Basic Information | |
---|---|
Family ID | F075477 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 45 residues |
Representative Sequence | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLD |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 93.22 % |
% of genes near scaffold ends (potentially truncated) | 97.48 % |
% of genes from short scaffolds (< 2000 bps) | 77.31 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (56.303 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (31.092 % of family members) |
Environment Ontology (ENVO) | Unclassified (64.706 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (51.261 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.73% β-sheet: 0.00% Coil/Unstructured: 60.27% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF00082 | Peptidase_S8 | 16.81 |
PF13640 | 2OG-FeII_Oxy_3 | 5.88 |
PF16861 | Carbam_trans_C | 5.04 |
PF00565 | SNase | 5.04 |
PF07235 | DUF1427 | 3.36 |
PF02369 | Big_1 | 2.52 |
PF11397 | GlcNAc | 0.84 |
PF02467 | Whib | 0.84 |
PF08241 | Methyltransf_11 | 0.84 |
PF02543 | Carbam_trans_N | 0.84 |
PF00694 | Aconitase_C | 0.84 |
PF00296 | Bac_luciferase | 0.84 |
PF01467 | CTP_transf_like | 0.84 |
PF01471 | PG_binding_1 | 0.84 |
PF07739 | TipAS | 0.84 |
PF00011 | HSP20 | 0.84 |
PF00255 | GSHPx | 0.84 |
PF02627 | CMD | 0.84 |
PF00106 | adh_short | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 3.36 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.84 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.84 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.84 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.84 |
COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.39 % |
Unclassified | root | N/A | 33.61 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559019|stn_contig01330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300000756|JGI12421J11937_10011145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3447 | Open in IMG/M |
3300000756|JGI12421J11937_10068799 | Not Available | 1069 | Open in IMG/M |
3300002296|B570J29587_1001619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2096 | Open in IMG/M |
3300002835|B570J40625_100747764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
3300003412|JGI25912J50252_10084754 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300004789|Ga0007752_11174311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
3300005580|Ga0049083_10044354 | Not Available | 1576 | Open in IMG/M |
3300005662|Ga0078894_10778972 | Not Available | 838 | Open in IMG/M |
3300006030|Ga0075470_10058787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
3300007590|Ga0102917_1206172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300007625|Ga0102870_1169060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300007627|Ga0102869_1091138 | Not Available | 835 | Open in IMG/M |
3300007630|Ga0102903_1227199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300007716|Ga0102867_1023811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1580 | Open in IMG/M |
3300007974|Ga0105747_1021543 | Not Available | 1769 | Open in IMG/M |
3300007974|Ga0105747_1079155 | Not Available | 1005 | Open in IMG/M |
3300008107|Ga0114340_1239261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300008108|Ga0114341_10005927 | Not Available | 24974 | Open in IMG/M |
3300008108|Ga0114341_10101498 | Not Available | 1748 | Open in IMG/M |
3300008110|Ga0114343_1002626 | Not Available | 36406 | Open in IMG/M |
3300008110|Ga0114343_1215921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300008267|Ga0114364_1130351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300008450|Ga0114880_1102435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
3300009024|Ga0102811_1076633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1254 | Open in IMG/M |
3300009152|Ga0114980_10469175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
3300009155|Ga0114968_10354378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300009159|Ga0114978_10093061 | Not Available | 1999 | Open in IMG/M |
3300009160|Ga0114981_10226021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
3300009163|Ga0114970_10015809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5171 | Open in IMG/M |
3300009180|Ga0114979_10265233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
