| Basic Information | |
|---|---|
| Family ID | F075505 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 38 residues |
| Representative Sequence | LGGEEETAIGSVKMEGCKRMRAVANVDVFEAEALGWYL |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 12.82 % |
| % of genes near scaffold ends (potentially truncated) | 10.17 % |
| % of genes from short scaffolds (< 2000 bps) | 99.15 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.458 % of family members) |
| Environment Ontology (ENVO) | Unclassified (97.458 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (97.458 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.85% β-sheet: 0.00% Coil/Unstructured: 65.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 97.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0157378_127736501 | 3300013297 | Miscanthus Rhizosphere | LGGEEETAIGSVKIEGCKRIRAATNIDVFEAKALGWYLKT* |
| Ga0182122_10304461 | 3300015267 | Miscanthus Phyllosphere | LRGGEEETAIGSIKVEGCRRMRAIANVDVFEAKALGWYL* |
| Ga0182122_10451312 | 3300015267 | Miscanthus Phyllosphere | LGGEEEITTGSMKMEGRKRKRAVANVDVFEAEALGWYL* |
| Ga0182154_10684931 | 3300015268 | Miscanthus Phyllosphere | LRGGEEETAIGSVKVEERRRMRAVANIDVFEAEALRWYL* |
| Ga0182113_10629832 | 3300015269 | Miscanthus Phyllosphere | GGEEETATRSMKMEGCERVRAVANVDVLEAEALGWYL* |
| Ga0182113_10671042 | 3300015269 | Miscanthus Phyllosphere | LKVKLETATGFVKMERRKRMRAVANVDVFEAEALGWYL* |
| Ga0182188_10576092 | 3300015274 | Miscanthus Phyllosphere | LGGEDETAIGSMKMEGRKRMRAVANIDVFEVKALGWYL* |
| Ga0182172_10736041 | 3300015275 | Miscanthus Phyllosphere | LGGEEEIAIGSMKVEGCKRMRAVANVDVFEAEALGWYL* |
| Ga0182170_10006542 | 3300015276 | Miscanthus Phyllosphere | LGGEEETATGSVKMEGCKRMRAVANVDVFEAEALGWYL* |
| Ga0182170_10524551 | 3300015276 | Miscanthus Phyllosphere | LRGGEEETAIGSVKMEGCKRMRVVANVDVFEAKTLGWYL* |
| Ga0182128_10694992 | 3300015277 | Miscanthus Phyllosphere | LREGEEETAIGPVMVEGCRGMRAVANVDVFEAKALG* |
| Ga0182174_10136251 | 3300015279 | Miscanthus Phyllosphere | LRGGEEETAIGSVKMEGHRRMRAVANVDVFEAETLSW |
| Ga0182174_10411492 | 3300015279 | Miscanthus Phyllosphere | VETAIGSVKVEGRMRIRAVANVDVFEAEALGWYL* |
| Ga0182160_10844151 | 3300015281 | Miscanthus Phyllosphere | LGGEEETTIGSMKMEGGKRMRAVANVDVFEAEALGWYL* |
| Ga0182124_10197182 | 3300015282 | Miscanthus Phyllosphere | LGGEEETAIGSVKMEGHKRMRAVANVDVFEAEALGWYL* |
| Ga0182124_10324492 | 3300015282 | Miscanthus Phyllosphere | LRGEEETVTGSVKMEGRKRIRAVANVDVFEGETLGWYL* |
| Ga0182124_10351501 | 3300015282 | Miscanthus Phyllosphere | LGGEEETAIGSVKIEGCKRTRTVANVDVFEAEALGWYL* |
| Ga0182156_10323352 | 3300015283 | Miscanthus Phyllosphere | LRGGEEETTTGLMKMEGRKRMRAVANVDVFEAEALGWYL* |
