NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075477

Metagenome / Metatranscriptome Family F075477

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075477
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 45 residues
Representative Sequence MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLD
Number of Associated Samples 96
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 93.22 %
% of genes near scaffold ends (potentially truncated) 97.48 %
% of genes from short scaffolds (< 2000 bps) 77.31 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (56.303 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(31.092 % of family members)
Environment Ontology (ENVO) Unclassified
(64.706 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(51.261 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.73%    β-sheet: 0.00%    Coil/Unstructured: 60.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00082Peptidase_S8 16.81
PF136402OG-FeII_Oxy_3 5.88
PF16861Carbam_trans_C 5.04
PF00565SNase 5.04
PF07235DUF1427 3.36
PF02369Big_1 2.52
PF11397GlcNAc 0.84
PF02467Whib 0.84
PF08241Methyltransf_11 0.84
PF02543Carbam_trans_N 0.84
PF00694Aconitase_C 0.84
PF00296Bac_luciferase 0.84
PF01467CTP_transf_like 0.84
PF01471PG_binding_1 0.84
PF07739TipAS 0.84
PF00011HSP20 0.84
PF00255GSHPx 0.84
PF02627CMD 0.84
PF00106adh_short 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG4317Xanthosine utilization system component, XapX domainNucleotide transport and metabolism [F] 3.36
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.84
COG0386Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxidesDefense mechanisms [V] 0.84
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.84
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.84
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.84
COG2192Predicted carbamoyl transferase, NodU familyGeneral function prediction only [R] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.39 %
UnclassifiedrootN/A33.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559019|stn_contig01330All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300000756|JGI12421J11937_10011145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3447Open in IMG/M
3300000756|JGI12421J11937_10068799Not Available1069Open in IMG/M
3300002296|B570J29587_1001619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2096Open in IMG/M
3300002835|B570J40625_100747764All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage867Open in IMG/M
3300003412|JGI25912J50252_10084754All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300004789|Ga0007752_11174311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage843Open in IMG/M
3300005580|Ga0049083_10044354Not Available1576Open in IMG/M
3300005662|Ga0078894_10778972Not Available838Open in IMG/M
3300006030|Ga0075470_10058787All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1173Open in IMG/M
3300007590|Ga0102917_1206172All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage686Open in IMG/M
3300007625|Ga0102870_1169060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300007627|Ga0102869_1091138Not Available835Open in IMG/M
3300007630|Ga0102903_1227199All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage505Open in IMG/M
3300007716|Ga0102867_1023811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1580Open in IMG/M
3300007974|Ga0105747_1021543Not Available1769Open in IMG/M
3300007974|Ga0105747_1079155Not Available1005Open in IMG/M
3300008107|Ga0114340_1239261All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage565Open in IMG/M
3300008108|Ga0114341_10005927Not Available24974Open in IMG/M
3300008108|Ga0114341_10101498Not Available1748Open in IMG/M
3300008110|Ga0114343_1002626Not Available36406Open in IMG/M
3300008110|Ga0114343_1215921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage541Open in IMG/M
3300008267|Ga0114364_1130351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage730Open in IMG/M
3300008450|Ga0114880_1102435All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1104Open in IMG/M
3300009024|Ga0102811_1076633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1254Open in IMG/M
3300009152|Ga0114980_10469175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage718Open in IMG/M
3300009155|Ga0114968_10354378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage809Open in IMG/M
3300009159|Ga0114978_10093061Not Available1999Open in IMG/M