3300010370|Ga0129336_10007753 | Not Available | 6619 | Open in IMG/M |
3300010370|Ga0129336_10444242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300010885|Ga0133913_10668905 | Not Available | 2720 | Open in IMG/M |
3300010885|Ga0133913_11084059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2064 | Open in IMG/M |
3300011995|Ga0153800_1007958 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300012665|Ga0157210_1023285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
3300013004|Ga0164293_10139643 | All Organisms → Viruses → Predicted Viral | 1813 | Open in IMG/M |
3300013004|Ga0164293_10427755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300013005|Ga0164292_10137157 | Not Available | 1803 | Open in IMG/M |
3300013005|Ga0164292_10213782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1364 | Open in IMG/M |
3300020141|Ga0211732_1487015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300020151|Ga0211736_10195907 | Not Available | 1223 | Open in IMG/M |
3300020151|Ga0211736_10398029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300020151|Ga0211736_10398674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 2422 | Open in IMG/M |
3300020151|Ga0211736_10428305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
3300020151|Ga0211736_10927492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300020162|Ga0211735_10052595 | Not Available | 4658 | Open in IMG/M |
3300020172|Ga0211729_10564497 | Not Available | 1303 | Open in IMG/M |
3300020205|Ga0211731_11225857 | Not Available | 5757 | Open in IMG/M |
3300020506|Ga0208091_1000356 | Not Available | 8922 | Open in IMG/M |
3300020511|Ga0208593_1000852 | Not Available | 4709 | Open in IMG/M |
3300020553|Ga0208855_1029656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
3300020556|Ga0208486_1030636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300020574|Ga0208221_1043865 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300023184|Ga0214919_10600245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300024346|Ga0244775_10913281 | Not Available | 697 | Open in IMG/M |
3300024348|Ga0244776_10578537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300025732|Ga0208784_1218321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300027121|Ga0255074_1041675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300027153|Ga0255083_1061390 | Not Available | 728 | Open in IMG/M |
3300027192|Ga0208673_1042913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
3300027227|Ga0208929_1101211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300027305|Ga0208168_1049994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
3300027418|Ga0208022_1060230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300027525|Ga0208437_1023439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1554 | Open in IMG/M |
3300027586|Ga0208966_1060492 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
3300027631|Ga0208133_1077647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300027659|Ga0208975_1029196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1770 | Open in IMG/M |
3300027697|Ga0209033_1034878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1904 | Open in IMG/M |
3300027772|Ga0209768_10053060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2124 | Open in IMG/M |
3300027782|Ga0209500_10059815 | Not Available | 2000 | Open in IMG/M |
3300027797|Ga0209107_10298937 | Not Available | 758 | Open in IMG/M |
3300027798|Ga0209353_10213748 | Not Available | 841 | Open in IMG/M |
3300027892|Ga0209550_10598944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300027971|Ga0209401_1204447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
3300028027|Ga0247722_10134165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
(restricted) 3300028114|Ga0247835_1116105 | Not Available | 1017 | Open in IMG/M |
3300028178|Ga0265593_1174503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10076614 | Not Available | 2352 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10189666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
(restricted) 3300029286|Ga0247841_10068457 | Not Available | 3142 | Open in IMG/M |
3300029349|Ga0238435_110830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300031857|Ga0315909_10381717 | Not Available | 1017 | Open in IMG/M |
