| Basic Information | |
|---|---|
| Family ID | F075753 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCVSE |
| Number of Associated Samples | 44 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 51.69 % |
| % of genes near scaffold ends (potentially truncated) | 33.90 % |
| % of genes from short scaffolds (< 2000 bps) | 94.07 % |
| Associated GOLD sequencing projects | 32 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (61.864 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake (50.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.932 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) (73.729 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 86.36% β-sheet: 0.00% Coil/Unstructured: 13.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF12728 | HTH_17 | 4.24 |
| PF01844 | HNH | 1.69 |
| PF04586 | Peptidase_S78 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.73 % |
| Unclassified | root | N/A | 26.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000405|LV_Brine_h2_0102DRAFT_1012760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1762 | Open in IMG/M |
| 3300001097|JGIcombinedJ13537_10046252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
| 3300001097|JGIcombinedJ13537_10099722 | Not Available | 637 | Open in IMG/M |
| 3300001097|JGIcombinedJ13537_10107038 | Not Available | 604 | Open in IMG/M |
| 3300005910|Ga0075113_1044821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300005912|Ga0075109_1054774 | All Organisms → Viruses → Predicted Viral | 1472 | Open in IMG/M |
| 3300005912|Ga0075109_1093595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
| 3300005912|Ga0075109_1101295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300005912|Ga0075109_1126937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300005912|Ga0075109_1176387 | Not Available | 680 | Open in IMG/M |
| 3300005912|Ga0075109_1184381 | Not Available | 660 | Open in IMG/M |
| 3300005913|Ga0075108_10126659 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300005913|Ga0075108_10137727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300005913|Ga0075108_10141334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300005913|Ga0075108_10142949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
| 3300005913|Ga0075108_10143326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300005913|Ga0075108_10217262 | Not Available | 658 | Open in IMG/M |
| 3300005913|Ga0075108_10226553 | Not Available | 640 | Open in IMG/M |
| 3300005913|Ga0075108_10237855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300005913|Ga0075108_10324215 | Not Available | 504 | Open in IMG/M |
| 3300005913|Ga0075108_10325235 | Not Available | 503 | Open in IMG/M |
| 3300005914|Ga0075117_1099992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300005914|Ga0075117_1101432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| 3300005914|Ga0075117_1119274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300005914|Ga0075117_1235709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300005918|Ga0075116_10333481 | Not Available | 546 | Open in IMG/M |
| 3300005931|Ga0075119_1030790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1490 | Open in IMG/M |
| 3300005931|Ga0075119_1047637 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300005931|Ga0075119_1048777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
| 3300005931|Ga0075119_1092148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300005931|Ga0075119_1098794 | Not Available | 641 | Open in IMG/M |
| 3300005931|Ga0075119_1105528 | Not Available | 612 | Open in IMG/M |
| 3300005931|Ga0075119_1113299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300005931|Ga0075119_1117079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300005933|Ga0075118_10185167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300005936|Ga0075124_10288359 | Not Available | 584 | Open in IMG/M |
