| Basic Information | |
|---|---|
| Family ID | F075696 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 118 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 43.22 % |
| % of genes near scaffold ends (potentially truncated) | 52.54 % |
| % of genes from short scaffolds (< 2000 bps) | 87.29 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.458 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (36.441 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.729 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.898 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 89.36% β-sheet: 0.00% Coil/Unstructured: 10.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01541 | GIY-YIG | 2.54 |
| PF04434 | SWIM | 1.69 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 1.69 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 1.69 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 1.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.54 % |
| Unclassified | root | N/A | 47.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000736|JGI12547J11936_1095028 | Not Available | 541 | Open in IMG/M |
| 3300000756|JGI12421J11937_10160183 | Not Available | 549 | Open in IMG/M |
| 3300000929|NpDRAFT_10020225 | All Organisms → Viruses → Predicted Viral | 4411 | Open in IMG/M |
| 3300001282|B570J14230_10123228 | Not Available | 760 | Open in IMG/M |
| 3300002408|B570J29032_109290065 | Not Available | 674 | Open in IMG/M |
| 3300002835|B570J40625_100052300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5780 | Open in IMG/M |
| 3300002835|B570J40625_100147167 | All Organisms → Viruses → Predicted Viral | 2702 | Open in IMG/M |
| 3300002835|B570J40625_100487117 | All Organisms → Viruses → Predicted Viral | 1164 | Open in IMG/M |
| 3300003277|JGI25908J49247_10016095 | All Organisms → Viruses → Predicted Viral | 2278 | Open in IMG/M |
| 3300003277|JGI25908J49247_10087513 | Not Available | 761 | Open in IMG/M |
| 3300003395|JGI25917J50250_1071944 | Not Available | 723 | Open in IMG/M |
| 3300003411|JGI25911J50253_10175863 | Not Available | 601 | Open in IMG/M |
| 3300003412|JGI25912J50252_10032476 | All Organisms → Viruses → Predicted Viral | 1561 | Open in IMG/M |
| 3300003413|JGI25922J50271_10052242 | Not Available | 915 | Open in IMG/M |
| 3300003430|JGI25921J50272_10094602 | Not Available | 636 | Open in IMG/M |
| 3300003488|JGI25919J51413_1016080 | Not Available | 581 | Open in IMG/M |
| 3300003491|JGI25924J51412_1036593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300003491|JGI25924J51412_1074428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
| 3300003616|JGI25928J51866_1063072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
| 3300003986|Ga0063233_10067446 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300004126|Ga0066179_10150597 | Not Available | 629 | Open in IMG/M |
| 3300004763|Ga0007746_1008746 | All Organisms → Viruses → Predicted Viral | 2555 | Open in IMG/M |
| 3300004765|Ga0007745_1361938 | Not Available | 580 | Open in IMG/M |
| 3300004790|Ga0007758_11187900 | Not Available | 692 | Open in IMG/M |
| 3300004790|Ga0007758_11193010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300004793|Ga0007760_10946508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300005580|Ga0049083_10018559 | All Organisms → Viruses → Predicted Viral | 2508 | Open in IMG/M |
| 3300005580|Ga0049083_10274904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300005582|Ga0049080_10035873 | All Organisms → Viruses → Predicted Viral | 1725 | Open in IMG/M |
