG/M |
| 3300016319|Ga0182033_10035503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3236 | Open in IMG/M |
| 3300016357|Ga0182032_11311618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 625 | Open in IMG/M |
| 3300016371|Ga0182034_11442211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300016371|Ga0182034_11449141 | Not Available | 601 | Open in IMG/M |
| 3300016371|Ga0182034_11493891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300016387|Ga0182040_10121013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1816 | Open in IMG/M |
| 3300016387|Ga0182040_11231990 | Not Available | 630 | Open in IMG/M |
| 3300016387|Ga0182040_11688322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300016404|Ga0182037_10288648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1314 | Open in IMG/M |
| 3300017966|Ga0187776_10087104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1838 | Open in IMG/M |
| 3300020580|Ga0210403_10018832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5514 | Open in IMG/M |
| 3300020580|Ga0210403_11524564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300020581|Ga0210399_10247755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1485 | Open in IMG/M |
| 3300021178|Ga0210408_10018781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5544 | Open in IMG/M |
| 3300021178|Ga0210408_10785451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300021401|Ga0210393_11053317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 657 | Open in IMG/M |
| 3300021404|Ga0210389_10433160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1034 | Open in IMG/M |
| 3300021405|Ga0210387_11179090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300021406|Ga0210386_11646782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300021420|Ga0210394_10628895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300022529|Ga0242668_1111562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300022715|Ga0242678_1046651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300025915|Ga0207693_10008963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8163 | Open in IMG/M |
| 3300025916|Ga0207663_10197067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1450 | Open in IMG/M |
| 3300025928|Ga0207700_10211062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1641 | Open in IMG/M |
| 3300026335|Ga0209804_1077547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1560 | Open in IMG/M |
| 3300027161|Ga0208368_105245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300027701|Ga0209447_10091172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 837 | Open in IMG/M |
| 3300027882|Ga0209590_10353257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300027884|Ga0209275_10023651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2773 | Open in IMG/M |
| 3300027903|Ga0209488_10741573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300028047|Ga0209526_10037629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3406 | Open in IMG/M |
| 3300028536|Ga0137415_10804819 | Not Available | 750 | Open in IMG/M |
| 3300030738|Ga0265462_12191743 | Not Available | 543 | Open in IMG/M |