| 3300007074|Ga0075110_1044208 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
| 3300007074|Ga0075110_1065544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300007074|Ga0075110_1078707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300007074|Ga0075110_1085095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300007074|Ga0075110_1086341 | Not Available | 674 | Open in IMG/M |
| 3300007074|Ga0075110_1092523 | Not Available | 642 | Open in IMG/M |
| 3300007074|Ga0075110_1093746 | Not Available | 636 | Open in IMG/M |
| 3300007074|Ga0075110_1096560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300007074|Ga0075110_1103475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
| 3300007074|Ga0075110_1106076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300007074|Ga0075110_1131667 | Not Available | 501 | Open in IMG/M |
| 3300007516|Ga0105050_10336981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
| 3300007516|Ga0105050_10891717 | Not Available | 503 | Open in IMG/M |
| 3300007519|Ga0105055_10510373 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300007519|Ga0105055_10543648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
| 3300007519|Ga0105055_10581697 | Not Available | 907 | Open in IMG/M |
| 3300007519|Ga0105055_10667471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300007519|Ga0105055_10983339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300007520|Ga0105054_10306204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1432 | Open in IMG/M |
| 3300007520|Ga0105054_10760837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300007522|Ga0105053_10965259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300007522|Ga0105053_11021645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300007522|Ga0105053_11123136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300007722|Ga0105051_10890894 | Not Available | 641 | Open in IMG/M |
| 3300007722|Ga0105051_10939531 | Not Available | 621 | Open in IMG/M |
| 3300007722|Ga0105051_11292795 | Not Available | 515 | Open in IMG/M |
| 3300022821|Ga0222673_1032741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300022825|Ga0222669_1009623 | All Organisms → Viruses → Predicted Viral | 2063 | Open in IMG/M |
| 3300022837|Ga0222711_1001037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7457 | Open in IMG/M |
| 3300022837|Ga0222711_1005289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2450 | Open in IMG/M |
| 3300022844|Ga0222687_1089423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300022847|Ga0222633_1029914 | Not Available | 763 | Open in IMG/M |
| 3300022851|Ga0222691_1009957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1778 | Open in IMG/M |
| 3300022853|Ga0222652_1018392 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300022853|Ga0222652_1045810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300022856|Ga0222671_1055336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
| 3300022859|Ga0222672_1033567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
| 3300022884|Ga0222701_1014758 | All Organisms → Viruses → Predicted Viral | 1492 | Open in IMG/M |
| 3300023230|Ga0222709_1003259 | All Organisms → Viruses → Predicted Viral | 2306 | Open in IMG/M |
| 3300023235|Ga0222634_1001899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6543 | Open in IMG/M |
| 3300023262|Ga0222639_1084186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300023293|Ga0222688_1009643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1454 | Open in IMG/M |
| 3300023296|Ga0222664_1061281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300023297|Ga0222640_1097712 | Not Available | 609 | Open in IMG/M |
| 3300023301|Ga0209414_1031041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1642 | Open in IMG/M |
