NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075794

Metagenome / Metatranscriptome Family F075794

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075794
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 42 residues
Representative Sequence DVTQSDEYQEARAEIRREYDKGELEVEGERDRFPPTRYDE
Number of Associated Samples 100
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.71 %
% of genes near scaffold ends (potentially truncated) 97.46 %
% of genes from short scaffolds (< 2000 bps) 91.53 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.525 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(38.983 % of family members)
Environment Ontology (ENVO) Unclassified
(45.763 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.915 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.53%    β-sheet: 0.00%    Coil/Unstructured: 76.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF00296Bac_luciferase 13.56
PF02852Pyr_redox_dim 12.71
PF04454Linocin_M18 9.32
PF07992Pyr_redox_2 6.78
PF04672Methyltransf_19 5.93
PF00768Peptidase_S11 5.08
PF01814Hemerythrin 5.08
PF00857Isochorismatase 3.39
PF00067p450 2.54
PF09335SNARE_assoc 1.69
PF04261Dyp_perox 1.69
PF00496SBP_bac_5 0.85
PF02744GalP_UDP_tr_C 0.85
PF07859Abhydrolase_3 0.85
PF13401AAA_22 0.85
PF03446NAD_binding_2 0.85
PF01028Topoisom_I 0.85
PF13424TPR_12 0.85
PF13936HTH_38 0.85
PF01841Transglut_core 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 13.56
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 5.08
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 3.39
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 3.39
COG2124Cytochrome P450Defense mechanisms [V] 2.54
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 1.69
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 1.69
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 1.69
COG2837Periplasmic deferrochelatase/peroxidase EfeBInorganic ion transport and metabolism [P] 1.69
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.85
COG3569DNA topoisomerase IBReplication, recombination and repair [L] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.53 %
UnclassifiedrootN/A8.47 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003505|JGIcombinedJ51221_10394808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia562Open in IMG/M
3300005436|Ga0070713_100020907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5025Open in IMG/M
3300005439|Ga0070711_100201572All Organisms → cellular organisms → Bacteria1536Open in IMG/M
3300005468|Ga0070707_100549716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1117Open in IMG/M
3300005602|Ga0070762_11085797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii551Open in IMG/M
3300005615|Ga0070702_100168298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1423Open in IMG/M
3300005712|Ga0070764_11063999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300005764|Ga0066903_106140022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales628Open in IMG/M
3300005764|Ga0066903_108556134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia521Open in IMG/M
3300005921|Ga0070766_11265529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300006854|Ga0075425_100161322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2572Open in IMG/M
3300006871|Ga0075434_100040793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae4597Open in IMG/M
3300009038|Ga0099829_11051535All Organisms → cellular organisms → Bacteria → Terrabacteria group675Open in IMG/M
3300009792|Ga0126374_10073206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1842Open in IMG/M
3300010043|Ga0126380_10026148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2885Open in IMG/M
3300010043|Ga0126380_11200115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300010043|Ga0126380_11387542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300010358|Ga0126370_12101740All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300010360|Ga0126372_11455095All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300010366|Ga0126379_13557100All Organisms → cellular organisms → Bacteria → Terrabacteria group522Open in IMG/M