| 3300030885|Ga0265743_119897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300030973|Ga0075395_11229983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300031446|Ga0170820_13827800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300031474|Ga0170818_110361606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300031572|Ga0318515_10008072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4553 | Open in IMG/M |
| 3300031572|Ga0318515_10122757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1374 | Open in IMG/M |
| 3300031668|Ga0318542_10766820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300031679|Ga0318561_10196623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1093 | Open in IMG/M |
| 3300031679|Ga0318561_10241247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 984 | Open in IMG/M |
| 3300031708|Ga0310686_119893524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 981 | Open in IMG/M |
| 3300031713|Ga0318496_10052907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2105 | Open in IMG/M |
| 3300031744|Ga0306918_10163498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1654 | Open in IMG/M |
| 3300031744|Ga0306918_10897449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300031744|Ga0306918_11350371 | Not Available | 547 | Open in IMG/M |
| 3300031765|Ga0318554_10157624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1290 | Open in IMG/M |
| 3300031768|Ga0318509_10355687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 820 | Open in IMG/M |
| 3300031768|Ga0318509_10573855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
| 3300031782|Ga0318552_10282682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300031846|Ga0318512_10294387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 806 | Open in IMG/M |
| 3300031859|Ga0318527_10348408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300031890|Ga0306925_12099426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300031896|Ga0318551_10675473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300031897|Ga0318520_10016719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3392 | Open in IMG/M |
| 3300031910|Ga0306923_10105399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3185 | Open in IMG/M |
| 3300031910|Ga0306923_11164184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
| 3300031912|Ga0306921_11731571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300031942|Ga0310916_10747150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
| 3300031945|Ga0310913_10365274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1022 | Open in IMG/M |
| 3300031946|Ga0310910_10501354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
| 3300031954|Ga0306926_10587982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1360 | Open in IMG/M |
| 3300031962|Ga0307479_12035145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300032001|Ga0306922_10088909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3252 | Open in IMG/M |
| 3300032010|Ga0318569_10093942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1349 | Open in IMG/M |
| 3300032035|Ga0310911_10490077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
