| Basic Information | |
|---|---|
| Family ID | F075822 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.51 % |
| % of genes near scaffold ends (potentially truncated) | 40.68 % |
| % of genes from short scaffolds (< 2000 bps) | 88.14 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.458 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.949 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.203 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.763 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 65.38% β-sheet: 0.00% Coil/Unstructured: 34.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 41.53 |
| PF13432 | TPR_16 | 16.95 |
| PF13424 | TPR_12 | 10.17 |
| PF00581 | Rhodanese | 6.78 |
| PF07721 | TPR_4 | 2.54 |
| PF05544 | Pro_racemase | 1.69 |
| PF13977 | TetR_C_6 | 1.69 |
| PF13560 | HTH_31 | 1.69 |
| PF02274 | ADI | 1.69 |
| PF16177 | ACAS_N | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 1.69 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 1.69 |
| COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 1.69 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 1.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.46 % |
| Unclassified | root | N/A | 2.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_10641818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300003267|soilL1_10038942 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300003321|soilH1_10199013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1025 | Open in IMG/M |
| 3300003323|rootH1_10117633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1640 | Open in IMG/M |
| 3300003987|Ga0055471_10297121 | Not Available | 517 | Open in IMG/M |
| 3300004114|Ga0062593_102741429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300004114|Ga0062593_102865878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300004157|Ga0062590_101772871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 632 | Open in IMG/M |
| 3300004463|Ga0063356_105070789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300004479|Ga0062595_100139334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1386 | Open in IMG/M |
| 3300004479|Ga0062595_100383188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300004480|Ga0062592_100536317 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300004785|Ga0058858_1410794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300004798|Ga0058859_11699066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300004803|Ga0058862_12808439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300005294|Ga0065705_10356914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 933 | Open in IMG/M |
| 3300005329|Ga0070683_100092814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2835 | Open in IMG/M |
| 3300005329|Ga0070683_101974737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300005331|Ga0070670_100234906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1596 | Open in IMG/M |
| 3300005332|Ga0066388_100307405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2231 | Open in IMG/M |
| 3300005338|Ga0068868_100332945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1296 | Open in IMG/M |
| 3300005338|Ga0068868_101371153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300005339|Ga0070660_100996174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300005344|Ga0070661_100385278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1106 | Open in IMG/M |
| 3300005353|Ga0070669_101490421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300005366|Ga0070659_100648900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300005438|Ga0070701_10025190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2886 | Open in IMG/M |
| 3300005441|Ga0070700_100024152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3565 | Open in IMG/M |
| 3300005444|Ga0070694_100486841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
| 3300005459|Ga0068867_100969718 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300005471|Ga0070698_101359113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300005530|Ga0070679_101471603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300005547|Ga0070693_101579389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300005615|Ga0070702_100322072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1078 | Open in IMG/M |
| 3300005617|Ga0068859_102993232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300006844|Ga0075428_100180032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2289 | Open in IMG/M |
| 3300006881|Ga0068865_100339602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1213 | Open in IMG/M |
| 3300009098|Ga0105245_10888115 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300009147|Ga0114129_12178430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300009553|Ga0105249_10764305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
| 3300009789|Ga0126307_10001432 | All Organisms → cellular organisms → Bacteria | 15749 | Open in IMG/M |
| 3300010044|Ga0126310_11180203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
| 3300010371|Ga0134125_11386644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