| Ga0182156_10393461 | 3300015283 | Miscanthus Phyllosphere | LGGEEETATGSVKMEGHKKMRAVANVDVFEAEVLG* |
| Ga0182186_10357731 | 3300015285 | Miscanthus Phyllosphere | LGGEEETAIGSVKMEGHKRMRAAANVDVLEAETLGWYL* |
| Ga0182176_10197421 | 3300015286 | Miscanthus Phyllosphere | EEETTIGSMKMEGGKRMRAVANVDVFEAEALGWYL* |
| Ga0182176_10538332 | 3300015286 | Miscanthus Phyllosphere | LGGEEETAIGFVKMEGCKRMRVVANVDVIEAKALGWYL* |
| Ga0182171_10091562 | 3300015287 | Miscanthus Phyllosphere | LGGEEETTIGSMKMEGHKRMRAVANVDVFEAEALG* |
| Ga0182171_10155742 | 3300015287 | Miscanthus Phyllosphere | LRGGEEEIAIGSMNMEGHRRMRAVANIDVFEAKTLG* |
| Ga0182173_10823952 | 3300015288 | Miscanthus Phyllosphere | LGGEVETATWSMKMEGGKRMRAVANVDVFEAEAHGWYL* |
| Ga0182125_10199322 | 3300015291 | Miscanthus Phyllosphere | LGGEEETATGSVEMEGCKRMRAVANIDVFEDEALDWYL* |
| Ga0182125_10654311 | 3300015291 | Miscanthus Phyllosphere | LGGEEETAIGSVKMEGCKRMRAVANVDVFEAEALGWYL* |
| Ga0182141_10065004 | 3300015292 | Miscanthus Phyllosphere | LRRGEETTTGSVKMEGRKKIRAVANVDMFEAEALG |
| Ga0182141_10128512 | 3300015292 | Miscanthus Phyllosphere | LGGEEETAIGYVKMEGCKGMRAVANIDVFEAEALD* |
| Ga0182141_10195321 | 3300015292 | Miscanthus Phyllosphere | LGGEEETATGSVEMEGGKRMRAVANVDVFEAEALGWYL* |
| Ga0182141_10922842 | 3300015292 | Miscanthus Phyllosphere | LRGGEEETATGSMRVEGHKRMRAVANVDVFEAEALGWYL* |
| Ga0182157_10372251 | 3300015296 | Miscanthus Phyllosphere | LGGEEETAIGSMKMEGCKRMRAVANVDVFEAEALGWYL* |
| Ga0182157_10423711 | 3300015296 | Miscanthus Phyllosphere | LGEEEETAIGSVKMEGRKRIRAVANVDVFEAEALGWYL* |
| Ga0182157_10482391 | 3300015296 | Miscanthus Phyllosphere | LGGEEETATGSMKMEGHKRIRAVANIDVFETDALGWYLL* |
| Ga0182157_10732411 | 3300015296 | Miscanthus Phyllosphere | LGGEEKIATRFVMMEGCKRMRVVANVDVFEAKALGWYL* |
| Ga0182106_10092921 | 3300015298 | Miscanthus Phyllosphere | LGGEEETAIGFVKMEGCKRMRAVADVDVFEAEALG* |
| Ga0182106_10300822 | 3300015298 | Miscanthus Phyllosphere | LRGGEEEIAIGSVKMEGHKRMRAAANVDVLEAETLGWYL* |
| Ga0182106_10767451 | 3300015298 | Miscanthus Phyllosphere | LGGEEETATGSVKMEGHKKMRAVANVDVFEAKALGWYL* |
| Ga0182107_10189982 | 3300015299 | Miscanthus Phyllosphere | LRGGEEETAIGSMKVEGHRRMRAVANVDMFEAEALGWYL* |
| Ga0182107_11016761 | 3300015299 | Miscanthus Phyllosphere | LGGEEEIATGSMKLEGRERMRAVANVDVFEVEALGWYL* |
| Ga0182108_10152812 | 3300015300 | Miscanthus Phyllosphere | LGGEEETAIGSMKMEGHKRMRAVANVDVFEAEALGWYL* |
| Ga0182108_10771081 | 3300015300 | Miscanthus Phyllosphere | LRGGEEEIAIGSVKMEGRKRMRRVANVDVFEAKALGWY |
| Ga0182123_10669402 | 3300015303 | Miscanthus Phyllosphere | LGGEEETITGSVKMEGCKRMSAFANVDVFEAEALGWYL* |