| 3300032043|Ga0318556_10540583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300032055|Ga0318575_10203148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 995 | Open in IMG/M |
| 3300032060|Ga0318505_10299198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300032119|Ga0316051_1023517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
| 3300032261|Ga0306920_100350907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2195 | Open in IMG/M |
| 3300033289|Ga0310914_10473861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1133 | Open in IMG/M |
| 3300033289|Ga0310914_10520209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1076 | Open in IMG/M |
| 3300033289|Ga0310914_11561736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300033290|Ga0318519_10353466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 869 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.54% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.85% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300027161 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030885 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_06053040 | 2189573004 | Grass Soil | RSIFSRFIDERQQASGGAPLTPEQKNELFGQFELWQKGQTR |
| JGI10216J12902_1084107382 | 3300000956 | Soil | IFSRFIDERQQASGNAPLSADQKNELFGQFELWQRGQIR* |
| Ga0062387_1000784312 | 3300004091 | Bog Forest Soil | QDLRSIFSRFIDERQQASGGAPLTPEQKNELFGQFELWQKGQAR* |
| Ga0066678_102891532 | 3300005181 | Soil | PNLQDLKGIFSRFIDERQQATGGPPMTQQEKDQLFGQFEAWQKGRIR* |
| Ga0066388_1001972063 | 3300005332 | Tropical Forest Soil | IFSRFIDERQQASGGAPLSPEQKNELFGQFELWQKGQVR* |
| Ga0066388_1070705602 | 3300005332 | Tropical Forest Soil | LQDLRSIFSRFIDERQQASGGAPLTRQQKDELFGQFELWQKGQLR* |
| Ga0066388_1079045222 | 3300005332 | Tropical Forest Soil | TAPNLQDLKAIFSRFIDETQQATGGQALSQQQKDELFGQFERWQKGQLR* |
| Ga0070711_1003388251 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | QDLRSIFSRFIDERQQASGGPPLTPEQKNELFGQFELWQKGQTR* |
| Ga0066703_103325411 | 3300005568 | Soil | IFSRFIDERQQASGGSPLSPEQKNELFGQFELWQKGQVR* |
| Ga0075284_10508302 | 3300005885 | Rice Paddy Soil | ANAVSPQDLKAMFMRFIDERQQARGGAAMSQQQKDELFGQFEKWQSGESR* |
| Ga0066660_109994561 | 3300006800 | Soil | APNLQDLRSIFSRFIDERQQASGGAPLTPEQKNELFGQFELWQKGQVR* |
| Ga0075425_1030343221 | 3300006854 | Populus Rhizosphere | EDLKAIFFRFIDERQQAAGGPPLSRQDKEQLFGQFELWQKRQLP* |
| Ga0066710_1033920621 | 3300009012 | Grasslands Soil | AIFSRFIDERQQATGGAPMTQEEKDQLFGQFERWQRGQIR |
| Ga0066710_1041061862 | 3300009012 | Grasslands Soil | AQMAVAPTMENLKVMFLRFIDERQQASGGPPLSPEEKNQLFGQFELWQKGQVR |
| Ga0099829_104825501 | 3300009038 | Vadose Zone Soil | QDLRSIFSRFIDERQQASGGAPLTPEQKNELFGQFELWQKGQVR* |
| Ga0126373_100209931 | 3300010048 | Tropical Forest Soil | DLKAIFSRFIDERQKASGGLLLTQEQKDELFRQFQLWQGGQRR* |
| Ga0074046_103557521 | 3300010339 | Bog Forest Soil | AAAPNLQDLKSIFSRFIDERQQATGGQPMSQQEKDQLFGQFELWQKGQLR* |
| Ga0126378_106805481 | 3300010361 | Tropical Forest Soil | KAIFSRFIDERQKASGGLLLTQEQKDELFRQFQLWQGGQRQ* |
| Ga0126378_109642072 | 3300010361 | Tropical Forest Soil | KAIFSRFIDERQKASGGLLLTQEQKDELFRQFQLWQGGQRR* |
| Ga0126378_117431471 | 3300010361 | Tropical Forest Soil | VPQDLQAIFSHLIDKRPKATGGLLLTEQQKDELFRQFQLWQGGQRK* |