| 3300005582|Ga0049080_10052950 | All Organisms → Viruses → Predicted Viral | 1401 | Open in IMG/M |
| 3300005583|Ga0049085_10083628 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
| 3300005584|Ga0049082_10111059 | Not Available | 959 | Open in IMG/M |
| 3300005584|Ga0049082_10141176 | Not Available | 837 | Open in IMG/M |
| 3300005662|Ga0078894_10286010 | All Organisms → Viruses → Predicted Viral | 1496 | Open in IMG/M |
| 3300005662|Ga0078894_10423541 | All Organisms → Viruses → Predicted Viral | 1201 | Open in IMG/M |
| 3300005662|Ga0078894_10481890 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300005662|Ga0078894_10895089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300005662|Ga0078894_10943920 | Not Available | 746 | Open in IMG/M |
| 3300005662|Ga0078894_11129915 | Not Available | 667 | Open in IMG/M |
| 3300007593|Ga0102918_1286189 | Not Available | 508 | Open in IMG/M |
| 3300007629|Ga0102895_1140890 | Not Available | 625 | Open in IMG/M |
| 3300007634|Ga0102901_1215922 | Not Available | 539 | Open in IMG/M |
| 3300007644|Ga0102902_1260364 | Not Available | 509 | Open in IMG/M |
| 3300008108|Ga0114341_10266922 | Not Available | 911 | Open in IMG/M |
| 3300008950|Ga0102891_1147240 | Not Available | 698 | Open in IMG/M |
| 3300009052|Ga0102886_1257796 | Not Available | 511 | Open in IMG/M |
| 3300009068|Ga0114973_10285420 | Not Available | 882 | Open in IMG/M |
| 3300009152|Ga0114980_10132995 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
| 3300009152|Ga0114980_10145193 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
| 3300009158|Ga0114977_10460550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300009159|Ga0114978_10164396 | All Organisms → Viruses → Predicted Viral | 1421 | Open in IMG/M |
| 3300009159|Ga0114978_10700166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
| 3300009164|Ga0114975_10122964 | All Organisms → Viruses → Predicted Viral | 1494 | Open in IMG/M |
| 3300009164|Ga0114975_10127953 | All Organisms → Viruses → Predicted Viral | 1461 | Open in IMG/M |
| 3300009184|Ga0114976_10071366 | All Organisms → Viruses → Predicted Viral | 2013 | Open in IMG/M |
| 3300010374|Ga0114986_1052630 | Not Available | 738 | Open in IMG/M |
| 3300010885|Ga0133913_12832434 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| 3300012663|Ga0157203_1038852 | Not Available | 655 | Open in IMG/M |
| 3300013295|Ga0170791_11818016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300013372|Ga0177922_10975971 | Not Available | 514 | Open in IMG/M |
| 3300017722|Ga0181347_1047877 | All Organisms → Viruses → Predicted Viral | 1295 | Open in IMG/M |
| 3300017722|Ga0181347_1144075 | Not Available | 653 | Open in IMG/M |
| 3300017778|Ga0181349_1257459 | Not Available | 580 | Open in IMG/M |
| 3300019784|Ga0181359_1003587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4787 | Open in IMG/M |
| 3300020141|Ga0211732_1031964 | Not Available | 1484 | Open in IMG/M |
| 3300020141|Ga0211732_1438053 | All Organisms → Viruses → Predicted Viral | 1342 | Open in IMG/M |
| 3300020141|Ga0211732_1465241 | All Organisms → Viruses → Predicted Viral | 1904 | Open in IMG/M |
| 3300020160|Ga0211733_10107813 | Not Available | 998 | Open in IMG/M |
| 3300020161|Ga0211726_10973378 | Not Available | 689 | Open in IMG/M |
| 3300020161|Ga0211726_11067341 | Not Available | 679 | Open in IMG/M |
| 3300020205|Ga0211731_10885122 | Not Available | 560 | Open in IMG/M |
| 3300020505|Ga0208088_1009600 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