| Ga0182112_10225532 | 3300015304 | Miscanthus Phyllosphere | LGGEEETATGSMKMEGRKRMRAVANVDVFEADALG* |
| Ga0182158_10795212 | 3300015305 | Miscanthus Phyllosphere | LGGEEETAIGAMKMEGHKRMRAVANVDVFEAEALGWYL* |
| Ga0182144_10534761 | 3300015307 | Miscanthus Phyllosphere | LGGEEETATGSVEMEGCKRMRAVTNVYVFEAEALGWYL* |
| Ga0182144_11086381 | 3300015307 | Miscanthus Phyllosphere | LRGGEEKTAIGSVKVEGDKIIRAVANVNVFEVKALG* |
| Ga0182142_10132592 | 3300015308 | Miscanthus Phyllosphere | LRGGEEETAIGSVKVEGCRRMRAIANVDVFEAETLGWYL* |
| Ga0182142_10569092 | 3300015308 | Miscanthus Phyllosphere | AIEFIGSTKTRRETATGFVKAEKCKGIGAVASIDVFEAGALGWYL* |
| Ga0182140_11116211 | 3300015314 | Miscanthus Phyllosphere | LKIKSDTATGFVKMERRKRMRAVANIDMFEAEALGWYL* |
| Ga0182127_10221643 | 3300015321 | Miscanthus Phyllosphere | VKLETATGFVKMERRKRMRAVANVDVFEAEALGWYL* |
| Ga0182127_10878822 | 3300015321 | Miscanthus Phyllosphere | LRGGEEETAIGSMKVEGCKRLRVVANVDVFEAEALGWYL* |
| Ga0182127_11218221 | 3300015321 | Miscanthus Phyllosphere | LGGEEETTIGSMKMEGGNRMRVVANVNVFEAEALGWYL* |
| Ga0182110_10650832 | 3300015322 | Miscanthus Phyllosphere | LGGEEETAIGSVKMEGHKRMRAVANVDVFEAKALGWYL* |
| Ga0182129_10545261 | 3300015323 | Miscanthus Phyllosphere | LGEEEKTATGSVKMEGCKKMRAVANVDVFEAEALGWYL* |
| Ga0182129_10691752 | 3300015323 | Miscanthus Phyllosphere | LGGDEETATGSMKMEGCKRMRAVANVDVFEAEALGWYL* |
| Ga0182187_11988142 | 3300015341 | Miscanthus Phyllosphere | LGGEEETAIGSVKMEGRKRMREVTNVDVFEAKALGRYL* |
| Ga0182109_11882752 | 3300015342 | Miscanthus Phyllosphere | EETAIGSMEMEGCKRMRVVANVDMFEAKALGWYS* |
| Ga0182109_12242731 | 3300015342 | Miscanthus Phyllosphere | LGGEEETATGFVKMEGHKRMRAVANIDVFKAEALSWYL* |
| Ga0182155_11866351 | 3300015343 | Miscanthus Phyllosphere | LRGGEEETATGFVKVEGCKRMGAVANVDVFEAETLG* |
| Ga0182189_11306301 | 3300015344 | Miscanthus Phyllosphere | LRGGEEETAIGSMKVEGHKRMRAVANVDVFEVEALGWYL* |
| Ga0182189_11379642 | 3300015344 | Miscanthus Phyllosphere | LGGEEKTATRSVKMEGCKRMRAVANVDVFEAEALGWYL* |
| Ga0182189_12282222 | 3300015344 | Miscanthus Phyllosphere | LREGEEETAIGPVMVEGCRGMRAVANVDVFEAKALGWYL* |
| Ga0182111_11045271 | 3300015345 | Miscanthus Phyllosphere | LGGEEETATGFVKMEGHKRMRAVANIDVFEAKALDWYL* |
| Ga0182111_11364702 | 3300015345 | Miscanthus Phyllosphere | LGGEEEIATGSMKMEGCKRMRAAANVDVFEAKALGWYL* |
| Ga0182111_11635161 | 3300015345 | Miscanthus Phyllosphere | LRGGEEETAIGSMKVEGCRRMRAVANVDVFEAETLG* |
| Ga0182111_11943072 | 3300015345 | Miscanthus Phyllosphere | LGGEEETATGSVEMEEHKRMRAVANVDVFEAEGLGWYS* |
| Ga0182139_11271341 | 3300015346 | Miscanthus Phyllosphere | LGGEEKIATRFVMMEGCKRMRVVANVDVFEGKALGWYL* |