3300031857|Ga0315909_10455095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300031963|Ga0315901_10413685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1077 | Open in IMG/M |
3300032050|Ga0315906_10004822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17138 | Open in IMG/M |
3300032050|Ga0315906_10303431 | Not Available | 1437 | Open in IMG/M |
3300032092|Ga0315905_11446343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300032116|Ga0315903_11210898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300033816|Ga0334980_0230521 | Not Available | 735 | Open in IMG/M |
3300034012|Ga0334986_0469732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300034019|Ga0334998_0635045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300034062|Ga0334995_0051500 | All Organisms → Viruses → Predicted Viral | 3364 | Open in IMG/M |
3300034066|Ga0335019_0361479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
3300034068|Ga0334990_0024777 | All Organisms → Viruses → Predicted Viral | 3195 | Open in IMG/M |
3300034082|Ga0335020_0052354 | Not Available | 2147 | Open in IMG/M |
3300034082|Ga0335020_0211210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
3300034093|Ga0335012_0071887 | All Organisms → Viruses → Predicted Viral | 1967 | Open in IMG/M |
3300034093|Ga0335012_0119278 | Not Available | 1460 | Open in IMG/M |
3300034102|Ga0335029_0102784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2014 | Open in IMG/M |
3300034102|Ga0335029_0131276 | Not Available | 1734 | Open in IMG/M |
3300034103|Ga0335030_0154352 | Not Available | 1632 | Open in IMG/M |
3300034103|Ga0335030_0394697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 899 | Open in IMG/M |
3300034105|Ga0335035_0659646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300034106|Ga0335036_0238189 | Not Available | 1239 | Open in IMG/M |
3300034108|Ga0335050_0306185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300034110|Ga0335055_0014748 | All Organisms → Viruses → Predicted Viral | 3652 | Open in IMG/M |
3300034112|Ga0335066_0415756 | Not Available | 731 | Open in IMG/M |
3300034112|Ga0335066_0486011 | Not Available | 657 | Open in IMG/M |
3300034167|Ga0335017_0052370 | Not Available | 2410 | Open in IMG/M |
3300034167|Ga0335017_0511341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300034200|Ga0335065_0078830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2259 | Open in IMG/M |
3300034272|Ga0335049_0180334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1495 | Open in IMG/M |
3300034272|Ga0335049_0489093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300034283|Ga0335007_0198748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1394 | Open in IMG/M |
3300034356|Ga0335048_0056247 | Not Available | 2515 | Open in IMG/M |
3300034356|Ga0335048_0527516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 31.09% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.08% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.24% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.40% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.88% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.88% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.04% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.20% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.52% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.52% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.52% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.68% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.68% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.68% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.68% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.68% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.84% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.84% |
Stentor Amethystinus | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Stentor Amethystinus | 0.84% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.84% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559019 | Stentor MTG 1 | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300002296 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
3300004789 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020486 | Freshwater microbial communities from Lake Mendota, WI - 20AUG2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020511 | Freshwater microbial communities from Lake Mendota, WI - 15JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020574 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027153 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h | Environmental | Open in IMG/M |