| 3300023301|Ga0209414_1079965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300023301|Ga0209414_1083964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
| 3300023301|Ga0209414_1106634 | Not Available | 657 | Open in IMG/M |
| 3300025362|Ga0208647_1034492 | Not Available | 577 | Open in IMG/M |
| 3300025425|Ga0208646_1002354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7847 | Open in IMG/M |
| 3300025425|Ga0208646_1019138 | All Organisms → Viruses → Predicted Viral | 1681 | Open in IMG/M |
| 3300025425|Ga0208646_1022859 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
| 3300025425|Ga0208646_1033207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
| 3300025425|Ga0208646_1045691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
| 3300025425|Ga0208646_1051690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300025425|Ga0208646_1054362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300025425|Ga0208646_1060532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300025425|Ga0208646_1060683 | Not Available | 671 | Open in IMG/M |
| 3300025425|Ga0208646_1072023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300025438|Ga0208770_1022843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1612 | Open in IMG/M |
| 3300025438|Ga0208770_1045381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
| 3300025438|Ga0208770_1067378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300025502|Ga0208903_1065158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 876 | Open in IMG/M |
| 3300025502|Ga0208903_1098975 | Not Available | 653 | Open in IMG/M |
| 3300025513|Ga0208413_1078090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
| 3300025601|Ga0208768_1162566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300027832|Ga0209491_10038445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4883 | Open in IMG/M |
| 3300027832|Ga0209491_10316382 | All Organisms → Viruses → Predicted Viral | 1191 | Open in IMG/M |
| 3300027832|Ga0209491_10420391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
| 3300027832|Ga0209491_10514606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
| 3300027832|Ga0209491_10562896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300027848|Ga0209390_10235837 | All Organisms → Viruses → Predicted Viral | 1525 | Open in IMG/M |
| 3300027976|Ga0209702_10111029 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
| 3300027976|Ga0209702_10136169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
| 3300027976|Ga0209702_10247880 | Not Available | 740 | Open in IMG/M |
| 3300027976|Ga0209702_10303678 | Not Available | 649 | Open in IMG/M |
| 3300027976|Ga0209702_10400104 | Not Available | 542 | Open in IMG/M |
| 3300032435|Ga0335398_10524808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
| 3300032435|Ga0335398_10654751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300032435|Ga0335398_10741224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300032462|Ga0335396_10428522 | Not Available | 849 | Open in IMG/M |
| 3300032462|Ga0335396_10599822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 50.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 26.27% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 15.25% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 6.78% |
| Lake Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Lake Water | 0.85% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300001097 | Saline microbial communities from Lake Vida, Antarctica (Lake Vida Brine Hole Two - Combined Assembly 2 samples, Mar 2013 Assem) | Environmental | Open in IMG/M |
| 3300005910 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKA | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005914 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ | Environmental | Open in IMG/M |