3300010379|Ga0136449_100300326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2929Open in IMG/M
3300010398|Ga0126383_11198633All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300010398|Ga0126383_11696509All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300010876|Ga0126361_10252148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia739Open in IMG/M
3300011120|Ga0150983_12841965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii790Open in IMG/M
3300012189|Ga0137388_10239622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1648Open in IMG/M
3300012210|Ga0137378_10632558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales980Open in IMG/M
3300012356|Ga0137371_11108019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300012357|Ga0137384_11426556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae541Open in IMG/M
3300012984|Ga0164309_11304510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria614Open in IMG/M
3300014501|Ga0182024_10086300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4647Open in IMG/M
3300016270|Ga0182036_11237988All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300016319|Ga0182033_10510097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia canadensis1034Open in IMG/M
3300016341|Ga0182035_10325470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sinosporangium → Sinosporangium album1269Open in IMG/M
3300016341|Ga0182035_10851636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300016422|Ga0182039_10554279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria999Open in IMG/M
3300016445|Ga0182038_12045177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300017970|Ga0187783_10453847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae930Open in IMG/M
3300017972|Ga0187781_10903290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae643Open in IMG/M
3300017973|Ga0187780_11027065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300017994|Ga0187822_10266005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae594Open in IMG/M
3300017999|Ga0187767_10296731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300018035|Ga0187875_10595425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300018038|Ga0187855_10137069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1464Open in IMG/M
3300018482|Ga0066669_11158518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300019879|Ga0193723_1094292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia850Open in IMG/M
3300021181|Ga0210388_11759396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300021401|Ga0210393_11331661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii575Open in IMG/M
3300021432|Ga0210384_10554450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1034Open in IMG/M
3300021475|Ga0210392_11447369Not Available514Open in IMG/M
3300021560|Ga0126371_11140047All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300021560|Ga0126371_11523724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria796Open in IMG/M
3300021560|Ga0126371_12058041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300025625|Ga0208219_1106323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii635Open in IMG/M
3300025916|Ga0207663_10339206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1134Open in IMG/M
3300025928|Ga0207700_10146007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1950Open in IMG/M
3300028806|Ga0302221_10336632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia657Open in IMG/M
3300028863|Ga0302218_10140253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia765Open in IMG/M
3300029951|Ga0311371_10143650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3675Open in IMG/M