| 3300010396|Ga0134126_12049185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300010399|Ga0134127_11964964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300010400|Ga0134122_10855486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
| 3300010403|Ga0134123_10454751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1191 | Open in IMG/M |
| 3300011332|Ga0126317_10181353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1046 | Open in IMG/M |
| 3300011332|Ga0126317_10458405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300012212|Ga0150985_122965273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300012373|Ga0134042_1166422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300012912|Ga0157306_10072122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 931 | Open in IMG/M |
| 3300013096|Ga0157307_1056546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 747 | Open in IMG/M |
| 3300013100|Ga0157373_10692522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300013296|Ga0157374_12278711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300013296|Ga0157374_12709449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300013297|Ga0157378_11273748 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300014254|Ga0075312_1015774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1294 | Open in IMG/M |
| 3300014325|Ga0163163_10342369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1551 | Open in IMG/M |
| 3300015077|Ga0173483_10034401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1864 | Open in IMG/M |
| 3300015200|Ga0173480_10743152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300017965|Ga0190266_10003214 | All Organisms → cellular organisms → Bacteria | 3413 | Open in IMG/M |
| 3300018067|Ga0184611_1273619 | Not Available | 592 | Open in IMG/M |
| 3300018469|Ga0190270_11822834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
| 3300019259|Ga0184646_1602060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 798 | Open in IMG/M |
| 3300019269|Ga0184644_1281501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1296 | Open in IMG/M |
| 3300019356|Ga0173481_10013762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2342 | Open in IMG/M |
| 3300019361|Ga0173482_10103550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1037 | Open in IMG/M |
| 3300019361|Ga0173482_10241885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
| 3300019362|Ga0173479_10058649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
| 3300019876|Ga0193703_1047394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300020005|Ga0193697_1002216 | All Organisms → cellular organisms → Bacteria | 5205 | Open in IMG/M |
| 3300020078|Ga0206352_10337985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| 3300020080|Ga0206350_10569963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300020082|Ga0206353_11177056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300021510|Ga0222621_1027009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
| 3300022756|Ga0222622_10102011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1766 | Open in IMG/M |
| 3300022898|Ga0247745_1034167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300023071|Ga0247752_1020315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 944 | Open in IMG/M |
| 3300025559|Ga0210087_1056463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 784 | Open in IMG/M |
| 3300025899|Ga0207642_11089014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300025901|Ga0207688_10068933 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300025910|Ga0207684_11265640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300025918|Ga0207662_10584412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300025920|Ga0207649_10599315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 847 | Open in IMG/M |
| 3300025923|Ga0207681_10558700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 943 | Open in IMG/M |
| 3300025926|Ga0207659_11025327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
| 3300025927|Ga0207687_10828929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300025932|Ga0207690_11856206 | Not Available | 503 | Open in IMG/M |
| 3300025934|Ga0207686_10583427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
| 3300025934|Ga0207686_10854654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
| 3300026116|Ga0207674_11029532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300026118|Ga0207675_100478623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1237 | Open in IMG/M |
| 3300027717|Ga0209998_10010678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1902 | Open in IMG/M |
| 3300027907|Ga0207428_10009317 | All Organisms → cellular organisms → Bacteria | 8808 | Open in IMG/M |
| 3300028589|Ga0247818_11313074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300028722|Ga0307319_10011078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2746 | Open in IMG/M |
| 3300028796|Ga0307287_10074256 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300028814|Ga0307302_10564902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300028875|Ga0307289_10139015 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300028880|Ga0307300_10007636 | All Organisms → cellular organisms → Bacteria | 2734 | Open in IMG/M |
| 3300028885|Ga0307304_10330543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