| 3300005918 | Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKC | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300005933 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKE | Environmental | Open in IMG/M |
| 3300005936 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKS | Environmental | Open in IMG/M |
| 3300007074 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
| 3300007520 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007522 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 | Environmental | Open in IMG/M |
| 3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300022821 | Saline water microbial communities from Ace Lake, Antarctica - #801 | Environmental | Open in IMG/M |
| 3300022825 | Saline water microbial communities from Ace Lake, Antarctica - #730 | Environmental | Open in IMG/M |
| 3300022837 | Saline water microbial communities from Ace Lake, Antarctica - #1699 | Environmental | Open in IMG/M |
| 3300022844 | Saline water microbial communities from Ace Lake, Antarctica - #1163 | Environmental | Open in IMG/M |
| 3300022847 | Saline water microbial communities from Ace Lake, Antarctica - #48 | Environmental | Open in IMG/M |
| 3300022851 | Saline water microbial communities from Ace Lake, Antarctica - #1237 | Environmental | Open in IMG/M |
| 3300022853 | Saline water microbial communities from Ace Lake, Antarctica - #371 | Environmental | Open in IMG/M |
| 3300022856 | Saline water microbial communities from Ace Lake, Antarctica - #797 | Environmental | Open in IMG/M |
| 3300022859 | Saline water microbial communities from Ace Lake, Antarctica - #799 | Environmental | Open in IMG/M |
| 3300022884 | Saline water microbial communities from Ace Lake, Antarctica - #1502 | Environmental | Open in IMG/M |
| 3300023230 | Saline water microbial communities from Ace Lake, Antarctica - #1692 | Environmental | Open in IMG/M |
| 3300023235 | Saline water microbial communities from Ace Lake, Antarctica - #50 | Environmental | Open in IMG/M |
| 3300023262 | Saline water microbial communities from Ace Lake, Antarctica - #185 | Environmental | Open in IMG/M |
| 3300023293 | Saline water microbial communities from Ace Lake, Antarctica - #1165 | Environmental | Open in IMG/M |
| 3300023296 | Saline water microbial communities from Ace Lake, Antarctica - #604 | Environmental | Open in IMG/M |
| 3300023297 | Saline water microbial communities from Ace Lake, Antarctica - #187 | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300025362 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKA (SPAdes) | Environmental | Open in IMG/M |
| 3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
| 3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025502 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes) | Environmental | Open in IMG/M |
| 3300025513 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD (SPAdes) | Environmental | Open in IMG/M |
| 3300025601 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027848 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300032435 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 (spades assembly) | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LV_Brine_h2_0102DRAFT_10127602 | 3300000405 | Hypersaline | MGDYLEGYLAALEDVLTEIVIENPESVNAVRYLIRHMIDDSGSE* |
| JGIcombinedJ13537_100462523 | 3300001097 | Hypersaline | MGDYLEGYLAALDDVLTSIVIENPDSVNAVRYLIRHMIDDTGSE* |
| JGIcombinedJ13537_100997223 | 3300001097 | Hypersaline | MGDYLEGYLAALDDVLTSIVIENPDSVNAVRYLIRHMIDDSGSE* |
| JGIcombinedJ13537_101070381 | 3300001097 | Hypersaline | MGDYLEGYVAALEDVLTSIVIENPDSVNAVRYLIRHMIDDSGSE* |
| Ga0075113_10448212 | 3300005910 | Saline Lake | MGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCVSE* |
| Ga0075109_10547742 | 3300005912 | Saline Lake | MGDYLEGYVQALDDVLTEIALENPDSVNAVRYLIRHMANDCTSE* |