3300030007|Ga0311338_10913828Not Available861Open in IMG/M
3300030058|Ga0302179_10037388Not Available2233Open in IMG/M
3300030573|Ga0210272_1319476Not Available506Open in IMG/M
3300030618|Ga0311354_11956536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300030743|Ga0265461_12036566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia656Open in IMG/M
3300031525|Ga0302326_10451157All Organisms → cellular organisms → Bacteria → Terrabacteria group1971Open in IMG/M
3300031544|Ga0318534_10158306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1308Open in IMG/M
3300031549|Ga0318571_10144128All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300031549|Ga0318571_10222292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia684Open in IMG/M
3300031549|Ga0318571_10426410Not Available522Open in IMG/M
3300031572|Ga0318515_10162217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium1193Open in IMG/M
3300031679|Ga0318561_10629545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300031681|Ga0318572_10218721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1115Open in IMG/M
3300031682|Ga0318560_10154845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia1214Open in IMG/M
3300031682|Ga0318560_10389647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae754Open in IMG/M
3300031708|Ga0310686_119189403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter834Open in IMG/M
3300031708|Ga0310686_119260666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia530Open in IMG/M
3300031713|Ga0318496_10455177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300031713|Ga0318496_10663946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300031713|Ga0318496_10707594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria555Open in IMG/M
3300031719|Ga0306917_10408619All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300031723|Ga0318493_10587317All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031724|Ga0318500_10467471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae632Open in IMG/M
3300031724|Ga0318500_10681965Not Available523Open in IMG/M
3300031736|Ga0318501_10841505All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300031740|Ga0307468_101044276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300031748|Ga0318492_10646712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia565Open in IMG/M
3300031751|Ga0318494_10455515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae744Open in IMG/M
3300031765|Ga0318554_10133355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1406Open in IMG/M
3300031779|Ga0318566_10067427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1725Open in IMG/M
3300031792|Ga0318529_10399602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia640Open in IMG/M
3300031798|Ga0318523_10097962Not Available1436Open in IMG/M
3300031798|Ga0318523_10141726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1193Open in IMG/M
3300031805|Ga0318497_10458011Not Available714Open in IMG/M
3300031831|Ga0318564_10348527All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300031859|Ga0318527_10389754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia594Open in IMG/M
3300031860|Ga0318495_10173601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria971Open in IMG/M
3300031910|Ga0306923_11812070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300031910|Ga0306923_12529576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300031941|Ga0310912_11239037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300031946|Ga0310910_11335234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300032001|Ga0306922_11783804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300032001|Ga0306922_12098907Not Available548Open in IMG/M
3300032008|Ga0318562_10686890All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300032009|Ga0318563_10440341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria705Open in IMG/M