| 3300020528|Ga0208224_1049473 | Not Available | 511 | Open in IMG/M |
| 3300020562|Ga0208597_1013361 | All Organisms → Viruses → Predicted Viral | 2065 | Open in IMG/M |
| 3300020562|Ga0208597_1052133 | Not Available | 769 | Open in IMG/M |
| 3300024348|Ga0244776_10078305 | All Organisms → Viruses → Predicted Viral | 2511 | Open in IMG/M |
| 3300024348|Ga0244776_10273201 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| 3300024348|Ga0244776_10661368 | Not Available | 650 | Open in IMG/M |
| 3300027125|Ga0255106_1028205 | Not Available | 793 | Open in IMG/M |
| 3300027132|Ga0255110_1018357 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
| 3300027147|Ga0255113_1097399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300027246|Ga0208931_1085942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300027301|Ga0255127_1015922 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
| 3300027333|Ga0255138_1017917 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300027375|Ga0255137_1009552 | All Organisms → Viruses → Predicted Viral | 2402 | Open in IMG/M |
| 3300027563|Ga0209552_1078796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300027563|Ga0209552_1088373 | Not Available | 840 | Open in IMG/M |
| 3300027563|Ga0209552_1194075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300027581|Ga0209651_1159754 | Not Available | 607 | Open in IMG/M |
| 3300027586|Ga0208966_1073396 | Not Available | 956 | Open in IMG/M |
| 3300027589|Ga0255123_1009183 | All Organisms → Viruses → Predicted Viral | 2322 | Open in IMG/M |
| 3300027608|Ga0208974_1035798 | All Organisms → Viruses → Predicted Viral | 1478 | Open in IMG/M |
| 3300027621|Ga0208951_1170288 | Not Available | 558 | Open in IMG/M |
| 3300027621|Ga0208951_1181365 | Not Available | 534 | Open in IMG/M |
| 3300027631|Ga0208133_1097487 | Not Available | 688 | Open in IMG/M |
| 3300027642|Ga0209135_1125738 | Not Available | 843 | Open in IMG/M |
| 3300027642|Ga0209135_1129546 | Not Available | 826 | Open in IMG/M |
| 3300027644|Ga0209356_1020611 | All Organisms → Viruses → Predicted Viral | 2232 | Open in IMG/M |
| 3300027679|Ga0209769_1143988 | Not Available | 756 | Open in IMG/M |
| 3300027689|Ga0209551_1132496 | Not Available | 790 | Open in IMG/M |
| 3300027732|Ga0209442_1228026 | Not Available | 676 | Open in IMG/M |
| 3300027733|Ga0209297_1142822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 990 | Open in IMG/M |
| 3300027734|Ga0209087_1164234 | Not Available | 881 | Open in IMG/M |
| 3300027744|Ga0209355_1073290 | All Organisms → Viruses → Predicted Viral | 1602 | Open in IMG/M |
| 3300027756|Ga0209444_10194624 | Not Available | 740 | Open in IMG/M |
| 3300027759|Ga0209296_1003214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11186 | Open in IMG/M |
| 3300027759|Ga0209296_1316019 | Not Available | 615 | Open in IMG/M |
| 3300027770|Ga0209086_10081893 | All Organisms → Viruses → Predicted Viral | 1699 | Open in IMG/M |
| 3300027772|Ga0209768_10314366 | Not Available | 653 | Open in IMG/M |
| 3300027797|Ga0209107_10186623 | All Organisms → Viruses → Predicted Viral | 1032 | Open in IMG/M |
| 3300027798|Ga0209353_10040363 | All Organisms → Viruses → Predicted Viral | 2156 | Open in IMG/M |
| 3300027798|Ga0209353_10380722 | Not Available | 583 | Open in IMG/M |
| 3300033992|Ga0334992_0179198 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
| 3300033992|Ga0334992_0338892 | Not Available | 692 | Open in IMG/M |
| 3300033994|Ga0334996_0155361 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300033995|Ga0335003_0120626 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