| Ga0075109_10935953 | 3300005912 | Saline Lake | VSDYIDAYLDALHVVLTEIAIEKPDSVDAVCHLIWHMIDDTDSE* |
| Ga0075109_11012952 | 3300005912 | Saline Lake | MWVAVMGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCVSE* |
| Ga0075109_11269372 | 3300005912 | Saline Lake | DYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSK* |
| Ga0075109_11763872 | 3300005912 | Saline Lake | MGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDT |
| Ga0075109_11843811 | 3300005912 | Saline Lake | VSDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDT |
| Ga0075108_101266593 | 3300005913 | Saline Lake | VVVVSEYIDAYLDALHVVLTEIAIEKPDSVDAVCHLIWHMIDDTDSE* |
| Ga0075108_101377272 | 3300005913 | Saline Lake | VSDYIDAYLDALHVVLTEIAVEKPDSVDAVSHLIWHMIDDCVSE* |
| Ga0075108_101413342 | 3300005913 | Saline Lake | YLDALHVVLTEIAVEKPDSVDAVCHLIWHMIDDCVSE* |
| Ga0075108_101429492 | 3300005913 | Saline Lake | MGDYLGGYLTALDDVLTEIAVENPDSVNAVRYLIRHMIDDCGSE* |
| Ga0075108_101433263 | 3300005913 | Saline Lake | GYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSE* |
| Ga0075108_102172621 | 3300005913 | Saline Lake | MSVVVVSDYIDAYLDALHVVLTEIAVEKPDSVDAVCHLIWHMID |
| Ga0075108_102265532 | 3300005913 | Saline Lake | VSDYIDAYLDALHVVLTEIAVEKPDSVDAVCHLIWQMIDDCVSE* |
| Ga0075108_102378552 | 3300005913 | Saline Lake | MGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSK* |
| Ga0075108_103242152 | 3300005913 | Saline Lake | MGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDCVSE* |
| Ga0075108_103252353 | 3300005913 | Saline Lake | DAYLDALHVVLTEIAVEKPDSVDAVCHLIWHMIDDTDSE* |
| Ga0075117_10999921 | 3300005914 | Saline Lake | YLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSE* |
| Ga0075117_11014322 | 3300005914 | Saline Lake | VSEYIDAYLDALHVVLTEIAVEKPDSVDAVCHLIWHMIDDCVSE* |
| Ga0075117_11192743 | 3300005914 | Saline Lake | VSDYIDAYLDALHVVLTEIAVEKPDSVDAVCHLIWHMIDDTDSE* |
| Ga0075117_12357092 | 3300005914 | Saline Lake | MGDYLEGYLAALDDVLEEIAVENPDSVNAVRYLIRHMIDDCVSE* |
| Ga0075116_103334812 | 3300005918 | Saline Lake | VVVVNDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCVSE* |
| Ga0075119_10307902 | 3300005931 | Saline Lake | VSDYIDAYLDALHVVLTEIAVEKPDSVNDVCHLIWHMIDDCVSE* |
| Ga0075119_10476373 | 3300005931 | Saline Lake | VVSDYIDAYLDALHVVLTEIAVEKPDSVDAVCHLIWHMIDDCVSE* |
| Ga0075119_10487772 | 3300005931 | Saline Lake | MSVVVMGDYLEGYVQALDDVLTEIAVENPDSVNAVRYLIRHMIDDCVSE* |
| Ga0075119_10921482 | 3300005931 | Saline Lake | MWVAVMGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCGSE* |
| Ga0075119_10987942 | 3300005931 | Saline Lake | MGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRH |
| Ga0075119_11055282 | 3300005931 | Saline Lake | MLVVVMGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLI |
| Ga0075119_11132991 | 3300005931 | Saline Lake | ALHVVLTEIAIEKPDSVDAVCHLIWHMIDDCVSE* |
| Ga0075119_11170791 | 3300005931 | Saline Lake | DALHVVLTEIAVEKPDSVDAVCHLIWHMIDDCVSE* |
| Ga0075118_101851671 | 3300005933 | Saline Lake | VVVVSDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSE* |
| Ga0075124_102883592 | 3300005936 | Lake Water | VVVVNDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCGSE* |
| Ga0075110_10442083 | 3300007074 | Saline Lake | VSDYIDAYLDALHVVLTEIAVEKPDSVDAVCHLIWHMIDDCVSE* |
| Ga0075110_10655441 | 3300007074 | Saline Lake | TALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSE* |
| Ga0075110_10787071 | 3300007074 | Saline Lake | EGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSE* |
| Ga0075110_10850952 | 3300007074 | Saline Lake | MLVVIMGDYLEGYVQALDDVLTEIALENPDSVNAVRYLIRHMANDCTSE* |
| Ga0075110_10863412 | 3300007074 | Saline Lake | MGDYLEGYVAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCGSE* |
| Ga0075110_10925232 | 3300007074 | Saline Lake | MLVAVMGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDD |
| Ga0075110_10937461 | 3300007074 | Saline Lake | MGDYLEGYVQALDDVLTEIAVENPDSVNAVRYLIRHMANDC |