3300032039|Ga0318559_10148254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1064Open in IMG/M
3300032051|Ga0318532_10074849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1181Open in IMG/M
3300032063|Ga0318504_10566474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300032065|Ga0318513_10130280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1192Open in IMG/M
3300032066|Ga0318514_10046415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2089Open in IMG/M
3300032076|Ga0306924_10640400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1199Open in IMG/M
3300032089|Ga0318525_10476536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300032090|Ga0318518_10327167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium787Open in IMG/M
3300032094|Ga0318540_10293989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia784Open in IMG/M
3300032261|Ga0306920_102322729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae742Open in IMG/M
3300032261|Ga0306920_102901679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella650Open in IMG/M
3300032828|Ga0335080_12122942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300033290|Ga0318519_11016371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil38.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.17%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.08%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.39%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.39%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.54%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.69%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.69%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.69%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.85%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.85%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ51221_1039480823300003505Forest SoilPPATDTPPQPEDITLNEDWQEERAEVRREEDKGELGAPIDERHPFPPTRYE*
Ga0070713_10002090763300005436Corn, Switchgrass And Miscanthus RhizospherePATDAPPEPDIARSEVFQEARAEIRREYDKDELLAEGQRDPYPPTRYDE*
Ga0070711_10020157213300005439Corn, Switchgrass And Miscanthus RhizosphereARSDVFQEARAEIRREYDKDELRVEGQRDPYPPTRYDEDVLAI*
Ga0070707_10054971633300005468Corn, Switchgrass And Miscanthus RhizospherePSQWDVTQTTEYQEERAEIRRELDKDELLIEGERDPFPPTRYDR*
Ga0070762_1108579723300005602SoilTDAPQSFDVTSTEEYQEERAEIRREFDRDELQIEGQRDRTPPTHYDE*
Ga0070702_10016829833300005615Corn, Switchgrass And Miscanthus RhizosphereDIRQSEEFQEARAEIRREYDKDELLVEGEREQFPPSHYDNS*
Ga0070764_1106399923300005712SoilDEVPPATDTPPQPEDITQTEVWQEERAEIRREEDKDELLVKGERDPFPPTRYE*
Ga0066903_10614002213300005764Tropical Forest SoilEEYQEARAEILREYDKGELETKGEPDRFPPTRYDS*
Ga0066903_10855613423300005764Tropical Forest SoilADSEVFQEARAEIRREYDKDELTLEHERSPYPPTRYE*
Ga0070766_1126552913300005921SoilQTDEYQEARAEIRREADQDELEVEGRRDPFPPSHYDR*
Ga0075425_10016132253300006854Populus RhizospherePDITQSDEYQEARAEIRREYDKGELEVEGERPGFPPTRYDE*
Ga0075434_10004079313300006871Populus RhizosphereTESDTYQEARAEIRREYDKDELTVEGQRDPYPPSHYDE*
Ga0099829_1105153523300009038Vadose Zone SoilVPSATDTPPQPEDITQTEEWQEERAEVRRELDKDELGPIAEREPFPPTRYE*
Ga0126374_1007320613300009792Tropical Forest SoilPDITESDVYQEAQAEIRREYDKDELTVEGERDPYPPTHYDD*
Ga0126380_1002614813300010043Tropical Forest SoilDEPPPFDVTQSDVYQEARAEIRREYDADELEVEGERDRFPPTHYDR*
Ga0126380_1120011513300010043Tropical Forest SoilDVTQSDVYQEARAEIRREYDADELEVEGERDRFPPTHYDR*
Ga0126380_1138754213300010043Tropical Forest SoilPPEFDVTQGEEYQEARAEIRREYDQGELEVEGERPGFPPTRYDQ*
Ga0126370_1210174033300010358Tropical Forest SoilPDVTQSDEYQEARAEIRREYDQDELEVEGERPGFPPTHYDR*
Ga0126372_1145509513300010360Tropical Forest SoilPEPDITESDTYQEARAEIRREYDKDELTVEGQRDPYPPTHYDE*
Ga0126379_1355710013300010366Tropical Forest SoilTDAPPQQDVTQTEEYQEARAEVRRELDKDELMVEGERDPFPPTHYDP*
Ga0136449_10030032633300010379Peatlands SoilDTPPEPDVTRSDTYQEARAEIRREYDKDELLVEGEREQFPPSHYE*