3300009160|Ga0114981_10226021All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1023Open in IMG/M
3300009163|Ga0114970_10015809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5171Open in IMG/M
3300009180|Ga0114979_10265233All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1026Open in IMG/M
3300010370|Ga0129336_10007753Not Available6619Open in IMG/M
3300010370|Ga0129336_10444242All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage704Open in IMG/M
3300010885|Ga0133913_10668905Not Available2720Open in IMG/M
3300010885|Ga0133913_11084059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2064Open in IMG/M
3300011995|Ga0153800_1007958All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300012665|Ga0157210_1023285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage992Open in IMG/M
3300013004|Ga0164293_10139643All Organisms → Viruses → Predicted Viral1813Open in IMG/M
3300013004|Ga0164293_10427755All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage886Open in IMG/M
3300013005|Ga0164292_10137157Not Available1803Open in IMG/M
3300013005|Ga0164292_10213782All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1364Open in IMG/M
3300020141|Ga0211732_1487015All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage672Open in IMG/M
3300020151|Ga0211736_10195907Not Available1223Open in IMG/M
3300020151|Ga0211736_10398029All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage617Open in IMG/M
3300020151|Ga0211736_10398674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1022422Open in IMG/M
3300020151|Ga0211736_10428305All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage748Open in IMG/M
3300020151|Ga0211736_10927492All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1113Open in IMG/M
3300020162|Ga0211735_10052595Not Available4658Open in IMG/M
3300020172|Ga0211729_10564497Not Available1303Open in IMG/M
3300020205|Ga0211731_11225857Not Available5757Open in IMG/M
3300020506|Ga0208091_1000356Not Available8922Open in IMG/M
3300020511|Ga0208593_1000852Not Available4709Open in IMG/M
3300020553|Ga0208855_1029656All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage766Open in IMG/M
3300020556|Ga0208486_1030636All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage811Open in IMG/M
3300020574|Ga0208221_1043865All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300023184|Ga0214919_10600245All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage650Open in IMG/M
3300024346|Ga0244775_10913281Not Available697Open in IMG/M
3300024348|Ga0244776_10578537All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300025732|Ga0208784_1218321All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage553Open in IMG/M
3300027121|Ga0255074_1041675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300027153|Ga0255083_1061390Not Available728Open in IMG/M
3300027192|Ga0208673_1042913All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage735Open in IMG/M
3300027227|Ga0208929_1101211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300027305|Ga0208168_1049994All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage905Open in IMG/M
3300027418|Ga0208022_1060230All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage823Open in IMG/M
3300027525|Ga0208437_1023439All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1554Open in IMG/M
3300027586|Ga0208966_1060492All Organisms → Viruses → Predicted Viral1070Open in IMG/M
3300027631|Ga0208133_1077647All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage784Open in IMG/M
3300027659|Ga0208975_1029196All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1770Open in IMG/M
3300027697|Ga0209033_1034878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1904Open in IMG/M
3300027772|Ga0209768_10053060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2124Open in IMG/M
3300027782|Ga0209500_10059815Not Available2000Open in IMG/M
3300027797|Ga0209107_10298937Not Available758Open in IMG/M
3300027798|Ga0209353_10213748Not Available841Open in IMG/M
3300027892|Ga0209550_10598944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage647Open in IMG/M
3300027971|Ga0209401_1204447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage735Open in IMG/M
3300028027|Ga0247722_10134165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage899Open in IMG/M
(restricted) 3300028114|Ga0247835_1116105Not Available1017Open in IMG/M
