NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075822

Metagenome / Metatranscriptome Family F075822

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075822
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 50 residues
Representative Sequence MLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Number of Associated Samples 110
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.51 %
% of genes near scaffold ends (potentially truncated) 40.68 %
% of genes from short scaffolds (< 2000 bps) 88.14 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.458 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.949 % of family members)
Environment Ontology (ENVO) Unclassified
(32.203 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.763 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 65.38%    β-sheet: 0.00%    Coil/Unstructured: 34.62%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF00571CBS 41.53
PF13432TPR_16 16.95
PF13424TPR_12 10.17
PF00581Rhodanese 6.78
PF07721TPR_4 2.54
PF05544Pro_racemase 1.69
PF13977TetR_C_6 1.69
PF13560HTH_31 1.69
PF02274ADI 1.69
PF16177ACAS_N 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG1834N-Dimethylarginine dimethylaminohydrolaseAmino acid transport and metabolism [E] 1.69
COG2235Arginine deiminaseAmino acid transport and metabolism [E] 1.69
COG3938Proline racemase/hydroxyproline epimeraseAmino acid transport and metabolism [E] 1.69
COG4874Uncharacterized conserved proteinFunction unknown [S] 1.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.46 %
UnclassifiedrootN/A2.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000890|JGI11643J12802_10641818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300003267|soilL1_10038942All Organisms → cellular organisms → Bacteria1941Open in IMG/M
3300003321|soilH1_10199013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1025Open in IMG/M
3300003323|rootH1_10117633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1640Open in IMG/M
3300003987|Ga0055471_10297121Not Available517Open in IMG/M
3300004114|Ga0062593_102741429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300004114|Ga0062593_102865878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300004157|Ga0062590_101772871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300004463|Ga0063356_105070789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300004479|Ga0062595_100139334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1386Open in IMG/M
3300004479|Ga0062595_100383188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria998Open in IMG/M
3300004480|Ga0062592_100536317All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300004785|Ga0058858_1410794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium674Open in IMG/M
3300004798|Ga0058859_11699066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium671Open in IMG/M
3300004803|Ga0058862_12808439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300005294|Ga0065705_10356914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium933Open in IMG/M
3300005329|Ga0070683_100092814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2835Open in IMG/M
3300005329|Ga0070683_101974737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300005331|Ga0070670_100234906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1596Open in IMG/M
3300005332|Ga0066388_100307405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2231Open in IMG/M
3300005338|Ga0068868_100332945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1296Open in IMG/M
3300005338|Ga0068868_101371153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300005339|Ga0070660_100996174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium708Open in IMG/M
3300005344|Ga0070661_100385278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1106Open in IMG/M
3300005353|Ga0070669_101490421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300005366|Ga0070659_100648900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300005438|Ga0070701_10025190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2886Open in IMG/M
3300005441|Ga0070700_100024152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3565Open in IMG/M
3300005444|Ga0070694_100486841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria980Open in IMG/M
3300005459|Ga0068867_100969718All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300005471|Ga0070698_101359113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300005530|Ga0070679_101471603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300005547|Ga0070693_101579389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300005615|Ga0070702_100322072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1078Open in IMG/M
3300005617|Ga0068859_102993232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300006844|Ga0075428_100180032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2289Open in IMG/M
3300006881|Ga0068865_100339602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1213Open in IMG/M
3300009098|Ga0105245_10888115All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300009147|Ga0114129_12178430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium667Open in IMG/M
3300009553|Ga0105249_10764305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1029Open in IMG/M
3300009789|Ga0126307_10001432All Organisms → cellular organisms → Bacteria15749Open in IMG/M
3300010044|Ga0126310_11180203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300010371|Ga0134125_11386644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria766Open in IMG/M
3300010396|Ga0134126_12049185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300010399|Ga0134127_11964964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300010400|Ga0134122_10855486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria874Open in IMG/M
3300010403|Ga0134123_10454751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1191Open in IMG/M
3300011332|Ga0126317_10181353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1046Open in IMG/M
3300011332|Ga0126317_10458405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300012212|Ga0150985_122965273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300012373|Ga0134042_1166422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300012912|Ga0157306_10072122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria931Open in IMG/M
3300013096|Ga0157307_1056546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium747Open in IMG/M
3300013100|Ga0157373_10692522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium746Open in IMG/M