Ga0126383_1119863313300010398Tropical Forest SoilQSDEYQEARAEIRREYDKGELEVEGERPGFPPTHYDR*
Ga0126383_1169650923300010398Tropical Forest SoilDITESDTYQEARAEIRREYDKDELTVEGQRDPYPPTHYDE*
Ga0126344_112701613300010866Boreal Forest SoilPPQPEDITQNEDWQEERAEVRREEDLGELGPPVDERHPFPPTRYE*
Ga0126361_1025214823300010876Boreal Forest SoilPPATDTPPQPEDITQTEEYQEERAEIHREYDKDEFLVKGERDPFPPTRYE*
Ga0150983_1284196533300011120Forest SoilDISQSDAYQEARAEIRREYDKDELLVEGEREQFPPTHYS*
Ga0137388_1023962213300012189Vadose Zone SoilPPEPDLAESDTYQEARAEIRREYDKDELTVEGQRDPYPPTHYDE*
Ga0137378_1063255823300012210Vadose Zone SoilPPQQDVTETDEYQEARAEIRREFDKDELQIEGERDPFPPTHYDR*
Ga0137371_1110801913300012356Vadose Zone SoilDVTQSDEYQEARAEIRREYDKGELEVEGERDRFPPTRYDE*
Ga0137384_1142655613300012357Vadose Zone SoilAPDITQSDVYQEAKAEIQHELDEDELRVRGERDPYPPTRYDRT*
Ga0164309_1130451033300012984SoilDEPPTPDITQSDEYQEARAEIRREYDKGELEVEGERPGFPPTRYDD*
Ga0182024_1008630063300014501PermafrostQTEAYQEARAEIRRQFDNDELTIEGERDQFPPTRYDQ*
Ga0182036_1123798813300016270SoilTDAPPEPDITESDTYQEARAEIRREYDKDELTVEGERDPYPPTRYDR
Ga0182033_1051009713300016319SoilIARSDEYQEARAEIRREYDKDELTVEGERDPYPPTHYDG
Ga0182035_1032547013300016341SoilEEYQEARAEIRRELDKDELLVEGERDAFPPTHYDQ
Ga0182035_1085163633300016341SoilFDVTQGEEYQEARAEIRREYDKGELEVEGEPDRFPPTRYDQ
Ga0182039_1055427913300016422SoilPPATDAPPEYDVREGEEYQEARAEILREYDKGELETKGEPDRFPPTRYDE
Ga0182038_1204517713300016445SoilATDEPPAFDVTQGEEYQEARAEIRREYDKGELEVEGEPDRFPPTRYDQ
Ga0187783_1045384723300017970Tropical PeatlandQPFDVTQTDEYQEARAEIRREYDQDELQVEGERNPFPPTHYDP
Ga0187781_1090329013300017972Tropical PeatlandTQTDEYQEARAEIRREYDKDELQVEGERNPFPPTHYDP
Ga0187780_1102706533300017973Tropical PeatlandVREGEEYQEARAEIRREYDKGELETEGERDRFPPTRYDS
Ga0187822_1026600523300017994Freshwater SedimentVTQTDEYQEAQAEIRREYDKDELQVEGERNPFPPTHYDP
Ga0187767_1029673113300017999Tropical PeatlandEGEEYQEARAEIRREYDKGELEVEGERPGFPPTRYDQ
Ga0187875_1059542523300018035PeatlandVPPATDTPPQPEDITQTEVWQEERAEIRREEDKDELLVKGERDPFPPTRYE
Ga0187855_1013706913300018038PeatlandATDTPPEPEDITQTEQWQEERAEIRREYDKDELRVKGERDPFPPTRYE
Ga0066669_1115851813300018482Grasslands SoilTDEPPTPDVTQSDEYQEARAEIRREYDKGELEVEGERDRFPPTRYDE
Ga0193723_109429213300019879SoilVTETDEYQEARAEIRREFDKDELQIEGERDPFPPTRYDR
Ga0210388_1175939613300021181SoilITQTEQWQEERAEIRREYDKDELLVKGERDPFPPTRYE
Ga0210393_1133166113300021401SoilPPEPDLSQSEVFQEARAEIRREYDKDELTLEHERSPYPPSHYDE
Ga0210384_1055445013300021432SoilPPEPDLTRSDTYQEARAEIRREYDKDELTVEGQRDPYPPSHYDE
Ga0210392_1144736923300021475SoilAPPEPDIARSDVFQEARAEIRREYDKDELRVEGQRDPYPPTRYDE
Ga0126371_1114004713300021560Tropical Forest SoilSDTYQEARAEIRREYDKDELTVEGERDPYPPTHYDE
Ga0126371_1152372433300021560Tropical Forest SoilPEFDVTQGEEYQEARAEIRREYDKGELETEGEPDRFPPTRYDE
Ga0126371_1205804133300021560Tropical Forest SoilEEYQEARAEILREYDKGELETKGEPDRFPPTRYDS
Ga0208219_110632323300025625Arctic Peat SoilMNDTTDAPPRPDVTQTEAYQEARAEIRRQFDNDELTIEGERDQFPPTRYDQ
Ga0207663_1033920613300025916Corn, Switchgrass And Miscanthus RhizospherePDIARSDVFQEARAEIRREYDKDELRVEGQRDPYPPTRYDE
Ga0207700_1014600733300025928Corn, Switchgrass And Miscanthus RhizosphereDAPPEADLAQSDIFQEARAEIRREYDKDELLVEGQRDPYPPTRYDE
Ga0302221_1033663213300028806PalsaPQPEDITQTEVWQEERAEIRREYDKDELRVKGERDPFPPTRYE
Ga0302218_1014025313300028863PalsaPPQPEDITQTEQWQEERAEIRREYDKDELRVKGERDPFPPTRYE
Ga0311371_1014365053300029951PalsaQPEDITQTEQWQEERAEIRREYDKDELLVKGERDPFPPTRYE
Ga0311338_1091382823300030007PalsaPATDTPPQPEDITQTEVWQEERAEIRREESKDELLVKGERNPFPPTRYE
Ga0302179_1003738813300030058PalsaTPPQPEDITQTEQWQEERAEIRREYDKDELLVKGERDPFPPTRYE
Ga0210272_131947613300030573SoilPDEVPPATDTPPQPEDITQTDVWQEERAEIRREYDKDELLVKGERDPFPPTRYE
Ga0311354_1195653623300030618PalsaDEVPPATDTPPQPEDITQTEVWQEERAEIRREESKDELLVKGERNPFPPTRYE
Ga0265461_1203656613300030743SoilVPPATDTPPQPEDITQTEQWQEERAEIRREYDKDELLVKGERDPFPPTRYE
Ga0302326_1045115713300031525PalsaEVPPATDTPPLPQDITQTEVYQEERAEVRRQAGKGELPTVDEHDPFPPTRYDESR
Ga0318534_1015830633300031544SoilDITQSDEYQEARAEIRREYDKGELEVEGERPGFPPTRYDD