| Ga0126378_119183701 | 3300010361 | Tropical Forest Soil | IFSRFIDERQQASGGPPLTPQQKDELFGQFELWQKGQLR* |
| Ga0126378_134525131 | 3300010361 | Tropical Forest Soil | IFSRFIDERQQASGGAPLTRQQKDELFGQFELWQKGQLR* |
| Ga0126381_1003519184 | 3300010376 | Tropical Forest Soil | VQVAAAPLPQDLKAIFSRFIDERQKASGGLLLTQEQKDELFRQFQLWQGGQRR* |
| Ga0126381_1029103532 | 3300010376 | Tropical Forest Soil | QDLRAIFSRFIDERQQASGGAPLTRQQKDELFGQFELWQKGQLR* |
| Ga0126381_1038573011 | 3300010376 | Tropical Forest Soil | LRAIFSRFIDERQQASGGLPMTQQQKDELFGQFELWQKGQAR* |
| Ga0126381_1039358881 | 3300010376 | Tropical Forest Soil | VQVAAAPLPQDLKAIFSRFIDERQKASGGLLLTQEQKDELFKQFQLWQGGQRQ* |
| Ga0126381_1041605822 | 3300010376 | Tropical Forest Soil | ASTPNLQELRAIFSRFIDERQQASGGPALTPQQKDELFGQFELWQKGQLR* |
| Ga0126383_102188635 | 3300010398 | Tropical Forest Soil | AAPLPQDLKAIFSRFIDERQKASGGLLLTQEQKDELFKQFQLWQGGQRQ* |
| Ga0126383_111896362 | 3300010398 | Tropical Forest Soil | LQDLRAIFSRFIDERQQASGGAPLTTEQKNNLFNQFELWQKGQLR* |
| Ga0150983_161202552 | 3300011120 | Forest Soil | RSIFSRFIDERQQASGGPPLTPEQKNELFGQFELWQKGQTR* |
| Ga0137382_109985721 | 3300012200 | Vadose Zone Soil | IFSRFIDERQQATGGPPMTQQEKDQLFGQFEAWQRGRIR* |
| Ga0137363_110842092 | 3300012202 | Vadose Zone Soil | FSRFIDERQQASGGPPLSPEQKNELFGQFELWQKGQVR* |
| Ga0137379_110247802 | 3300012209 | Vadose Zone Soil | VAAAPNLQDLRSIFSRFIDERQQASGGAPLTPEQKNELFGQFELWQKGQVR* |
| Ga0137377_110130791 | 3300012211 | Vadose Zone Soil | RFIDERQQASGGPPLSPEQKNELFGQFELWQKGQVR* |
| Ga0150985_1003190532 | 3300012212 | Avena Fatua Rhizosphere | RSIFSRFIDERQQASGGAPLTPEQKNELFGQFELWQKGQVR* |
| Ga0137360_112555622 | 3300012361 | Vadose Zone Soil | IFSRFIDERQQATGGPPMTQQEKDQLFGQFEAWQRGRLR* |
| Ga0137361_104550601 | 3300012362 | Vadose Zone Soil | RFIDERQQASGGAPLTSDQKNELFGQFELWQKGQVR* |
| Ga0137361_105331262 | 3300012362 | Vadose Zone Soil | AIFSRFIDERQQASGGPPLSPEEKNQLFGQFELWQKGQVR* |
| Ga0137361_114786572 | 3300012362 | Vadose Zone Soil | DLRSIFARFIDERQQASGGAPLTPEQKNELFGQFELWQKGQVR* |
| Ga0137390_115961001 | 3300012363 | Vadose Zone Soil | IFSRFIDERQQASGGAPLTPEQKNELFGQFELWQKGQVR* |
| Ga0126369_104517022 | 3300012971 | Tropical Forest Soil | VPQDLQAIFSHFIDKRQKATGGLLLTEQQKDELFRQFQLWQGGQRK* |
| Ga0182033_100355031 | 3300016319 | Soil | LQDLKTIFSKFIDERQQAAGGQPMSQQEKDRLFGQFELWQKSQIR |
| Ga0182032_113116182 | 3300016357 | Soil | FSRFIDERQQASGGAPLTVEQKNELFGQFELWQKGQLH |
| Ga0182034_114422112 | 3300016371 | Soil | NLQDLKAIFSRFIDEREQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0182034_114491411 | 3300016371 | Soil | DDQDLKAIFARFIDERQQATGGTPLTQQQKDDLFGQFQQWEKGQIR |
| Ga0182034_114938912 | 3300016371 | Soil | AIFSRFIDERQQAAGGPPMTQQEKDQLFGQFETWQKQQIR |
| Ga0182040_101210133 | 3300016387 | Soil | IFSRFIDERQQAAGGEPMTQQEKDQLFGQFEAWQKRQIR |
| Ga0182040_112319902 | 3300016387 | Soil | SNLQDLKAIFSRFIDERQQATGGASLSQKDKDQLFGQFELWQKGQLR |
| Ga0182040_116883222 | 3300016387 | Soil | PPNLQDLKTIFSRFIDERQQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0182037_102886482 | 3300016404 | Soil | HFIDERQQATGGPPLTQQQKDELFGQFELWQKGVVR |
| Ga0187776_100871042 | 3300017966 | Tropical Peatland | ARFIDERQQATGGAPLTQKQKDELFGQFQQWQKGQLR |
| Ga0210403_100188321 | 3300020580 | Soil | SIFSRFIDERQQASGGPPLTPEQKNELFGQFELWQKGQAR |