3300013296|Ga0157374_12278711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300013296|Ga0157374_12709449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300013297|Ga0157378_11273748All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300014254|Ga0075312_1015774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1294Open in IMG/M
3300014325|Ga0163163_10342369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1551Open in IMG/M
3300015077|Ga0173483_10034401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1864Open in IMG/M
3300015200|Ga0173480_10743152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300017965|Ga0190266_10003214All Organisms → cellular organisms → Bacteria3413Open in IMG/M
3300018067|Ga0184611_1273619Not Available592Open in IMG/M
3300018469|Ga0190270_11822834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300019259|Ga0184646_1602060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium798Open in IMG/M
3300019269|Ga0184644_1281501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1296Open in IMG/M
3300019356|Ga0173481_10013762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2342Open in IMG/M
3300019361|Ga0173482_10103550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1037Open in IMG/M
3300019361|Ga0173482_10241885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium764Open in IMG/M
3300019362|Ga0173479_10058649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1292Open in IMG/M
3300019876|Ga0193703_1047394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300020005|Ga0193697_1002216All Organisms → cellular organisms → Bacteria5205Open in IMG/M
3300020078|Ga0206352_10337985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300020080|Ga0206350_10569963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300020082|Ga0206353_11177056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300021510|Ga0222621_1027009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1173Open in IMG/M
3300022756|Ga0222622_10102011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1766Open in IMG/M
3300022898|Ga0247745_1034167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300023071|Ga0247752_1020315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium944Open in IMG/M
3300025559|Ga0210087_1056463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria784Open in IMG/M
3300025899|Ga0207642_11089014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300025901|Ga0207688_10068933All Organisms → cellular organisms → Bacteria2004Open in IMG/M
3300025910|Ga0207684_11265640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300025918|Ga0207662_10584412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300025920|Ga0207649_10599315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria847Open in IMG/M
3300025923|Ga0207681_10558700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium943Open in IMG/M
3300025926|Ga0207659_11025327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300025927|Ga0207687_10828929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300025932|Ga0207690_11856206Not Available503Open in IMG/M
3300025934|Ga0207686_10583427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria878Open in IMG/M
3300025934|Ga0207686_10854654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300026116|Ga0207674_11029532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300026118|Ga0207675_100478623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1237Open in IMG/M
3300027717|Ga0209998_10010678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1902Open in IMG/M
3300027907|Ga0207428_10009317All Organisms → cellular organisms → Bacteria8808Open in IMG/M
3300028589|Ga0247818_11313074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300028722|Ga0307319_10011078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2746Open in IMG/M
3300028796|Ga0307287_10074256All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300028814|Ga0307302_10564902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300028875|Ga0307289_10139015All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300028880|Ga0307300_10007636All Organisms → cellular organisms → Bacteria2734Open in IMG/M
3300028885|Ga0307304_10330543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium678Open in IMG/M
3300030552|Ga0247654_1008685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1021Open in IMG/M
3300030905|Ga0308200_1011916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1266Open in IMG/M
3300031125|Ga0308182_1010694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300031548|Ga0307408_100226860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1527Open in IMG/M
3300031731|Ga0307405_10015154All Organisms → cellular organisms → Bacteria4166Open in IMG/M
3300031824|Ga0307413_10656476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria866Open in IMG/M
3300031911|Ga0307412_10402174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1115Open in IMG/M
3300031943|Ga0310885_10059563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1616Open in IMG/M
3300032012|Ga0310902_10370150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria904Open in IMG/M
3300032075|Ga0310890_10108926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1754Open in IMG/M
3300032180|Ga0307471_101087200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria966Open in IMG/M
3300034661|Ga0314782_053997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium808Open in IMG/M
3300034662|Ga0314783_037534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium865Open in IMG/M
3300034667|Ga0314792_138863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300034669|Ga0314794_060417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium737Open in IMG/M
3300034677|Ga0314802_009755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium859Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil7.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.08%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.24%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.24%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.39%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.39%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.54%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.54%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.54%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.54%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.54%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.69%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.69%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.69%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.69%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.69%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.69%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.69%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.85%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.85%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.85%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003323Sugarcane root Sample H1Host-AssociatedOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004785Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012373Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014254Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030552Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031125Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034662Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034667Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034669Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034677Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11643J12802_1064181813300000890SoilMLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLG
soilL1_1003894243300003267Sugarcane Root And Bulk SoilMLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL*
soilH1_1019901333300003321Sugarcane Root And Bulk SoilMLEFRVEGFAAREPEFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL*
rootH1_1011763323300003323Sugarcane Root And Bulk SoilMLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGASGLIVAQLL*
Ga0055471_1029712113300003987Natural And Restored WetlandsMLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAALWLGAAGLIAAQLL*
Ga0062593_10274142913300004114SoilMLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL*
Ga0062593_10286587813300004114SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0062590_10177287123300004157SoilMLEFCVEVMRRASRDFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL*
Ga0063356_10507078913300004463Arabidopsis Thaliana RhizosphereRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL*
Ga0062595_10013933433300004479SoilVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0062595_10038318823300004479SoilMLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF*
Ga0062592_10053631733300004480SoilLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL*
Ga0058858_141079413300004785Host-AssociatedMLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0058859_1169906613300004798Host-AssociatedMLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0058862_1280843913300004803Host-AssociatedMLEFCVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAAAMIAAQLL
Ga0065705_1035691413300005294Switchgrass RhizosphereEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL*
Ga0070683_10009281443300005329Corn RhizosphereMLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0070683_10197473713300005329Corn RhizosphereLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL*
Ga0070670_10023490613300005331Switchgrass RhizosphereMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAAAMIAAQLL*
Ga0066388_10030740533300005332Tropical Forest SoilMLQFRGEVMRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAALIAAQLL*
Ga0068868_10033294533300005338Miscanthus RhizosphereRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF*
Ga0068868_10137115313300005338Miscanthus RhizosphereRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL*
Ga0070660_10099617423300005339Corn RhizosphereMLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0070661_10038527833300005344Corn RhizosphereLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0070669_10149042113300005353Switchgrass RhizosphereMLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL*
Ga0070659_10064890023300005366Corn RhizosphereMLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL*
Ga0070701_1002519033300005438Corn, Switchgrass And Miscanthus RhizosphereMPEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0070700_10002415223300005441Corn, Switchgrass And Miscanthus RhizosphereMLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL*
Ga0070694_10048684113300005444Corn, Switchgrass And Miscanthus RhizosphereMLEFCVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL*
Ga0068867_10096971823300005459Miscanthus RhizosphereMLEFCVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF*
Ga0070698_10135911323300005471Corn, Switchgrass And Miscanthus RhizosphereMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF*
Ga0070679_10147160323300005530Corn RhizosphereFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAAAMIAAQLL*
Ga0070693_10157938923300005547Corn, Switchgrass And Miscanthus RhizosphereLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGMIVAQLL*
Ga0070702_10032207213300005615Corn, Switchgrass And Miscanthus RhizosphereFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0068859_10299323223300005617Switchgrass RhizosphereMLEFCVEGMRRASRDFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL*
Ga0075428_10018003233300006844Populus RhizosphereMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLLGTLAGLWLGAAAMIAAQLL*
Ga0068865_10033960223300006881Miscanthus RhizosphereMLQFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF*
Ga0105245_1088811533300009098Miscanthus RhizosphereLRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAAAMIAAQLL*
Ga0114129_1217843023300009147Populus RhizosphereMLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAA
Ga0105249_1076430513300009553Switchgrass RhizosphereMLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGA
Ga0126307_1000143253300009789Serpentine SoilMHEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL*
Ga0126310_1118020323300010044Serpentine SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAACLIAAQLL*
Ga0134125_1138664433300010371Terrestrial SoilMLEFRVEGLRRASREFFFDMEQRPSLRPLAPLIGTWAGLWLGAAGMIVAQLL*
Ga0134126_1204918523300010396Terrestrial SoilMLEFRVEGLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGMIVAQLL*
Ga0134127_1196496413300010399Terrestrial SoilAGRMPEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0134122_1085548613300010400Terrestrial SoilRRMLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGMIVAQLL*
Ga0134123_1045475113300010403Terrestrial SoilMLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQ
Ga0126317_1018135323300011332SoilMLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0126317_1045840523300011332SoilMLEFRVEVLRRASRDFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL*
Ga0150985_12296527323300012212Avena Fatua RhizosphereMFEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0134042_116642223300012373Grasslands SoilMLAFSVEGMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL*
Ga0157306_1007212223300012912SoilMFEFRAEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL*
Ga0157307_105654613300013096SoilMLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGL
Ga0157373_1069252233300013100Corn RhizosphereMLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGMIVAQLL*