Ga0318571_1014412813300031549SoilDAPPEPDITESDTYQEARAEIRREYDKDELTVEGERDPYPPTRYDG
Ga0318571_1022229213300031549SoilAPPEPDIARSDVFQEAQAEIRREYDKDELLAEGQRDPYPPTRYDE
Ga0318571_1042641023300031549SoilSDTYQEARAEIRREYDKDELTLEHERDPYPPTRYE
Ga0318515_1016221723300031572SoilEPDIARSDEYQEARAEIRREYDKDELTVEGERDPYPPTHYDG
Ga0318561_1062954533300031679SoilEEYQEARAEILREYDKGELETKGEPDRFPPTRYDE
Ga0318572_1021872113300031681SoilITRSDAYQEARAEIWREYDKDELLVEGEREQFPPTHYE
Ga0318560_1015484533300031682SoilTDEPPEPDLAQSEVFQEARAEIRREYDKDELTLEHERSPYPPTRYDE
Ga0318560_1038964713300031682SoilPWDVTQTDEYQEARAEIRREYDQDELQVEGERNPFPPTHYDP
Ga0310686_11918940313300031708SoilDVYEEERAEIRREYDKDELEMEHERSPFPPSHYDR
Ga0310686_11926066613300031708SoilDTYQEARAEIRREYDKDELMVEGQRDPYPPTRYDE
Ga0318496_1045517733300031713SoilYDVREGEEYQEARAEILREYDKGELETKGEPDRFPPTRYDE
Ga0318496_1066394623300031713SoilAPPQPDITRSDAYQEARAEIRREYDKDELLVEGEREQFPPSHYE
Ga0318496_1070759433300031713SoilDVTQGEEYQEARAEIRREYDKGELETEGERDGFPPTRYDE
Ga0306917_1040861913300031719SoilTDAPPEPDIRESDTYQEARAEIRREYDKDELTVEGQRDPYPPTHYDE
Ga0318493_1058731713300031723SoilATDAPPEPDIRESDTYQEARAEIRREYDKDELTVEGQRDPYPPTRYDK
Ga0318500_1046747113300031724SoilTPPQPWDVTQTDEYQEARAEIRREYDQDELQVEGERNPFPPTHYDP
Ga0318500_1068196523300031724SoilATDAPPQPDLELSDTYQEARAEIRREYDKDELTLEHERDPYPPTRYE
Ga0318501_1084150523300031736SoilTDAPPEPDLADSDTYQEARAEIRREYDKDELTVEGQRDPYPPTHYDE
Ga0307468_10104427633300031740Hardwood Forest SoilITQSDEYQEARAEIRRAYDEGELEVEGERPGFPPSHYER
Ga0318492_1064671223300031748SoilPPEPDLAESEVFQEARAEIRRERDKDELTLEHERSPYPPTRYE
Ga0318494_1045551523300031751SoilTDEYQEARAEIRREYDKDELQVEGERNPFPPTHYDP
Ga0318554_1013335513300031765SoilPWDVTQTDEYQEARAEIRREYDQDELQVEGERNPFPPTHYDR
Ga0318566_1006742713300031779SoilATDAPPEPDLADSDTYQEARAEIRREYDKDELTVEGQRDPYPPTHYDE
Ga0318529_1039960223300031792SoilDTYQEARAEIEREYDKDELTLEHERSPYPPTRYDE
Ga0318523_1009796213300031798SoilDEYQEARAEIRREYDQDELQVEGERNPFPPTHYDR
Ga0318523_1014172613300031798SoilYDVREGEEYQEARAEILREYDKGELETKGEPDRFPPTRYDP
Ga0318497_1045801113300031805SoilSETYQEARAEIRREYDKDELTLEHERDPYPPTRYDE
Ga0318564_1034852713300031831SoilPEPDITESDTYQEARAEIRREYDKDELTVEGERDPYPPTRYDR
Ga0318527_1038975413300031859SoilSEVFQEAQAEIRRERDKDELTLEHERSPYPPTRYE
Ga0318495_1017360113300031860SoilGEEYQEARAEILREYDKGELETKGEPDRFPPTRYDE
Ga0306923_1181207023300031910SoilDEYQEARAEIRREYDKDELTVEGERDPYPPTRYDG
Ga0306923_1252957623300031910SoilAATDAPPEPDITESDTYQEARAEIRREYDRDELTVEGERDPYPPTRYDE
Ga0310912_1123903713300031941SoilPDIALSDEYQEARAEIRREYDKDELTVEGERDPYPPTRYDG
Ga0310910_1133523433300031946SoilPPEYDVREGEEYQEARAEILREYDKGELETKGEPDRFPPTRYDP
Ga0306922_1178380413300032001SoilALSDEYQEARAEIRREYDKDELTVEGERDPYPPTRYDG
Ga0306922_1209890713300032001SoilPDLELSDTYQEARAEIRREYDKDELTLEHERDPYPPTRYE
Ga0318562_1068689023300032008SoilDITESDTYQEARAEIRREYDKDELTVEGQRDPYPPTHYDE
Ga0318563_1044034133300032009SoilGEEYQEARAEIRREYDKGELETEGERDGFPPTRYDE
Ga0318559_1014825433300032039SoilATDAPPEYDVREGEEYQEARAEILREYDKGELETKGEPDRFPPTRYDE
Ga0318532_1007484933300032051SoilPPEYDVREGEEYQEARAEILREYDKGELETKGEPDRFPPTRYDE
Ga0318504_1056647413300032063SoilPEYDVREGEEYQEARAEILREYDKGELETKGEPDRFPPTRYDP
Ga0318513_1013028013300032065SoilATDGPPQQDVTQTEEYQEARAEIRRELDKDELLVEGERDAFPPTHYDQ
Ga0318514_1004641543300032066SoilAHRSPEPDIALSDEYQEARAEIRREYDKDELTVEGERDPYPPTRYDG
Ga0306924_1064040013300032076SoilEGEEYQEARAEILREYDKGELETKGEPDRFPPTRYDE
Ga0318525_1047653623300032089SoilTDTPPQPWDVTQTDEYQEARAEIRREYDKDELQVEGERNPFPPTHYDP
Ga0318518_1032716713300032090SoilDVPPEPDITRSDAYQEARAEIRREYDKDELLVEGEREQFPPTHYE
Ga0318540_1029398913300032094SoilSEVFQEARAEIRREYDKDELTLEHERSPYPPTRYDE
Ga0306920_10232272913300032261SoilDEYQEARAEIRREYDKDELQVEGERNPFPPTHYDP
Ga0306920_10290167913300032261SoilPPATDAPPEPDLRQSDTYQEARAEIEREYDKDELTLEHERSPYPPTRYE
Ga0335080_1212294233300032828SoilDVTEGEEYQEARAEIRREYDKGELETEGERPGFPPTRYDE
Ga0318519_1101637123300033290SoilPATDAPPEPDIALSDEYQEARAEIRREYDKDELTVEGERDPYPPTRYDG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.