| 3300030552|Ga0247654_1008685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1021 | Open in IMG/M |
| 3300030905|Ga0308200_1011916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| 3300031125|Ga0308182_1010694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
| 3300031548|Ga0307408_100226860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1527 | Open in IMG/M |
| 3300031731|Ga0307405_10015154 | All Organisms → cellular organisms → Bacteria | 4166 | Open in IMG/M |
| 3300031824|Ga0307413_10656476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
| 3300031911|Ga0307412_10402174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1115 | Open in IMG/M |
| 3300031943|Ga0310885_10059563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1616 | Open in IMG/M |
| 3300032012|Ga0310902_10370150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
| 3300032075|Ga0310890_10108926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1754 | Open in IMG/M |
| 3300032180|Ga0307471_101087200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300034661|Ga0314782_053997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
| 3300034662|Ga0314783_037534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 865 | Open in IMG/M |
| 3300034667|Ga0314792_138863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300034669|Ga0314794_060417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 737 | Open in IMG/M |
| 3300034677|Ga0314802_009755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 859 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.08% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.24% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.39% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.39% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.54% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 2.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.54% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.69% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.69% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.69% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.69% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.85% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003323 | Sugarcane root Sample H1 | Host-Associated | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030552 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030905 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034677 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_106418181 | 3300000890 | Soil | MLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLG |
| soilL1_100389424 | 3300003267 | Sugarcane Root And Bulk Soil | MLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL* |
| soilH1_101990133 | 3300003321 | Sugarcane Root And Bulk Soil | MLEFRVEGFAAREPEFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL* |
| rootH1_101176332 | 3300003323 | Sugarcane Root And Bulk Soil | MLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGASGLIVAQLL* |
| Ga0055471_102971211 | 3300003987 | Natural And Restored Wetlands | MLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAALWLGAAGLIAAQLL* |
| Ga0062593_1027414291 | 3300004114 | Soil | MLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL* |
| Ga0062593_1028658781 | 3300004114 | Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0062590_1017728712 | 3300004157 | Soil | MLEFCVEVMRRASRDFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL* |
| Ga0063356_1050707891 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL* |
| Ga0062595_1001393343 | 3300004479 | Soil | VEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0062595_1003831882 | 3300004479 | Soil | MLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF* |
| Ga0062592_1005363173 | 3300004480 | Soil | LRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL* |
| Ga0058858_14107941 | 3300004785 | Host-Associated | MLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0058859_116990661 | 3300004798 | Host-Associated | MLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0058862_128084391 | 3300004803 | Host-Associated | MLEFCVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAAAMIAAQLL |
| Ga0065705_103569141 | 3300005294 | Switchgrass Rhizosphere | EFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL* |
| Ga0070683_1000928144 | 3300005329 | Corn Rhizosphere | MLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0070683_1019747371 | 3300005329 | Corn Rhizosphere | LRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL* |
| Ga0070670_1002349061 | 3300005331 | Switchgrass Rhizosphere | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAAAMIAAQLL* |
| Ga0066388_1003074053 | 3300005332 | Tropical Forest Soil | MLQFRGEVMRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAALIAAQLL* |
| Ga0068868_1003329453 | 3300005338 | Miscanthus Rhizosphere | RRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF* |
| Ga0068868_1013711531 | 3300005338 | Miscanthus Rhizosphere | RVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL* |
| Ga0070660_1009961742 | 3300005339 | Corn Rhizosphere | MLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0070661_1003852783 | 3300005344 | Corn Rhizosphere | LRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0070669_1014904211 | 3300005353 | Switchgrass Rhizosphere | MLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL* |