| Ga0075110_10965602 | 3300007074 | Saline Lake | DALHVVLTEIAVEKPDSVDAVCHLIWHMIDDTDSE* |
| Ga0075110_11034752 | 3300007074 | Saline Lake | VSDYIDAYLDALHVVLTEIAVEKPDSVEAVCHLIWHMIDDCVSE* |
| Ga0075110_11060762 | 3300007074 | Saline Lake | MWVVVMGDYLEGYVQALDDVLTEIALENPDSVNAVRYLIRHMANDCTSE* |
| Ga0075110_11316672 | 3300007074 | Saline Lake | MGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSE* |
| Ga0105050_103369812 | 3300007516 | Freshwater | MGDYLEGYLAALDDVLNEIAVEKPDSVNAVRYLIRHMIDDCGSE* |
| Ga0105050_108917171 | 3300007516 | Freshwater | MGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMAND |
| Ga0105055_105103732 | 3300007519 | Freshwater | MGEYLEGYLAALDDVLTEIAVEKPDSVNAVRYLIRHMIEDCGSE* |
| Ga0105055_105436482 | 3300007519 | Freshwater | VNDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMANDCGSE* |
| Ga0105055_105816972 | 3300007519 | Freshwater | MGDYLEGYLAALDDVLTEIEVENPDSVNAVRYLIRHMANDCNSE* |
| Ga0105055_106674712 | 3300007519 | Freshwater | EGYLAALDDVLTEIEVENPDSVNAVRYLIRHMANDCNSE* |
| Ga0105055_109833391 | 3300007519 | Freshwater | MGDYLEGYLAALDDVLAEIVIENPDSVNAVRHLIRHMIDDTGSE* |
| Ga0105054_103062042 | 3300007520 | Freshwater | MWVAVMGDYLEGYLAALDDVLTEIEVENPDSVNAVRYLIRHMANDCNSE* |
| Ga0105054_107608371 | 3300007520 | Freshwater | GYLAALDDVLAEIVIENPDSVNAVRHLIRHMIDDTGSE* |
| Ga0105053_109652591 | 3300007522 | Freshwater | AALDDVLTEIEVENPDSVNAVRYLIRHMANDCNSE* |
| Ga0105053_110216452 | 3300007522 | Freshwater | MGEYLEGYLAALDDVLAEIVIENPDSVNAVRYLIRHMIDDCGSE* |
| Ga0105053_111231363 | 3300007522 | Freshwater | MGDYLEGYLAALDDVLAEIVVENPDSVNAVRYLIRHMIDDTGSE* |
| Ga0105051_108908942 | 3300007722 | Freshwater | MGDYFEGYLAALDDVLTEIAVEKPDSVNAVRYLIRHMIDDCGSE* |
| Ga0105051_109395312 | 3300007722 | Freshwater | MGDYLEGYLAALDDVLTEIEVENPDSVNAVRYLIRHMAN |
| Ga0105051_112927951 | 3300007722 | Freshwater | MSVAVMGDYLEGYLAALDDVLTEIAVEKPDSVNAVRYLIRHMIDDCGSE* |
| Ga0222673_10327412 | 3300022821 | Saline Water | VVVVNDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCVSE |
| Ga0222669_10096232 | 3300022825 | Saline Water | MSVVVVSDYIDAYLDALHVVLTEIAVEKPDSVDAVCHLIWHMIDDCVSE |
| Ga0222711_10010374 | 3300022837 | Saline Water | VSDYIDAYLDALHVVLTEIAVEKPDSVDAVCHLIWHMIDDCVSE |
| Ga0222711_10052897 | 3300022837 | Saline Water | VSDYIDAYLDALHVVLTEIAVEKPDSVEAVCHLIWHMID |
| Ga0222687_10894231 | 3300022844 | Saline Water | LDALHVVLTEIAVEKPDSVDAVCHLIWHMIDDCVSE |
| Ga0222633_10299143 | 3300022847 | Saline Water | MWVAVMGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCV |
| Ga0222691_10099572 | 3300022851 | Saline Water | MWVAVMGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCGSE |
| Ga0222652_10183923 | 3300022853 | Saline Water | VVVVSEYIDAYLDALHVVLTEIAIEKPDSVDAVCHLIWHMIDDTDSE |
| Ga0222652_10458102 | 3300022853 | Saline Water | MLVVVMGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSK |
| Ga0222671_10553362 | 3300022856 | Saline Water | MGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLVRHMIDDCGSE |
| Ga0222672_10335672 | 3300022859 | Saline Water | MGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCGSE |
| Ga0222701_10147582 | 3300022884 | Saline Water | MGDYLEGYLAALDDVLEEIAVENPDSVNAVRYLIRHMIDDCVSE |
| Ga0222709_10032594 | 3300023230 | Saline Water | VVVVSDYIDAYLDALHVVLTEIAVEKPDSVDAVCHLIWHMIDDCVSE |
| Ga0222634_10018991 | 3300023235 | Saline Water | GDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCVSE |
| Ga0222639_10841862 | 3300023262 | Saline Water | MWVAVMGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCVSE |
| Ga0222688_10096432 | 3300023293 | Saline Water | VVVVSDYIDAYLDALHVVLTEIAVEKPDSVEAVCHLIWHMIDDTDSE |
| Ga0222664_10612812 | 3300023296 | Saline Water | VMGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCVSE |
| Ga0222640_10977123 | 3300023297 | Saline Water | VNDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCVSE |
| Ga0209414_10310412 | 3300023301 | Hypersaline | MGDYLEGYLAALEDVLTEIVIENPESVNAVRYLIRHMIDDSGSE |
| Ga0209414_10799651 | 3300023301 | Hypersaline | MGEYLEGYLAALDDVLTSIVIENPDSVNAVRYLIRHMIDDCGSE |
| Ga0209414_10839643 | 3300023301 | Hypersaline | MGDYLEGYLAALDDVLTSIVIENPDSVNAVRYLIRHMIDDSGSE |
| Ga0209414_11066342 | 3300023301 | Hypersaline | MGDYLEGYLAALDDVLTEIVIENPDSVSAVRYLIRHMIDDTGSE |
| Ga0208647_10344923 | 3300025362 | Saline Lake | VAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCGSE |
| Ga0208646_10023546 | 3300025425 | Saline Lake | MGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSK |
| Ga0208646_10191383 | 3300025425 | Saline Lake | MWVVVMGDYLEGYVQALDDVLTEIALENPDSVNAVRYLIRHMANDCTSE |
| Ga0208646_10228592 | 3300025425 | Saline Lake | MLVAVMGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSE |
| Ga0208646_10332072 | 3300025425 | Saline Lake | MSVVVMGDYLEGYVQALDDVLTEIAVENPDSVNAVRYLIRHMIDDCVSE |
| Ga0208646_10456912 | 3300025425 | Saline Lake | VSEYIDAYLDALHVVLTEIAIEKPDSVDAVCHLIWHMIDDCVSE |
| Ga0208646_10516902 | 3300025425 | Saline Lake | MGDYLEGYVQALDDVLTEIAVENPDSVNAVRYLIRHMANDCTSE |
| Ga0208646_10543622 | 3300025425 | Saline Lake | MGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDCVSE |
| Ga0208646_10605321 | 3300025425 | Saline Lake | MLVVIMGDYLEGYVQALDDVLTEIALENPDSVNAVRYLIRHMANDCTSE |
| Ga0208646_10606831 | 3300025425 | Saline Lake | VSDYIDAYLDALHVVLTEIAVEKPDSVDAVCHLIWHMIDD |
| Ga0208646_10720232 | 3300025425 | Saline Lake | GATSVAVMGDYLGGYLTALDDVLTEIAVENPDSVNAVRYLIRHMIDDCGSE |
| Ga0208770_10228431 | 3300025438 | Saline Lake | YLDALHVVLTEIAVEKPDSVDAVCHLIWHMIDDTDSE |
| Ga0208770_10453812 | 3300025438 | Saline Lake | VSDYIDAYLDALHVVLTEIAVEKPDSVNDVCHLIWHMIDDCVSE |
| Ga0208770_10673781 | 3300025438 | Saline Lake | VVVVSEYIDAYLDALHVVLTEIAIEKPDSVDAVCHLIWHMIDDCVSE |
| Ga0208903_10651581 | 3300025502 | Saline Lake | VMGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSE |
| Ga0208903_10989751 | 3300025502 | Saline Lake | MLVVVMGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRH |
| Ga0208413_10780902 | 3300025513 | Saline Lake | MWVAVMGDYLEGYRTALHDVLAEIAVEQPDSVKTACYLIRHMIDDTDSK |
| Ga0208768_11625662 | 3300025601 | Saline Lake | IDAYLDALHVVLTEIAVEKPDSVDAVCHLIWQMIDDCVSE |
| Ga0209491_1003844511 | 3300027832 | Freshwater | MGDYLEGYLAALDDVLTEIEVENPDSVNAVRYLIRHMANDCNSE |
| Ga0209491_103163823 | 3300027832 | Freshwater | MGDYLEGYLAALDDVLAEIVVENPDSVNAVRYLIRHMANDCTSE |
| Ga0209491_104203912 | 3300027832 | Freshwater | MGDYLEGYLAALDDVLAEIVIENPDSVNAVRHLIRHMIDDTGSE |
| Ga0209491_105146062 | 3300027832 | Freshwater | AVMGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCGSE |
| Ga0209491_105628962 | 3300027832 | Freshwater | DVYLAALDDVLAEIVIENPDSVNAVRHLIRHMIDDTGSE |
| Ga0209390_102358372 | 3300027848 | Freshwater | MWVAVMGDYLEGYLAALDDVLTEIEVENPDSVNAVRYLIRHMANDCNSE |
| Ga0209702_101110293 | 3300027976 | Freshwater | MGDYLEGYLAALDDVLTEIAVEKPDSVNAVRYLIRHMIDDCGSE |
| Ga0209702_101361692 | 3300027976 | Freshwater | MGDYLEGYLAALDDVLNEIAVEKPDSVNAVRYLIRHMIDDCGSE |
| Ga0209702_102478802 | 3300027976 | Freshwater | MGDYLEGYLAALDDVLTEIEVEKPDSVNAVRYLIRHMANDCTSE |
| Ga0209702_103036782 | 3300027976 | Freshwater | MGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMIDDCTSE |
| Ga0209702_104001041 | 3300027976 | Freshwater | MGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIR |
| Ga0335398_105248083 | 3300032435 | Freshwater | TSVAVMGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHMVNDCTSE |
| Ga0335398_106547512 | 3300032435 | Freshwater | MGEYLEGYLAALDDVLTEIAVEKPDSVNAVRYLIRHMIEDCGSE |
| Ga0335398_107412241 | 3300032435 | Freshwater | MGDYLEGYLAALDDVLAEIVIENPDSVNAVRYLIRHMANDCTSE |
| Ga0335396_104285223 | 3300032462 | Freshwater | MGDYLEGYLAALDDVLTEIAVENPDSVNAVRYLIRHM |
| Ga0335396_105998221 | 3300032462 | Freshwater | MGDYFEGYLAALDDVLTEIAVEKPDSVNAVRYLIRHMIDDCGSE |
| ⦗Top⦘ |