| Ga0210403_115245642 | 3300020580 | Soil | APNLQDLRAIFSRFIDERQQASGGAPLSPEQKNELFGQFELWQKGQPR |
| Ga0210399_102477551 | 3300020581 | Soil | RFIDERQQASGGPPMTQQEKDQLFGQFELWQKRQIR |
| Ga0210408_100187816 | 3300021178 | Soil | AAPNLQDLRAIFARFIDERQQASGGPPLTPEQKNELFGQFELWQKSQLR |
| Ga0210408_107854511 | 3300021178 | Soil | LRSIFSRFIDERQQASGGPPLTPEQKNELFGQFELWQKGQAR |
| Ga0210393_110533172 | 3300021401 | Soil | VAAAPNLQDLRSIFSRFIDERQQASGGAPLSPEQKNELFGQFELWAKGQAR |
| Ga0210389_104331602 | 3300021404 | Soil | TAPNLQDLRSIFSRFIDERQQASGGPPLTPEQKNELFGQFELWQKGQTR |
| Ga0210387_111790901 | 3300021405 | Soil | FIDERQQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0210386_116467821 | 3300021406 | Soil | RSIFSRFIDERQQASGGPPLTPEQKNELFGQFELWQKGQTR |
| Ga0210394_106288952 | 3300021420 | Soil | NEQDLKSIFARFIDERQQATGGTPLTPQQKENLFGQFQQWEKGQAR |
| Ga0242668_11115622 | 3300022529 | Soil | LQDLRSIFSRFIDERQQASGGAPLSPEQKNELFGQFELWAKGQAR |
| Ga0242678_10466511 | 3300022715 | Soil | GAPTEDTLKAIFGRFIEERQQASGGAPLTQQEKNNLFSQFQQWEKGQGR |
| Ga0207693_100089631 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ATPNLQDLRSIFSRFIDELQQASGGPPLTPEQKNELFGQFELWQKGQTR |
| Ga0207663_101970672 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | NLQDLRSIFSRFIDERQQASGGPPLTPEQKNELFGQFELWQKGQTR |
| Ga0207700_102110622 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SRFIDERQQASGGPPLTPEQKNELFGQFELWQKGQTR |
| Ga0209804_10775473 | 3300026335 | Soil | MASAEVFDVSRFIDERQQASGGPPLTPEQKNELFGQFELWQKAQVR |
| Ga0208368_1052451 | 3300027161 | Forest Soil | QDLRSIFSRFIDERQQASGGPPLNPEQKNELFGQFELWQKGQTR |
| Ga0209447_100911722 | 3300027701 | Bog Forest Soil | PNETDLKSIFARFIDERQRVSGGTPLSQQQKDDLFGQFQRWEKTQSQ |
| Ga0209590_103532572 | 3300027882 | Vadose Zone Soil | QDLRATFSRFIDERQQASGGAPLTSDQTNELFGQFELWQKGQVR |
| Ga0209275_100236513 | 3300027884 | Soil | NLQDLRSIFSRFIDERQQASGGPPLTPEQKNELFGQFELWQKGQAR |
| Ga0209488_107415732 | 3300027903 | Vadose Zone Soil | QVAAAPNLQDLRSIFSRFIDERQQASGGAPLSPEQKNELFGQFELWQKGQTR |
| Ga0209526_100376291 | 3300028047 | Forest Soil | SIFSRFIDERQQASGGPPLTPEQKNELFGQFELWQKGQTR |
| Ga0137415_108048192 | 3300028536 | Vadose Zone Soil | APNLQDLRSIFSHFIDERQQASGGAPLTPEQKNELFGQFELWQKGQVR |
| Ga0265462_121917431 | 3300030738 | Soil | ARFIDERQQATGGTPLTQQQKDELFGQFQQWQKGKTQ |
| Ga0265743_1198971 | 3300030885 | Soil | SRFIDERQQASGGAPLSPEQKNELFGQFELWQKGQTR |
| Ga0075395_112299832 | 3300030973 | Soil | VAAAPNLQDLKLIFSRFIDERQQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0170820_138278002 | 3300031446 | Forest Soil | AIFSRFIDERQQASGGPALTPEQKNELFGQFELWAKGQAR |
| Ga0170818_1103616061 | 3300031474 | Forest Soil | IFSRFIDERQQASGGPALTPEQKNELFGQFELWAKGQAR |
| Ga0318515_100080724 | 3300031572 | Soil | APPNLQDLKTIFSRFIDERQQAAGGQPMTQQEKDQLFGQFELWQKNQIR |
| Ga0318515_101227572 | 3300031572 | Soil | LQDLKAIFSRFIDERQQAAGGQAMTQQEKDQLFGQFELWQKRQIR |
| Ga0318542_107668201 | 3300031668 | Soil | PNPQDLRSIFSRFIDERQQASGGTPLTADQKNELFGQFELWQKGQVH |
| Ga0318561_101966232 | 3300031679 | Soil | SHFIDERQQASGGTPLTADQKNELFGQFELWQKGQVH |
| Ga0318561_102412472 | 3300031679 | Soil | IFSRFIDERQQAAGGQPMTQQEKDQLFGQFELWQKSQIR |
| Ga0310686_1198935242 | 3300031708 | Soil | VSSQPNEQDLKSIFARFIDERQQATGATPLTQQQKDQLFGQFQQWQKGQAR |