| Ga0182139_11580011 | 3300015346 | Miscanthus Phyllosphere | LRGGDEETAIGSMKVEGHKRMRAVANVDVFEVEAL |
| Ga0182177_11941511 | 3300015347 | Miscanthus Phyllosphere | LGGEEETATESVKMEGCKRMRAVANVDVLEAKALGWYL* |
| Ga0182161_12209281 | 3300015351 | Miscanthus Phyllosphere | LRGGEEETAIEFVKVEGRRRMRAVANVDVFEAEALGWYL* |
| Ga0182159_12290511 | 3300015355 | Miscanthus Phyllosphere | LRGGEEETAIGFVKMEGCKRMRAVANVDVFEGETLG* |
| Ga0182145_10413051 | 3300015361 | Miscanthus Phyllosphere | LRGGEEETAIGSVKMKGHKRMRAVANVDVFEAEALG* |
| Ga0182145_11210992 | 3300015361 | Miscanthus Phyllosphere | LGGEEETAIGSAKMEGRKRMRAVTNVDVFEAKALGRYL* |
| Ga0182145_11504921 | 3300015361 | Miscanthus Phyllosphere | GGEEETAIGFVKMEGCKRMRAFANVDVFEAEALGWYL* |
| Ga0182203_10379592 | 3300017404 | Miscanthus Phyllosphere | LRGGEEETATGSMRVEGHKRMRAVANVDVFEAEALGWYL |
| Ga0182203_11524822 | 3300017404 | Miscanthus Phyllosphere | EEETTTGSMKMEGCKRKRVVANVDVFEAEALGWYL |
| Ga0182220_10616851 | 3300017407 | Miscanthus Phyllosphere | MGGEEETAIGSMEMEGRKRMRAVANIDVFEAEDFGWYL |
| Ga0182204_10541422 | 3300017409 | Miscanthus Phyllosphere | LGGEEKTATGSVKMERRKRMREVANVDVFEAEALG |
| Ga0182207_11574092 | 3300017410 | Miscanthus Phyllosphere | LGGEEETSIGSVKMEGHKRMRVVANVDVFEAKALGWYL |
| Ga0182208_10150982 | 3300017411 | Miscanthus Phyllosphere | LGGEEEIAIGSVKMEGRKRMRRVANVDVFEAKALGWYL |
| Ga0182208_10853481 | 3300017411 | Miscanthus Phyllosphere | LKGGEEETAIGSMKVEGCRRMRAVANIEVFEAEALGWYL |
| Ga0182208_10888413 | 3300017411 | Miscanthus Phyllosphere | LRGGEEETAIGSMKVEGCRRMRAIANVDVFEAEALGWYL |
| Ga0182222_10187272 | 3300017413 | Miscanthus Phyllosphere | LGGEEETAIGSVKMEGHKRMRAVANVDVFEAETLGWYL |
| Ga0182222_10484931 | 3300017413 | Miscanthus Phyllosphere | LRVKSETAIGFVKMEGCKRMRAFANVDVFEAEALGWYL |
| Ga0182202_10244661 | 3300017415 | Miscanthus Phyllosphere | LGGDEETATGSMKMEGCKRMRAVANVDVFEAEALGWYL |
| Ga0182202_10292631 | 3300017415 | Miscanthus Phyllosphere | LGGEEETAIGSMKMEGCKRMRAVANVDVFEAEALA |
| Ga0182202_11100281 | 3300017415 | Miscanthus Phyllosphere | LGGEEETAIGFVKMEGCKRMRAVANVDVFEAETLGWYL |
| Ga0182230_10447071 | 3300017417 | Miscanthus Phyllosphere | MGGEEETAIGSMEMEGRKRMRAVANVDVFEAKALGWYL |
| Ga0182219_10312622 | 3300017424 | Miscanthus Phyllosphere | LGGEEETAIGFVKMEGCKRMRAFANVDVFEAEALGWYL |
| Ga0182224_11151932 | 3300017425 | Miscanthus Phyllosphere | LRGGEEETAIGSMKVEGHKRMRAVANVDVLEVEALGWYL |
| Ga0182224_11162941 | 3300017425 | Miscanthus Phyllosphere | LRGGEEEIAIGSMNMEGHRRMRAVANIDVFEAEALG |
| Ga0182190_10869742 | 3300017427 | Miscanthus Phyllosphere | LRRGEEETTIGSVKIEGCKRIRAATNIDVFEAEALGWYL |