3300028178|Ga0265593_1174503All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
(restricted) 3300028581|Ga0247840_10076614Not Available2352Open in IMG/M
(restricted) 3300028581|Ga0247840_10189666All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1174Open in IMG/M
(restricted) 3300029286|Ga0247841_10068457Not Available3142Open in IMG/M
3300029349|Ga0238435_110830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage833Open in IMG/M
3300031857|Ga0315909_10381717Not Available1017Open in IMG/M
3300031857|Ga0315909_10455095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage898Open in IMG/M
3300031963|Ga0315901_10413685All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1077Open in IMG/M
3300032050|Ga0315906_10004822All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17138Open in IMG/M
3300032050|Ga0315906_10303431Not Available1437Open in IMG/M
3300032092|Ga0315905_11446343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300032116|Ga0315903_11210898All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage508Open in IMG/M
3300033816|Ga0334980_0230521Not Available735Open in IMG/M
3300034012|Ga0334986_0469732All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage624Open in IMG/M
3300034019|Ga0334998_0635045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300034062|Ga0334995_0051500All Organisms → Viruses → Predicted Viral3364Open in IMG/M
3300034066|Ga0335019_0361479All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage896Open in IMG/M
3300034068|Ga0334990_0024777All Organisms → Viruses → Predicted Viral3195Open in IMG/M
3300034082|Ga0335020_0052354Not Available2147Open in IMG/M
3300034082|Ga0335020_0211210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage968Open in IMG/M
3300034093|Ga0335012_0071887All Organisms → Viruses → Predicted Viral1967Open in IMG/M
3300034093|Ga0335012_0119278Not Available1460Open in IMG/M
3300034102|Ga0335029_0102784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2014Open in IMG/M
3300034102|Ga0335029_0131276Not Available1734Open in IMG/M
3300034103|Ga0335030_0154352Not Available1632Open in IMG/M
3300034103|Ga0335030_0394697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102899Open in IMG/M
3300034105|Ga0335035_0659646All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage543Open in IMG/M
3300034106|Ga0335036_0238189Not Available1239Open in IMG/M
3300034108|Ga0335050_0306185All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage756Open in IMG/M
3300034110|Ga0335055_0014748All Organisms → Viruses → Predicted Viral3652Open in IMG/M
3300034112|Ga0335066_0415756Not Available731Open in IMG/M
3300034112|Ga0335066_0486011Not Available657Open in IMG/M
3300034167|Ga0335017_0052370Not Available2410Open in IMG/M
3300034167|Ga0335017_0511341All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300034200|Ga0335065_0078830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2259Open in IMG/M
3300034272|Ga0335049_0180334All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1495Open in IMG/M
3300034272|Ga0335049_0489093All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage786Open in IMG/M
3300034283|Ga0335007_0198748All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1394Open in IMG/M
3300034356|Ga0335048_0056247Not Available2515Open in IMG/M
3300034356|Ga0335048_0527516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage560Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater31.09%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine10.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater9.24%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake8.40%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.88%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton5.04%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater4.20%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.52%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.52%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment2.52%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.68%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.68%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.68%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.68%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.68%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.84%