| 3300034063|Ga0335000_0261456 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
| 3300034082|Ga0335020_0072123 | All Organisms → Viruses → Predicted Viral | 1783 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 36.44% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.71% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 9.32% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.93% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.69% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.69% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.85% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.85% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.85% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.85% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300003488 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003616 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004765 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300027125 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027132 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027147 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027246 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027301 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027333 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300027375 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027589 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12547J11936_10950281 | 3300000736 | Freshwater And Sediment | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACAL |
| JGI12421J11937_101601831 | 3300000756 | Freshwater And Sediment | KLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA* |
| NpDRAFT_100202251 | 3300000929 | Freshwater And Marine | MQDTKSKIDSLMLQLQAVLEDAELDEHETIQNAFNALACALDEEVV* |
| B570J14230_101232282 | 3300001282 | Freshwater | MQSTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIA* |
| B570J29032_1092900651 | 3300002408 | Freshwater | TKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIA* |
| B570J40625_10005230015 | 3300002835 | Freshwater | MQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIQ* |
| B570J40625_1001471678 | 3300002835 | Freshwater | TMQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIQ* |
| B570J40625_1004871171 | 3300002835 | Freshwater | MQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIA* |
| JGI25908J49247_100160955 | 3300003277 | Freshwater Lake | MQNTKSKLDSLMLQLQAVLDEAELDEHVAIQNAFNALACALDDTIIA* |
| JGI25908J49247_100875131 | 3300003277 | Freshwater Lake | MQNTKSTLDSLMLQLQAVLDDAGLDEHVAIQNAFNALACALDDTIIA* |
| JGI25917J50250_10719442 | 3300003395 | Freshwater Lake | DSLMLQLQAVLDEAELDEHVAIQNAFNALACALDDTIIA* |
| JGI25911J50253_101758631 | 3300003411 | Freshwater Lake | MQNTKSTLDSLMLQLQAVLDEAGLDEHETIQNAFNALACALDEEIIA* |
| JGI25912J50252_100324765 | 3300003412 | Freshwater Lake | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDEEI |
| JGI25922J50271_100522422 | 3300003413 | Freshwater Lake | MQNTKSTLDSLMLQLQAVLDDAGLDEXVAVQNAFNALAVELDEALA* |
| JGI25921J50272_100946022 | 3300003430 | Freshwater Lake | MQNTKSTLDSLMLQLQAVLDDAGLDEHVAVQNAFNALAVELDEVLI* |
| JGI25919J51413_10160801 | 3300003488 | Freshwater Lake | MQNTKSTLDSLMLQLQAVLDEAGLDEHETIQNAFNALACALDEEII |
| JGI25924J51412_10365932 | 3300003491 | Freshwater Lake | TMQNTKSKLDSLMLQLQAVLEEAELDEXVAIQNAFNALACALDDTIIA* |
| JGI25924J51412_10744282 | 3300003491 | Freshwater Lake | GNTMQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDEEIIA* |