| Ga0182190_11303871 | 3300017427 | Miscanthus Phyllosphere | LGGEEETTIESMKMEGHKRMRAVANVDVFEAKALGWYL |
| Ga0182190_11307302 | 3300017427 | Miscanthus Phyllosphere | GEEETATRSMKMEGCKRVRAVANIDVFKAEALGWYL |
| Ga0182192_11000711 | 3300017430 | Miscanthus Phyllosphere | LGGEEKIATRFVKMEGCKRMRAVANVDVLEAKALGWYL |
| Ga0182206_10020382 | 3300017433 | Miscanthus Phyllosphere | LGGEEETATGSVEMEGGKRMRAVANVDVFEAEALGWYL |
| Ga0182206_10269871 | 3300017433 | Miscanthus Phyllosphere | LGGEEKTATWSMKMEGHRRMRAVANIDVFEAEALG |
| Ga0182206_11409402 | 3300017433 | Miscanthus Phyllosphere | LRGGKEETAIGSVKVGGCRRMRAFANIDVFEAEALGWYL |
| Ga0182209_10919452 | 3300017436 | Miscanthus Phyllosphere | LGGEEETAIGFVKMEGHKRMRAVANVDVFEAKALGWYL |
| Ga0182209_11374321 | 3300017436 | Miscanthus Phyllosphere | LGGEEETAIGYVKMEGCKGMRAVANIDVFEDEALDWYL |
| Ga0182191_10549411 | 3300017438 | Miscanthus Phyllosphere | LGEEETIIGFVKMEGHKRMRAVANIDVFEAEALGWYL |
| Ga0182191_10989251 | 3300017438 | Miscanthus Phyllosphere | LGGEEETAIGFVKMEGCKRMRAVANVDVFEGETLGWYL |
| Ga0182191_11520242 | 3300017438 | Miscanthus Phyllosphere | LGGEEKIATRFVMMEGCKRMRVVANVDVFEAKALGWYL |
| Ga0182221_10418091 | 3300017442 | Miscanthus Phyllosphere | LGGEEEIAIGSVKMEGCKRMRAVANVDVFEAEALGWYL |
| Ga0182221_11341381 | 3300017442 | Miscanthus Phyllosphere | LRGGEEETAIGSVKMEGCRRMRAVVNVDVFEAIALGWYL |
| Ga0182221_11659361 | 3300017442 | Miscanthus Phyllosphere | LGGEEETAIGSVKMEGRKRMREVTNVDVFEAKALGRYL |
| Ga0182193_10784262 | 3300017443 | Miscanthus Phyllosphere | LGGEEETAIGSVKMEGHKRMRAVANVDVFEAKALGWYL |
| Ga0182193_11471812 | 3300017443 | Miscanthus Phyllosphere | LGGEEETAIGSMKMEGCKRMRAVANVDVFEAEALGWYL |
| Ga0182229_10560471 | 3300017682 | Miscanthus Phyllosphere | LKVKSETATGFVKMERCKRMRAVANVDVFEAEALGWYL |
| Ga0182218_11477691 | 3300017683 | Miscanthus Phyllosphere | LGGDKETATGSMKIEGCKRMRAVANVDVFEAEALSWYL |
| Ga0182225_11228441 | 3300017684 | Miscanthus Phyllosphere | LGGEEETAIGSVKMEGHKRMRVVANVDVIEAKALGWYL |
| Ga0182227_10439822 | 3300017685 | Miscanthus Phyllosphere | LGGEEETAIGSVKMEGHKRMRAVANVDVFEAEALGWYL |
| Ga0182223_10477392 | 3300017690 | Miscanthus Phyllosphere | LRGGEEKTAIGFVKGEGCRRMRELANVDVFEVKALG |
| Ga0182223_10610142 | 3300017690 | Miscanthus Phyllosphere | LGGEEETTIGSMKMEGHKRMRAVANVDVFEAEALG |
| Ga0182223_11073752 | 3300017690 | Miscanthus Phyllosphere | LGGEEETAIGSVKMEGRKRMRAVANIDVFEAEALGWYL |
| Ga0207643_104447341 | 3300025908 | Miscanthus Rhizosphere | LREGEEETAIGPVMVEGCRGMRAVANVDVFEAEALGWYL |
| Ga0207689_117362811 | 3300025942 | Miscanthus Rhizosphere | LGGEEEIAIGSMKMEGRKRMRAVANVDVFEAEALG |
| ⦗Top⦘ |