Stentor AmethystinusEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus0.84%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.84%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.84%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559019Stentor MTG 1EnvironmentalOpen in IMG/M
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300002296Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003412Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DDEnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007625Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02EnvironmentalOpen in IMG/M
3300007627Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011995Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020486Freshwater microbial communities from Lake Mendota, WI - 20AUG2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020506Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020511Freshwater microbial communities from Lake Mendota, WI - 15JUL2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020556Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020574Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027153Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8hEnvironmentalOpen in IMG/M
3300027192Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes)EnvironmentalOpen in IMG/M
3300027227Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027305Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028027Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FCEnvironmentalOpen in IMG/M
3300028114 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5mEnvironmentalOpen in IMG/M
3300028178Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36mEnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300029349Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034108Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157EnvironmentalOpen in IMG/M
3300034110Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M
3300034200Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
stn_001144802166559019Stentor AmethystinusFFIGFNRDLARLNNAHRINSQSYPPYDILKLDEDTYRIS
JGI12421J11937_1001114513300000756Freshwater And SedimentMVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPY
JGI12421J11937_1006879913300000756Freshwater And SedimentMVNTTYTMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPP
B570J29587_100161913300002296FreshwaterMDLFNDPFFIGFNRELNRLNTAHKTNSQSYPPYDLIKLDEDT
B570J40625_10074776433300002835FreshwaterMVSVIKHPMDLLNDPFFIGFNRELNRLNSAHKTNSQSYPPYDLLKLD
JGI25912J50252_1008475413300003412Freshwater LakeMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYRLS
Ga0007752_1117431133300004789Freshwater LakeMNATNFAMDLFNDPFFIGFNRDLARLNNAHKVNSQSYPPYDILKLDEDTY
Ga0049083_1004435413300005580Freshwater LenticMVNTTYTMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDLLKLD
Ga0078894_1077897213300005662Freshwater LakeMVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFP
Ga0075470_1005878733300006030AqueousMTTQLLDLFNDPFFIGFNRELGRLNNAHKINSQSYPP
Ga0102917_120617213300007590EstuarineMHMNATNFAMDLFNDPFFIGFNRDLARLNNAHKVNSQ
Ga0102870_116906023300007625EstuarineMVNTFGMDLFRDPFFIGFNREVERFNSLHQINRGAFPPYDLLK
Ga0102869_109113823300007627EstuarineMVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDN
Ga0102903_122719913300007630EstuarineMVSATNFAMDLFNDPFFIGFNRELGRLNTAHKTNSQSYPPYDLLKLDEDTFRLSIAVAG
Ga0102867_102381133300007716EstuarineMNATNFAMDLFNDPFFIGFNRDLARLNNAHKVNSQSYPPYDILKLD
Ga0105747_102154363300007974Estuary WaterMVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDLLKLDEDTYR
Ga0105747_107915543300007974Estuary WaterMVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDLLKL
Ga0114340_123926113300008107Freshwater, PlanktonMVVTHAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTYRISIAVA
Ga0114341_10005927233300008108Freshwater, PlanktonMVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDNYLQK*
Ga0114341_1010149813300008108Freshwater, PlanktonMVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDNY
Ga0114343_1002626233300008110Freshwater, PlanktonMVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDNYVFGLQVRLQK*
Ga0114343_121592123300008110Freshwater, PlanktonMVNKLTMDLFNDPFFIGFNKELNRLNTAHKTNSHSY
Ga0114364_113035123300008267Freshwater, PlanktonMVNKLTMDLFNDPFFIGFNRELGRLNTVYKTNSQSYPPYDLLKL
Ga0114880_110243553300008450Freshwater LakeMVTNLTMDLFNDPFFIGWNRELSRLNNAHRTNSQSYPPYDLLKLDEDT
Ga0102811_107663313300009024EstuarineMVTTTLDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTY
Ga0114980_1046917513300009152Freshwater LakeMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDL
Ga0114968_1035437843300009155Freshwater LakeMVVTHAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDT
Ga0114978_1009306163300009159Freshwater LakeMVTQFAMDLFNDPFFIGFNRELSRLNTAHKVNSQSYPPYDLLKLD
Ga0114981_1022602133300009160Freshwater LakeMVTQFAMDLFNDPFFIGFNRELSRLNTAHKVNSQSYPPYDL
Ga0114970_1001580913300009163Freshwater LakeMVTQFAMDLFNDPFFIGFNRELSRLSTAHKVNSQSYPPYDL
Ga0114979_1026523313300009180Freshwater LakeMVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQSYPPYDLLK
Ga0129336_10007753103300010370Freshwater To Marine Saline GradientMVTQFAMDLFRDPFFIGFNRELERMANVHNTASRQSYPPYDVLKLDEDTYQVQLAV
Ga0129336_1044424223300010370Freshwater To Marine Saline GradientMVTQFAMDLFKDPFFIGFNKELERLNAVYNLGSRNSYPPYDIQQLD
Ga0133913_1066890513300010885Freshwater LakeMDLLNDPFFIGFNRELGRLNTAHKTNLQSYPPYDLLKLDEDTY
Ga0133913_1108405963300010885Freshwater LakeMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLD
Ga0153800_100795813300011995FreshwaterMDLFNDPFFIGFNRELGRLNSAHKVNSQSYPPYDLLKLDEDTYR
Ga0157210_102328513300012665FreshwaterMVSVIKHPMDLLNDPFFIGFNRELNRLNSAHKTNSQSYPPYD
Ga0164293_1013964313300013004FreshwaterMVTQFAMDLFNDPFFIGFNRELSRLNHAHKLNSQSYPPYDLLKLDEDTFRLSIA
Ga0164293_1042775533300013004FreshwaterMVSVIKHPMDLLNDPFFIGFNRELNRLNSAHKTNSQSYPPYDLLKLDEDTY
Ga0164292_1013715763300013005FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYR
Ga0164292_1021378253300013005FreshwaterMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYR
Ga0211732_148701513300020141FreshwaterMVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDD
Ga0211736_1019590713300020151FreshwaterMVTTTLDLFNDPFFIGFNRELGRLNTAHKTNLQTYP
Ga0211736_1039802913300020151FreshwaterMVNKLTMDLFNDPFFIGFNRELNRLNTAHKTNSQSYPP
Ga0211736_1039867413300020151FreshwaterMVTKYAMDLFNDPFFIGFNRELNRLNTAHKTNSQSYPP
Ga0211736_1042830523300020151FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPP
Ga0211736_1092749253300020151FreshwaterMVTKYAMDLFNDPFFIGFNRDLNRLNTAHKTNLQTYPPYDLLKLD
Ga0211735_10052595103300020162FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKTNSQAYPPYDLLKLDEDTY
Ga0211729_1056449743300020172FreshwaterMVNAIKHPMDLFNDPFFIGFNRELNRLNSAHKTNSQSYPP
Ga0211731_11225857203300020205FreshwaterMVTKYAMDLFNDPFFIGFNRELNRLNTAHKTNSQSYPPYDLLK
Ga0208698_10661653300020486FreshwaterMVTQFMDLFNDPFFIGFNRDLARLNNIHREAINESYPPYDVLQHDND
Ga0208091_1000356233300020506FreshwaterMVTQFAMDLFNDPFFIGFNRDLARLNNAHKINSQSYPPYDLLK
Ga0208593_100085213300020511FreshwaterMVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDNYQ
Ga0208855_102965623300020553FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPY
Ga0208486_103063643300020556FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTY
Ga0208221_104386533300020574FreshwaterMVTQFAMDLFNDPFFIGFNRDLARLNSAHKINSQSYPPYDLLKLDEDTYRLS
Ga0214919_1060024513300023184FreshwaterLFNDPFFIGFNRELGRLSTAHKINSQSYPPYDLLKLDEDTYRIF
Ga0244775_1091328113300024346EstuarineMVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAF
Ga0244776_1057853723300024348EstuarineMVNKLTMDLFNDPFFIGFNRELGRLNTAYKTNSQSYPPYDLLKLDEDTYQISL
Ga0208784_121832123300025732AqueousVVTQFAMDLFRDPFFIGFNRDLERMANVHQTASRQTYPPYDVLKLDEDTFQVS
Ga0255074_104167513300027121FreshwaterMVTTTLDLFNDPFFIGFNRELSRLNNAHKTNLQTYPPYDLLKLDEDTYR
Ga0255083_106139013300027153FreshwaterMVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTY
Ga0208673_104291313300027192EstuarineMVTTTLDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTYQI
Ga0208929_110121113300027227EstuarineMVTTTLDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTYQIS
Ga0208168_104999413300027305EstuarineMVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDL
Ga0208022_106023013300027418EstuarineMVVTHAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLD
Ga0208437_102343953300027525EstuarineMVTTTLDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLK
Ga0208966_106049223300027586Freshwater LenticMVTTFAMDLFKDPFFIGFNRELDRLNQAHSINAGGFPPYDLLKLDD
Ga0208133_107764733300027631EstuarineMVNQFAMDLFNDPFFIGFNRELGRLNTAHKTNLQSYPPYDLLKLDEDT
Ga0208975_102919613300027659Freshwater LenticMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLK
Ga0209033_103487843300027697Freshwater LakeMVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYD
Ga0209768_1005306013300027772Freshwater LakeMDLFNDPFFIGFNRELSRLNNAHKVNSQSYPPYDLLKLDEDTY
Ga0209500_1005981513300027782Freshwater LakeMVTQFAMDLFNDPFFIGFNRELSRLNTAHKVNSQSYPPYDLLKL