| JGI25928J51866_10630722 | 3300003616 | Freshwater Lake | TMQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA* |
| Ga0063233_100674461 | 3300003986 | Freshwater Lake | MQNTKSKLDSLMLQLQAVLDEAELDEHVAIQNAFNALACALDDTII |
| Ga0066179_101505971 | 3300004126 | Freshwater Lake | QNTKSTLDSLMLQLQAVLDDAGLDEHVAIQNAFNALACALDDTIIA* |
| Ga0007746_10087469 | 3300004763 | Freshwater Lake | MQNTKSKLDSLMLQLQAVLEDAELGEHETIQNAFNALACALDEELIPV* |
| Ga0007745_13619381 | 3300004765 | Freshwater Lake | NTMQNTKSKLDSLMLQLQAVLEDAELGEHETIQNAFNALACALDEELIPV* |
| Ga0007758_111879002 | 3300004790 | Freshwater Lake | MQDTKSKIDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIA* |
| Ga0007758_111930101 | 3300004790 | Freshwater Lake | DSLMLQLQAVLDEAGLDEHETIQNAFNALACALDEEIIA* |
| Ga0007760_109465082 | 3300004793 | Freshwater Lake | KQTMQNTKSTLDSLMLQLQAVLDEAGLDEHETIQNAFNALACALDEEIIA* |
| Ga0049083_100185593 | 3300005580 | Freshwater Lentic | MQNTKSKLDSLMLQLQAVLDEAELDEHVAIQNAFNALACALDEEVV* |
| Ga0049083_102749042 | 3300005580 | Freshwater Lentic | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDEEIIA* |
| Ga0049080_100358731 | 3300005582 | Freshwater Lentic | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTI |
| Ga0049080_100529501 | 3300005582 | Freshwater Lentic | NTMQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIQ* |
| Ga0049085_100836283 | 3300005583 | Freshwater Lentic | MQNTKSTLDSLMLQLQAVLDEAGLDEHETIQNAFNALACALDEEITA* |
| Ga0049082_101110591 | 3300005584 | Freshwater Lentic | MQNTKSKLDSLMLQLQAVLEEAELDEHETIQNAFNALACALDDTIIA* |
| Ga0049082_101411763 | 3300005584 | Freshwater Lentic | MQNTKSKLDSLMLQLQTVLEEAELDEHVATQNAFNALACALDDTIIA* |
| Ga0078894_102860104 | 3300005662 | Freshwater Lake | MQNTKSTLDSLMLQLQAVLDDAGLDEHVAVQNAFNALAVELDEALA* |
| Ga0078894_104235411 | 3300005662 | Freshwater Lake | TLDSLMLQLQAVLDDAGLDEHVAVQNAFNALAVELDEVLI* |
| Ga0078894_104818902 | 3300005662 | Freshwater Lake | MQDTKSKIDSLMLQLQAVLDEAELDEHETIQNAFNALACALDEEVV* |
| Ga0078894_108950893 | 3300005662 | Freshwater Lake | TKSTLDSLMLQLQAVLDDAGLDEHVAVQNAFNALAIELDEALA* |
| Ga0078894_109439201 | 3300005662 | Freshwater Lake | MLQLQALIDEEFEYNESIQNAFNALACALDEELYE* |
| Ga0078894_111299151 | 3300005662 | Freshwater Lake | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA* |
| Ga0102918_12861891 | 3300007593 | Estuarine | MQNTKSTLDSLMLQLQAVLDDAGLDEHVAIQNAFNALACALD |
| Ga0102895_11408903 | 3300007629 | Estuarine | MQNTKSTLDSLMLQLQAVLDDAGLDEHVAIQNAFNALAVELDEALI* |
| Ga0102901_12159222 | 3300007634 | Estuarine | MQNTKSTLDSLMLQLQAVLDDAGLDEHVAIQNAFNALAVELDEALA* |
| Ga0102902_12603642 | 3300007644 | Estuarine | MQNTKSTLDSLMLQLQAVLDAAGLDEHVAIQNAFNALACALDDTIIA* |
| Ga0114341_102669222 | 3300008108 | Freshwater, Plankton | MQNTKSKLDSLMLQLQAVLEDAGLDEHETIQNAFNALACALDDTIIA* |
| Ga0102891_11472401 | 3300008950 | Estuarine | NTMQNTKSKLDSLMLQLQAVLEDAELDEHETIQNAFNALACALDEEVV* |
| Ga0102886_12577961 | 3300009052 | Estuarine | SLMLQLQAVLDDAGLDEHVAIQNAFNALACALDEEVV* |
| Ga0114973_102854203 | 3300009068 | Freshwater Lake | MQNTKSKLDSLMLQLQAVLDEAGLDEHVAIQNAFNALACALDDTIIA* |
| Ga0114980_101329952 | 3300009152 | Freshwater Lake | MQDTKSKIDSLMLQLQAVLEDAELGEHETIQNAFNALACALDEEVV* |
| Ga0114980_101451931 | 3300009152 | Freshwater Lake | KSKLDSLMLQLQTVLEEAELDEHETIQNAFNALACALDEEITA* |
| Ga0114977_104605501 | 3300009158 | Freshwater Lake | MQNTKSKLDSLMLQLQTVLEEAELDEHETIQNAFNALACALDEEITA* |
| Ga0114978_101643961 | 3300009159 | Freshwater Lake | KSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA* |