| Ga0070659_1006489002 | 3300005366 | Corn Rhizosphere | MLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL* |
| Ga0070701_100251903 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0070700_1000241522 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL* |
| Ga0070694_1004868411 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEFCVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL* |
| Ga0068867_1009697182 | 3300005459 | Miscanthus Rhizosphere | MLEFCVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF* |
| Ga0070698_1013591132 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF* |
| Ga0070679_1014716032 | 3300005530 | Corn Rhizosphere | FRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAAAMIAAQLL* |
| Ga0070693_1015793892 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGMIVAQLL* |
| Ga0070702_1003220721 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | FRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0068859_1029932322 | 3300005617 | Switchgrass Rhizosphere | MLEFCVEGMRRASRDFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL* |
| Ga0075428_1001800323 | 3300006844 | Populus Rhizosphere | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLLGTLAGLWLGAAAMIAAQLL* |
| Ga0068865_1003396022 | 3300006881 | Miscanthus Rhizosphere | MLQFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF* |
| Ga0105245_108881153 | 3300009098 | Miscanthus Rhizosphere | LRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAAAMIAAQLL* |
| Ga0114129_121784302 | 3300009147 | Populus Rhizosphere | MLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAA |
| Ga0105249_107643051 | 3300009553 | Switchgrass Rhizosphere | MLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGA |
| Ga0126307_100014325 | 3300009789 | Serpentine Soil | MHEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL* |
| Ga0126310_111802032 | 3300010044 | Serpentine Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAACLIAAQLL* |
| Ga0134125_113866443 | 3300010371 | Terrestrial Soil | MLEFRVEGLRRASREFFFDMEQRPSLRPLAPLIGTWAGLWLGAAGMIVAQLL* |
| Ga0134126_120491852 | 3300010396 | Terrestrial Soil | MLEFRVEGLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGMIVAQLL* |
| Ga0134127_119649641 | 3300010399 | Terrestrial Soil | AGRMPEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0134122_108554861 | 3300010400 | Terrestrial Soil | RRMLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGMIVAQLL* |
| Ga0134123_104547511 | 3300010403 | Terrestrial Soil | MLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQ |
| Ga0126317_101813532 | 3300011332 | Soil | MLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0126317_104584052 | 3300011332 | Soil | MLEFRVEVLRRASRDFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL* |
| Ga0150985_1229652732 | 3300012212 | Avena Fatua Rhizosphere | MFEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0134042_11664222 | 3300012373 | Grasslands Soil | MLAFSVEGMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL* |
| Ga0157306_100721222 | 3300012912 | Soil | MFEFRAEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL* |
| Ga0157307_10565461 | 3300013096 | Soil | MLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGL |
| Ga0157373_106925223 | 3300013100 | Corn Rhizosphere | MLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGMIVAQLL* |
| Ga0157374_122787111 | 3300013296 | Miscanthus Rhizosphere | MLEFCVEVMRRASREFFFDMEPRPSLRPLAPLIGTL |
| Ga0157374_127094492 | 3300013296 | Miscanthus Rhizosphere | MLEFCVEVMRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0157378_112737481 | 3300013297 | Miscanthus Rhizosphere | VEVLRRASREFFFDMKQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0075312_10157743 | 3300014254 | Natural And Restored Wetlands | MLEFRVEVLRRASRELFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL* |
| Ga0163163_103423692 | 3300014325 | Switchgrass Rhizosphere | MLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAATIAAQLL* |
| Ga0173483_100344013 | 3300015077 | Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAVMIAAQLL* |
| Ga0173480_107431522 | 3300015200 | Soil | KRRMLEFRVEVLRRASREFFLDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL* |
| Ga0190266_100032144 | 3300017965 | Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0184611_12736192 | 3300018067 | Groundwater Sediment | MLQFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0190270_118228342 | 3300018469 | Soil | RRSFAAREPRIFFDMEPRPSLRPLAPLIGTLAGLWLGAAGMIAAQLL |
| Ga0184646_16020602 | 3300019259 | Groundwater Sediment | MREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL |
| Ga0184644_12815012 | 3300019269 | Groundwater Sediment | MREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0173481_100137623 | 3300019356 | Soil | MLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL |
| Ga0173482_101035503 | 3300019361 | Soil | MLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL |
| Ga0173482_102418853 | 3300019361 | Soil | MLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0173479_100586492 | 3300019362 | Soil | MLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0193703_10473941 | 3300019876 | Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLW |
| Ga0193697_10022165 | 3300020005 | Soil | MREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGILAGLWLGAAAMIAAQLL |
| Ga0206352_103379851 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLYKYEM |
| Ga0206350_105699631 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAAAMIAAQLL |
| Ga0206353_111770562 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL |
| Ga0222621_10270091 | 3300021510 | Groundwater Sediment | MLEFRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQ |
| Ga0222622_101020111 | 3300022756 | Groundwater Sediment | MREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLA |
| Ga0247745_10341672 | 3300022898 | Soil | MLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWL |
| Ga0247752_10203152 | 3300023071 | Soil | MFEFRAEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0210087_10564632 | 3300025559 | Natural And Restored Wetlands | MLEFRVEVLRRASRELFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0207642_110890142 | 3300025899 | Miscanthus Rhizosphere | MLEFRVEVLRRASREFFFDMEQRPSLLPLAPLIGTLAGLWLG |
| Ga0207688_100689331 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | RMLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0207684_112656402 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAG |
| Ga0207662_105844122 | 3300025918 | Switchgrass Rhizosphere | MLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTL |
| Ga0207649_105993152 | 3300025920 | Corn Rhizosphere | MLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLW |
| Ga0207681_105587002 | 3300025923 | Switchgrass Rhizosphere | MLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL |
| Ga0207659_110253271 | 3300025926 | Miscanthus Rhizosphere | MLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMI |
| Ga0207687_108289291 | 3300025927 | Miscanthus Rhizosphere | MLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGT |
| Ga0207690_118562061 | 3300025932 | Corn Rhizosphere | MLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL |
| Ga0207686_105834272 | 3300025934 | Miscanthus Rhizosphere | MLEFCVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF |
| Ga0207686_108546541 | 3300025934 | Miscanthus Rhizosphere | MPEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0207674_110295321 | 3300026116 | Corn Rhizosphere | MLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAA |
| Ga0207675_1004786232 | 3300026118 | Switchgrass Rhizosphere | MLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF |
| Ga0209998_100106783 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGALAGLWLGATGLIVAQLL |
| Ga0207428_100093177 | 3300027907 | Populus Rhizosphere | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLLGTLAGLWLGAAAMIAAQLL |
| Ga0247818_113130741 | 3300028589 | Soil | MREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAM |
| Ga0307319_100110783 | 3300028722 | Soil | MLEFRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL |
| Ga0307287_100742561 | 3300028796 | Soil | EFRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL |
| Ga0307302_105649022 | 3300028814 | Soil | LRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL |
| Ga0307289_101390153 | 3300028875 | Soil | FRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL |
| Ga0307300_100076361 | 3300028880 | Soil | GRMLEFRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL |
| Ga0307304_103305432 | 3300028885 | Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQ |
| Ga0247654_10086852 | 3300030552 | Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAVQLL |
| Ga0308200_10119162 | 3300030905 | Soil | MLEFRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0308182_10106941 | 3300031125 | Soil | MREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL |
| Ga0307408_1002268602 | 3300031548 | Rhizosphere | MLEFRVEVCGARAEKFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGMIAAQLL |
| Ga0307405_100151542 | 3300031731 | Rhizosphere | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIAVQLF |
| Ga0307413_106564762 | 3300031824 | Rhizosphere | MLEFRVEVCGARAEKFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0307412_104021741 | 3300031911 | Rhizosphere | MLEFRVEVCGARAEKFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIAVQLF |
| Ga0310885_100595631 | 3300031943 | Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLLGTLAGLWLGAAA |
| Ga0310902_103701501 | 3300032012 | Soil | MLEFRVEGLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAA |
| Ga0310890_101089263 | 3300032075 | Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGPWLGAAAMIAAQLL |
| Ga0307471_1010872001 | 3300032180 | Hardwood Forest Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQ |
| Ga0314782_053997_580_717 | 3300034661 | Soil | VLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL |
| Ga0314783_037534_155_313 | 3300034662 | Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAGAMIAAQLL |
| Ga0314792_138863_475_633 | 3300034667 | Soil | MLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIAAQLF |
| Ga0314794_060417_202_360 | 3300034669 | Soil | MLEVRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL |
| Ga0314802_009755_3_116 | 3300034677 | Soil | MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAG |
| ⦗Top⦘ |