Ga0209107_1029893713300027797Freshwater And SedimentMVNTTYTMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDLLKLDE
Ga0209353_1021374843300027798Freshwater LakeMVNTTYTMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDL
Ga0209550_1059894443300027892Freshwater LakeMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDT
Ga0209401_120444743300027971Freshwater LakeMVTQFAMDLFNDPFFIGFNRELSRLNTAHKVNSQSYPPYDLLKLDEDTYRLSLAIA
Ga0247722_1013416513300028027Deep Subsurface SedimentMVTKLAMDLFNDPFFIGFNRDLARLNNAHRINSQSYPPYD
(restricted) Ga0247835_111610513300028114FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKINSQSYPPYDLLKLDEDTYRLSLAIA
Ga0265593_117450313300028178Saline WaterMVTQFAMDLFNDPFFIGFNRELSRLNTAHKVNSQSYPPYDLLK
(restricted) Ga0247840_1007661413300028581FreshwaterMDLFNDPFFIGFNRELGRLNTAHKINSQSYPPYDLLKLDEDTYRLS
(restricted) Ga0247840_1018966633300028581FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDE
(restricted) Ga0247841_1006845793300029286FreshwaterMVTKYAMDLFNDPFFIGFGRELSRLNGAYKTNSQSYP
Ga0238435_11083013300029349FreshwaterMVTTFAMDLFKDPFFIGFNRELDRLNQAHSINAGGFPPYDL
Ga0315909_1038171723300031857FreshwaterMVSNFAMDLFNDPFFIGFNRELSRLNNAHKVNSQS
Ga0315909_1045509553300031857FreshwaterMVSSFALDLFKDPFFIGFNRELERFGNLHKVNSQSYPPYD
Ga0315901_1041368553300031963FreshwaterMVTKYAMDLFNDPFFIGFNKELNRLNTAHKTNSHSYPPYDLIKLDEDRYKISLAV
Ga0315906_10004822283300032050FreshwaterMVTQFAMDLFKDPFFIGFNRELERFNSLSRVNNTAFPPYDLLK
Ga0315906_1030343113300032050FreshwaterMVTKLAMDLFNDPFFIGFNRELNRLNSAYKTNSQTYPPYDILKLDEDTYRV
Ga0315905_1144634323300032092FreshwaterMVSTFAMDLFNDPFFIGFNRELGRLNTAHKTNLQSYPPYDLLKLDEDTY
Ga0315903_1121089823300032116FreshwaterMVTQFAMDLFNDPFFIGFNRELSRLNNAHKINSQSYPPYDLLKLNEDTYRISIAV
Ga0334980_0230521_622_7353300033816FreshwaterMVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPP
Ga0334986_0469732_1_1233300034012FreshwaterMVVTHAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDL
Ga0334998_0635045_410_5773300034019FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYRLSIALA
Ga0334995_0051500_3202_33633300034062FreshwaterMVTQFAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTYKLSLA
Ga0335019_0361479_2_1213300034066FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYD
Ga0334990_0024777_1_1203300034068FreshwaterMVNTTYTMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPY
Ga0335020_0052354_1_1143300034082FreshwaterMVTKYAMDLFNDPFFIGFNRELSRLNTAHQTNSQSYPP
Ga0335020_0211210_851_9673300034082FreshwaterMVTNLTMDLFNDPFFIGWNRELARLNNAHRTNSQSYPPY
Ga0335012_0071887_2_1603300034093FreshwaterMVTQFAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTYRLSL
Ga0335012_0119278_1348_14583300034093FreshwaterMVNSFTMDLFNDPFFIGFNRELSRLNNAHKVNSNSYP
Ga0335029_0102784_2_1513300034102FreshwaterMVTQFGLDLFNDPFFIGFNRELSRLNNAHKVNSQSYPPYDLIKLDEDTYR
Ga0335029_0131276_2_1423300034102FreshwaterMVTTFAMDLFKDPFFIGFNRELDRLNQAHSINAGGFPPYDLLKLDDD
Ga0335030_0154352_1_1623300034103FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYKLSLA
Ga0335030_0394697_757_8973300034103FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDED
Ga0335035_0659646_2_1633300034105FreshwaterMVTTFAMDLFKDPFFIGFNRELDRLNQAHSINAGGFPPYDLLKLDDDNYIITLA
Ga0335036_0238189_3_1313300034106FreshwaterMVTKYAMDLFNDPFFIGFNRELSRLNTAHQTNSQSYPPYDLLK
Ga0335050_0306185_649_7563300034108FreshwaterMVTQFAMDLFNDPFFIGFNRELSRLSNAHKVNSQSY
Ga0335055_0014748_3503_36523300034110FreshwaterMDLFKDPFFIGFNRELDRLNQAHSINAGGFPPYDLLKLDDDNYIITLAVA
Ga0335066_0415756_565_7293300034112FreshwaterMVTKYAMDLFNDPFFIGFNRELNRLNTAHKTNSQSYPPYDLLKLDEDTYQISLAI
Ga0335066_0486011_3_1313300034112FreshwaterMVTQFAMDLFNDPFFIGFNRDLARLNTAHKINSQSYPPYDLLK
Ga0335017_0052370_2292_24083300034167FreshwaterMVTTTLDLFNDPFFIGFNRELVRLNTAHKTNSQTYPPYD
Ga0335017_0511341_3_1553300034167FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYRL
Ga0335065_0078830_1_1623300034200FreshwaterMVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDNYQLSLA
Ga0335049_0180334_1329_14933300034272FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYRLSLAI
Ga0335049_0489093_3_1163300034272FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNSAHKTNTQSYPP
Ga0335007_0198748_1254_13943300034283FreshwaterMVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLIKLDED
Ga0335048_0056247_3_1553300034356FreshwaterMVTTTLDLFNDPFFIGFNRELVRLNTAHKTNSQTYPPYDLLKLDEDTYRIS
Ga0335048_0527516_401_5593300034356FreshwaterMVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDLLKLDEDTYRISL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.