Ga0157374_1227871113300013296Miscanthus RhizosphereMLEFCVEVMRRASREFFFDMEPRPSLRPLAPLIGTL
Ga0157374_1270944923300013296Miscanthus RhizosphereMLEFCVEVMRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0157378_1127374813300013297Miscanthus RhizosphereVEVLRRASREFFFDMKQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0075312_101577433300014254Natural And Restored WetlandsMLEFRVEVLRRASRELFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL*
Ga0163163_1034236923300014325Switchgrass RhizosphereMLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAATIAAQLL*
Ga0173483_1003440133300015077SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAVMIAAQLL*
Ga0173480_1074315223300015200SoilKRRMLEFRVEVLRRASREFFLDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL*
Ga0190266_1000321443300017965SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0184611_127361923300018067Groundwater SedimentMLQFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0190270_1182283423300018469SoilRRSFAAREPRIFFDMEPRPSLRPLAPLIGTLAGLWLGAAGMIAAQLL
Ga0184646_160206023300019259Groundwater SedimentMREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL
Ga0184644_128150123300019269Groundwater SedimentMREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0173481_1001376233300019356SoilMLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL
Ga0173482_1010355033300019361SoilMLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL
Ga0173482_1024188533300019361SoilMLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0173479_1005864923300019362SoilMLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0193703_104739413300019876SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLW
Ga0193697_100221653300020005SoilMREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGILAGLWLGAAAMIAAQLL
Ga0206352_1033798513300020078Corn, Switchgrass And Miscanthus RhizosphereMLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLYKYEM
Ga0206350_1056996313300020080Corn, Switchgrass And Miscanthus RhizosphereMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAAAMIAAQLL
Ga0206353_1117705623300020082Corn, Switchgrass And Miscanthus RhizosphereMLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL
Ga0222621_102700913300021510Groundwater SedimentMLEFRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQ
Ga0222622_1010201113300022756Groundwater SedimentMREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLA
Ga0247745_103416723300022898SoilMLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWL
Ga0247752_102031523300023071SoilMFEFRAEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0210087_105646323300025559Natural And Restored WetlandsMLEFRVEVLRRASRELFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0207642_1108901423300025899Miscanthus RhizosphereMLEFRVEVLRRASREFFFDMEQRPSLLPLAPLIGTLAGLWLG
Ga0207688_1006893313300025901Corn, Switchgrass And Miscanthus RhizosphereRMLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0207684_1126564023300025910Corn, Switchgrass And Miscanthus RhizosphereMLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAG
Ga0207662_1058441223300025918Switchgrass RhizosphereMLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTL
Ga0207649_1059931523300025920Corn RhizosphereMLEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLW
Ga0207681_1055870023300025923Switchgrass RhizosphereMLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL
Ga0207659_1102532713300025926Miscanthus RhizosphereMLEFHVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMI
Ga0207687_1082892913300025927Miscanthus RhizosphereMLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGT
Ga0207690_1185620613300025932Corn RhizosphereMLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL
Ga0207686_1058342723300025934Miscanthus RhizosphereMLEFCVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF
Ga0207686_1085465413300025934Miscanthus RhizosphereMPEFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0207674_1102953213300026116Corn RhizosphereMLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAA
Ga0207675_10047862323300026118Switchgrass RhizosphereMLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLF
Ga0209998_1001067833300027717Arabidopsis Thaliana RhizosphereMLQFRVEVLRRASREFFFDMEQRPSLRPLAPLIGALAGLWLGATGLIVAQLL
Ga0207428_1000931773300027907Populus RhizosphereMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLLGTLAGLWLGAAAMIAAQLL
Ga0247818_1131307413300028589SoilMREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAM
Ga0307319_1001107833300028722SoilMLEFRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL
Ga0307287_1007425613300028796SoilEFRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL
Ga0307302_1056490223300028814SoilLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL
Ga0307289_1013901533300028875SoilFRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL
Ga0307300_1000763613300028880SoilGRMLEFRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWVGAAAMIAVQLL
Ga0307304_1033054323300028885SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQ
Ga0247654_100868523300030552SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAVQLL
Ga0308200_101191623300030905SoilMLEFRVEDLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0308182_101069413300031125SoilMREFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQLL
Ga0307408_10022686023300031548RhizosphereMLEFRVEVCGARAEKFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGMIAAQLL
Ga0307405_1001515423300031731RhizosphereMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIAVQLF
Ga0307413_1065647623300031824RhizosphereMLEFRVEVCGARAEKFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0307412_1040217413300031911RhizosphereMLEFRVEVCGARAEKFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIAVQLF
Ga0310885_1005956313300031943SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLLGTLAGLWLGAAA
Ga0310902_1037015013300032012SoilMLEFRVEGLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAA
Ga0310890_1010892633300032075SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGPWLGAAAMIAAQLL
Ga0307471_10108720013300032180Hardwood Forest SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIVAQ
Ga0314782_053997_580_7173300034661SoilVLRRASREFFFDMEQRPSLRPLAPLIGTLAGLWLGAAGLIAAQLL
Ga0314783_037534_155_3133300034662SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGFWLGAGAMIAAQLL
Ga0314792_138863_475_6333300034667SoilMLEFRVEVMRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAGLIAAQLF
Ga0314794_060417_202_3603300034669SoilMLEVRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAGLWLGAAAMIAAQLL
Ga0314802_009755_3_1163300034677SoilMLEFRVEVLRRASREFFFDMEPRPSLRPLAPLIGTLAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.