| Ga0318496_100529071 | 3300031713 | Soil | TIFSRFIDERQQAAGGQAMTQQEKDQLFGQFELWQKRQIR |
| Ga0306918_101634982 | 3300031744 | Soil | PNPQDLRSIFSHFIDERQQASGGTPLTADQKNELFGQFELWQKGQVH |
| Ga0306918_108974491 | 3300031744 | Soil | RFIDERQQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0306918_113503712 | 3300031744 | Soil | KAIFSRFIDERQQATGGAPLSQKDRDQLFGQFELWKKGQLR |
| Ga0318554_101576241 | 3300031765 | Soil | NMQDLRAIFSRFIDERQQASGGPPLTQQQKDELFGQFELWQKGQLR |
| Ga0318509_103556871 | 3300031768 | Soil | PNLQDLKAIFSRFIDEREQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0318509_105738552 | 3300031768 | Soil | APNLQDLKAIFSRYIDERQQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0318552_102826821 | 3300031782 | Soil | DLRAIFSRFIDERQQASGGAPLTVEQKNELFGQFELWQKGQLH |
| Ga0318512_102943871 | 3300031846 | Soil | LKTIFSRFVDERQQATGGLPMTQQEKDQLFGQFEAWQKGQIR |
| Ga0318527_103484081 | 3300031859 | Soil | FIDERQQAAGGEPMTQQEKDQLFGQFEAWQKRQIR |
| Ga0306925_120994262 | 3300031890 | Soil | SPNLQDLKAIFSKFIDERQQAAGGPPLTQQEKDQLFGQFEAWQKSQAR |
| Ga0318551_106754732 | 3300031896 | Soil | FSRFIEERQQAAGGQPMTEQEKDQLFGQFELWQKRQIR |
| Ga0318520_100167194 | 3300031897 | Soil | ASTPNLQDLRAIFSRFIDERQQASGGTPLTRQQKDELFGQFDLWQKGQLR |
| Ga0306923_101053993 | 3300031910 | Soil | IFSKFIDERQQAAGGQPMSQQEKDRLFGQFELWQKSQVR |
| Ga0306923_111641842 | 3300031910 | Soil | PNLQDLKAIFSHFIDERQQATGGPPLTQQQKDELFGQFELWQKGVVR |
| Ga0306921_117315712 | 3300031912 | Soil | PNLQDLKTIFSRFVDERQQATGGLPMSQQEKDQLFGQFEAWQKGQIR |
| Ga0310916_107471502 | 3300031942 | Soil | NLQDLKTIFSRFIDERQQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0310913_103652742 | 3300031945 | Soil | PQDLRSIFSRFIDERQQASGGTPLTADQKNELFGQFELWQKGQVH |
| Ga0310910_105013542 | 3300031946 | Soil | AAAPNLQDLKAIFSHFIDERQQATGGPPLTQQQKDELFGQFELWQKGVVR |
| Ga0306926_105879822 | 3300031954 | Soil | TIFSRFIDERQQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0307479_120351452 | 3300031962 | Hardwood Forest Soil | IFSRFIDERQQASGGPPLTPEQKNELFGQFELWQKGQAR |
| Ga0306922_100889099 | 3300032001 | Soil | TSNLQDLKAIFSRFIDERQQATGGASLSQKDKDQLFGQFELWQKGQLR |
| Ga0318569_100939421 | 3300032010 | Soil | AAAPPNLQDLKTIFSRFIDERQQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0310911_104900771 | 3300032035 | Soil | DLKTIFSRFIDERQQAAGGQAMTQQEKDQLFGQFELWQKRQIR |
| Ga0318556_105405831 | 3300032043 | Soil | ASTPNLQDLRAIFSRFIDERQQASGGAPLTRQQKDELFGQFDLWQKGQLR |
| Ga0318575_102031481 | 3300032055 | Soil | LTTIFSRFIDERQQAAGGQAMTQQEKDQLFGQFELWQKRQIR |
| Ga0318505_102991981 | 3300032060 | Soil | LQDLKTIFSRFIDERQQAAGGQPMTQQEKDQLFGQFELWQKSQIR |
| Ga0316051_10235172 | 3300032119 | Soil | FARFIDERQQATGGAPLTQQQKDELFGQFQQWQKGQVR |
| Ga0306920_1003509073 | 3300032261 | Soil | ARFVDERQQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0310914_104738612 | 3300033289 | Soil | IFTRFIDERQQAAGGEPMTQQEKDQLFGQFEAWQKRQIR |
| Ga0310914_105202092 | 3300033289 | Soil | AATPNLQDLKTIFSKFIDERQQAAGGQPMSQQEKDRLFGQFELWQKSQIR |
| Ga0310914_115617362 | 3300033289 | Soil | LQDLKTIFSRFIDERQQAAGGQPMTQQEKDQLFGQFELWQKRQIR |
| Ga0318519_103534661 | 3300033290 | Soil | QDLKAIFSRFIEERQQAAGGQPMTEQEKDQLFGQFELWQKRQIR |
| ⦗Top⦘ |