| Ga0114978_107001662 | 3300009159 | Freshwater Lake | DSLMLQLQAVLDEAGLDEHETIQNAFNALACALDEEITA* |
| Ga0114975_101229643 | 3300009164 | Freshwater Lake | MQNTKRTLDSLMLQLQAVLDEAGLDEHVAIQNAFNALACALDDTIIA* |
| Ga0114975_101279534 | 3300009164 | Freshwater Lake | MLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA* |
| Ga0114976_100713665 | 3300009184 | Freshwater Lake | MQNTTSKLDSLMLQLQTVLEEAELDEHETIQNAFNALACALDEEITA* |
| Ga0114986_10526302 | 3300010374 | Deep Subsurface | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDEEITA* |
| Ga0133913_128324344 | 3300010885 | Freshwater Lake | DSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA* |
| Ga0157203_10388523 | 3300012663 | Freshwater | LMLQLQDVLETVGLDEHERIQNAFNALAMELDDAVF* |
| Ga0170791_118180161 | 3300013295 | Freshwater | DSLMLQLQAVLDDAGLDEHVAVQNAFNALAVELDEALA* |
| Ga0177922_109759711 | 3300013372 | Freshwater | NRKQTMQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDEEVV* |
| Ga0181347_10478773 | 3300017722 | Freshwater Lake | MQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDEEITA |
| Ga0181347_11440751 | 3300017722 | Freshwater Lake | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAYNALACALDEEIIA |
| Ga0181349_12574591 | 3300017778 | Freshwater Lake | LSNKGNTMQNTKSKLDSLMLQLQAVLEDAELGEHETIQNAFNALACALDEELIPV |
| Ga0181359_100358710 | 3300019784 | Freshwater Lake | MQNTKSTLDSLMLQLQAVLDEAGLDEHETIQNAFNALACALDEEIIA |
| Ga0211732_10319643 | 3300020141 | Freshwater | MQNTKSKLDSLMLQLQAVLDDAGLDEHETIQNAFNALACALDDTIIA |
| Ga0211732_14380533 | 3300020141 | Freshwater | MQNTKRTLDSLMLQLQAVLDEAGLDEHVAIQNAFNALACALDDTIIA |
| Ga0211732_14652413 | 3300020141 | Freshwater | MQDTKSKIDSLMLQLQAVLEDAEMGEHETIQNAFNALACALDEEVV |
| Ga0211733_101078132 | 3300020160 | Freshwater | MQNTKRTLDSLMLQLQAVLDEAGLDEHVAIQNAFNALACALDDTIIT |
| Ga0211726_109733783 | 3300020161 | Freshwater | MQNTKSKLDSLMLQLQAVLDDAGLDEHETIQNAFNALACALDDTI |
| Ga0211726_110673411 | 3300020161 | Freshwater | HAKITHVMLDLQRLLDDALLDEHEAIQNAFNALACALDDELVE |
| Ga0211731_108851222 | 3300020205 | Freshwater | MQNTKSKLDSLMLQLQAVLEDAELDEHETIQNAFNALACALDEEIIA |
| Ga0208088_10096002 | 3300020505 | Freshwater | MQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIQ |
| Ga0208224_10494732 | 3300020528 | Freshwater | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0208597_10133616 | 3300020562 | Freshwater | QRNTMQNTKSTLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0208597_10521331 | 3300020562 | Freshwater | SNKGNTMQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIQ |
| Ga0244776_100783057 | 3300024348 | Estuarine | MQDTKSKIDSLMLQLQAVLEDAELDEHETIQNAFNALACALDEEVV |
| Ga0244776_102732014 | 3300024348 | Estuarine | MQNTKSKLDSLMLQLQAVLEDAELDEHETIQNAFNALACALDEEVV |
| Ga0244776_106613682 | 3300024348 | Estuarine | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDEEIIA |
| Ga0255106_10282052 | 3300027125 | Freshwater | MQNTKSKLDSLMLQLQAVLDEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0255110_10183571 | 3300027132 | Freshwater | MQNTKSTLDSLMLQLQAVLDEAGLDEHETIQNAFNALACALDEEITA |
| Ga0255113_10973992 | 3300027147 | Freshwater | KQTMQNTKSKLDSLMLQLQTVLEEAELDEHIAIQNAFNALACALDDTIIA |
| Ga0208931_10859422 | 3300027246 | Estuarine | MQNTKSKLDSLMLQLQAVLDDAGLDEHVAIQNAFNALAVELDEALA |
| Ga0255127_10159221 | 3300027301 | Freshwater | QTMQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDEEITA |
| Ga0255138_10179171 | 3300027333 | Freshwater | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIE |
| Ga0255137_10095521 | 3300027375 | Freshwater | RKQTMQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0209552_10787961 | 3300027563 | Freshwater Lake | LMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0209552_10883731 | 3300027563 | Freshwater Lake | MQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDEEIIA |
| Ga0209552_11940752 | 3300027563 | Freshwater Lake | LMLQLQAVLEEAELDEHVAIQNAFNALACALDEEIIA |
| Ga0209651_11597542 | 3300027581 | Freshwater Lake | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTII |
| Ga0208966_10733964 | 3300027586 | Freshwater Lentic | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALA |
| Ga0255123_10091837 | 3300027589 | Freshwater | KQTMQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0208974_10357981 | 3300027608 | Freshwater Lentic | LDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0208951_11702882 | 3300027621 | Freshwater Lentic | LREQKMQNTKSKLDSLMLQLQAVLDEAELDEHVAIQNAFNALACALDEEVV |
| Ga0208951_11813652 | 3300027621 | Freshwater Lentic | QNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0208133_10974872 | 3300027631 | Estuarine | MQNTKSTLDSLMLQLQAVLDDAGLDEHVAIQNAFNALACALDDTIIA |
| Ga0209135_11257381 | 3300027642 | Freshwater Lake | KGNTMQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0209135_11295461 | 3300027642 | Freshwater Lake | KGNTMQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDEEIIA |
| Ga0209356_10206111 | 3300027644 | Freshwater Lake | LMLQLQAVLDEAELDEHETIQNAFNALACALDEELIPV |
| Ga0209769_11439881 | 3300027679 | Freshwater Lake | MLQLQAVLEDAELGEHETIQNAFNALACALDEELIPV |
| Ga0209551_11324963 | 3300027689 | Freshwater Lake | MLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0209442_12280262 | 3300027732 | Freshwater Lake | RKQKMQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDEEVV |
| Ga0209297_11428222 | 3300027733 | Freshwater Lake | MQDTKSKIDSLMLQLQAVLEDAELGEHETIQNAFNALACALDEEVV |
| Ga0209087_11642342 | 3300027734 | Freshwater Lake | MQDTKSKIDSLMLQLQAVLDEAELDEHETIQNAFNALACALDEEVV |
| Ga0209355_10732901 | 3300027744 | Freshwater Lake | LQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0209444_101946241 | 3300027756 | Freshwater Lake | MQNTKSKLDSLMLQLQAVLDEAELDEHETIQNAFNALACALDEELIPV |
| Ga0209296_10032149 | 3300027759 | Freshwater Lake | MQNTKSKLDSLMLQLQTVLEEAELDEHETIQNAFNALACALDEEITA |
| Ga0209296_13160192 | 3300027759 | Freshwater Lake | MQNTKSTLDSLMLQLQAVLDDAGLDEHVAIQNAFNAL |
| Ga0209086_100818932 | 3300027770 | Freshwater Lake | MQNTKSKLDSLMLQLQAVLDEAGLDEHVAIQNAFNALACALDDTIIA |
| Ga0209768_103143662 | 3300027772 | Freshwater Lake | SLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0209107_101866234 | 3300027797 | Freshwater And Sediment | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNA |
| Ga0209353_100403636 | 3300027798 | Freshwater Lake | TKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDEEIIA |
| Ga0209353_103807222 | 3300027798 | Freshwater Lake | MQNTKSKLDSLMLQLQAVLEEAELDEHVAIQNAFNALAC |
| Ga0334992_0179198_937_1068 | 3300033992 | Freshwater | KSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0334992_0338892_2_139 | 3300033992 | Freshwater | MQNTKSTLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTII |
| Ga0334996_0155361_1_108 | 3300033994 | Freshwater | LQLQAVLEQAGLDEHERIQNAFNALAIELDDTIIA |
| Ga0335003_0120626_409_552 | 3300033995 | Freshwater | MQNTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0335000_0261456_874_1017 | 3300034063 | Freshwater | MQSTKSKLDSLMLQLQTVLEEAELDEHVAIQNAFNALACALDDTIIA |
| Ga0335020_0072123_1126_1269 | 3300034082 | Freshwater | MQNTKSTLDSLMLQLQAVLEEAELDEHVAIQNAFNALACALDDTIIA |
| ⦗Top⦘ |