3300027192 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes) | Environmental | Open in IMG/M |
3300027227 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027305 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
3300027525 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
stn_00114480 | 2166559019 | Stentor Amethystinus | FFIGFNRDLARLNNAHRINSQSYPPYDILKLDEDTYRIS |
JGI12421J11937_100111451 | 3300000756 | Freshwater And Sediment | MVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPY |
JGI12421J11937_100687991 | 3300000756 | Freshwater And Sediment | MVNTTYTMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPP |
B570J29587_10016191 | 3300002296 | Freshwater | MDLFNDPFFIGFNRELNRLNTAHKTNSQSYPPYDLIKLDEDT |
B570J40625_1007477643 | 3300002835 | Freshwater | MVSVIKHPMDLLNDPFFIGFNRELNRLNSAHKTNSQSYPPYDLLKLD |
JGI25912J50252_100847541 | 3300003412 | Freshwater Lake | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYRLS |
Ga0007752_111743113 | 3300004789 | Freshwater Lake | MNATNFAMDLFNDPFFIGFNRDLARLNNAHKVNSQSYPPYDILKLDEDTY |
Ga0049083_100443541 | 3300005580 | Freshwater Lentic | MVNTTYTMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDLLKLD |
Ga0078894_107789721 | 3300005662 | Freshwater Lake | MVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFP |
Ga0075470_100587873 | 3300006030 | Aqueous | MTTQLLDLFNDPFFIGFNRELGRLNNAHKINSQSYPP |
Ga0102917_12061721 | 3300007590 | Estuarine | MHMNATNFAMDLFNDPFFIGFNRDLARLNNAHKVNSQ |
Ga0102870_11690602 | 3300007625 | Estuarine | MVNTFGMDLFRDPFFIGFNREVERFNSLHQINRGAFPPYDLLK |
Ga0102869_10911382 | 3300007627 | Estuarine | MVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDN |
Ga0102903_12271991 | 3300007630 | Estuarine | MVSATNFAMDLFNDPFFIGFNRELGRLNTAHKTNSQSYPPYDLLKLDEDTFRLSIAVAG |
Ga0102867_10238113 | 3300007716 | Estuarine | MNATNFAMDLFNDPFFIGFNRDLARLNNAHKVNSQSYPPYDILKLD |
Ga0105747_10215436 | 3300007974 | Estuary Water | MVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDLLKLDEDTYR |
Ga0105747_10791554 | 3300007974 | Estuary Water | MVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDLLKL |
Ga0114340_12392611 | 3300008107 | Freshwater, Plankton | MVVTHAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTYRISIAVA |
Ga0114341_1000592723 | 3300008108 | Freshwater, Plankton | MVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDNYLQK* |
Ga0114341_101014981 | 3300008108 | Freshwater, Plankton | MVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDNY |
Ga0114343_100262623 | 3300008110 | Freshwater, Plankton | MVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDNYVFGLQVRLQK* |
Ga0114343_12159212 | 3300008110 | Freshwater, Plankton | MVNKLTMDLFNDPFFIGFNKELNRLNTAHKTNSHSY |
Ga0114364_11303512 | 3300008267 | Freshwater, Plankton | MVNKLTMDLFNDPFFIGFNRELGRLNTVYKTNSQSYPPYDLLKL |
Ga0114880_11024355 | 3300008450 | Freshwater Lake | MVTNLTMDLFNDPFFIGWNRELSRLNNAHRTNSQSYPPYDLLKLDEDT |
Ga0102811_10766331 | 3300009024 | Estuarine | MVTTTLDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTY |
Ga0114980_104691751 | 3300009152 | Freshwater Lake | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDL |
Ga0114968_103543784 | 3300009155 | Freshwater Lake | MVVTHAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDT |
Ga0114978_100930616 | 3300009159 | Freshwater Lake | MVTQFAMDLFNDPFFIGFNRELSRLNTAHKVNSQSYPPYDLLKLD |
Ga0114981_102260213 | 3300009160 | Freshwater Lake | MVTQFAMDLFNDPFFIGFNRELSRLNTAHKVNSQSYPPYDL |
Ga0114970_100158091 | 3300009163 | Freshwater Lake | MVTQFAMDLFNDPFFIGFNRELSRLSTAHKVNSQSYPPYDL |
Ga0114979_102652331 | 3300009180 | Freshwater Lake | MVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQSYPPYDLLK |
Ga0129336_1000775310 | 3300010370 | Freshwater To Marine Saline Gradient | MVTQFAMDLFRDPFFIGFNRELERMANVHNTASRQSYPPYDVLKLDEDTYQVQLAV |
Ga0129336_104442422 | 3300010370 | Freshwater To Marine Saline Gradient | MVTQFAMDLFKDPFFIGFNKELERLNAVYNLGSRNSYPPYDIQQLD |
Ga0133913_106689051 | 3300010885 | Freshwater Lake | MDLLNDPFFIGFNRELGRLNTAHKTNLQSYPPYDLLKLDEDTY |
Ga0133913_110840596 | 3300010885 | Freshwater Lake | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLD |
Ga0153800_10079581 | 3300011995 | Freshwater | MDLFNDPFFIGFNRELGRLNSAHKVNSQSYPPYDLLKLDEDTYR |
Ga0157210_10232851 | 3300012665 | Freshwater | MVSVIKHPMDLLNDPFFIGFNRELNRLNSAHKTNSQSYPPYD |
Ga0164293_101396431 | 3300013004 | Freshwater | MVTQFAMDLFNDPFFIGFNRELSRLNHAHKLNSQSYPPYDLLKLDEDTFRLSIA |
Ga0164293_104277553 | 3300013004 | Freshwater | MVSVIKHPMDLLNDPFFIGFNRELNRLNSAHKTNSQSYPPYDLLKLDEDTY |
Ga0164292_101371576 | 3300013005 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYR |
Ga0164292_102137825 | 3300013005 | Freshwater | MDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYR |
Ga0211732_14870151 | 3300020141 | Freshwater | MVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDD |
Ga0211736_101959071 | 3300020151 | Freshwater | MVTTTLDLFNDPFFIGFNRELGRLNTAHKTNLQTYP |
Ga0211736_103980291 | 3300020151 | Freshwater | MVNKLTMDLFNDPFFIGFNRELNRLNTAHKTNSQSYPP |
Ga0211736_103986741 | 3300020151 | Freshwater | MVTKYAMDLFNDPFFIGFNRELNRLNTAHKTNSQSYPP |
Ga0211736_104283052 | 3300020151 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPP |
Ga0211736_109274925 | 3300020151 | Freshwater | MVTKYAMDLFNDPFFIGFNRDLNRLNTAHKTNLQTYPPYDLLKLD |
Ga0211735_1005259510 | 3300020162 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKTNSQAYPPYDLLKLDEDTY |
Ga0211729_105644974 | 3300020172 | Freshwater | MVNAIKHPMDLFNDPFFIGFNRELNRLNSAHKTNSQSYPP |
Ga0211731_1122585720 | 3300020205 | Freshwater | MVTKYAMDLFNDPFFIGFNRELNRLNTAHKTNSQSYPPYDLLK |
Ga0208698_1066165 | 3300020486 | Freshwater | MVTQFMDLFNDPFFIGFNRDLARLNNIHREAINESYPPYDVLQHDND |
Ga0208091_100035623 | 3300020506 | Freshwater | MVTQFAMDLFNDPFFIGFNRDLARLNNAHKINSQSYPPYDLLK |
Ga0208593_10008521 | 3300020511 | Freshwater | MVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDNYQ |
Ga0208855_10296562 | 3300020553 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPY |
Ga0208486_10306364 | 3300020556 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTY |
Ga0208221_10438653 | 3300020574 | Freshwater | MVTQFAMDLFNDPFFIGFNRDLARLNSAHKINSQSYPPYDLLKLDEDTYRLS |
Ga0214919_106002451 | 3300023184 | Freshwater | LFNDPFFIGFNRELGRLSTAHKINSQSYPPYDLLKLDEDTYRIF |
Ga0244775_109132811 | 3300024346 | Estuarine | MVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAF |
Ga0244776_105785372 | 3300024348 | Estuarine | MVNKLTMDLFNDPFFIGFNRELGRLNTAYKTNSQSYPPYDLLKLDEDTYQISL |
Ga0208784_12183212 | 3300025732 | Aqueous | VVTQFAMDLFRDPFFIGFNRDLERMANVHQTASRQTYPPYDVLKLDEDTFQVS |
Ga0255074_10416751 | 3300027121 | Freshwater | MVTTTLDLFNDPFFIGFNRELSRLNNAHKTNLQTYPPYDLLKLDEDTYR |
Ga0255083_10613901 | 3300027153 | Freshwater | MVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTY |
Ga0208673_10429131 | 3300027192 | Estuarine | MVTTTLDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTYQI |
Ga0208929_11012111 | 3300027227 | Estuarine | MVTTTLDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTYQIS |
Ga0208168_10499941 | 3300027305 | Estuarine | MVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDL |
Ga0208022_10602301 | 3300027418 | Estuarine | MVVTHAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLD |
Ga0208437_10234395 | 3300027525 | Estuarine | MVTTTLDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLK |
Ga0208966_10604922 | 3300027586 | Freshwater Lentic | MVTTFAMDLFKDPFFIGFNRELDRLNQAHSINAGGFPPYDLLKLDD |
Ga0208133_10776473 | 3300027631 | Estuarine | MVNQFAMDLFNDPFFIGFNRELGRLNTAHKTNLQSYPPYDLLKLDEDT |
Ga0208975_10291961 | 3300027659 | Freshwater Lentic | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLK |
Ga0209033_10348784 | 3300027697 | Freshwater Lake | MVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYD |
Ga0209768_100530601 | 3300027772 | Freshwater Lake | MDLFNDPFFIGFNRELSRLNNAHKVNSQSYPPYDLLKLDEDTY |
Ga0209500_100598151 | 3300027782 | Freshwater Lake | MVTQFAMDLFNDPFFIGFNRELSRLNTAHKVNSQSYPPYDLLKL |
Ga0209107_102989371 | 3300027797 | Freshwater And Sediment | MVNTTYTMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDLLKLDE |
Ga0209353_102137484 | 3300027798 | Freshwater Lake | MVNTTYTMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDL |
Ga0209550_105989444 | 3300027892 | Freshwater Lake | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDT |
Ga0209401_12044474 | 3300027971 | Freshwater Lake | MVTQFAMDLFNDPFFIGFNRELSRLNTAHKVNSQSYPPYDLLKLDEDTYRLSLAIA |
Ga0247722_101341651 | 3300028027 | Deep Subsurface Sediment | MVTKLAMDLFNDPFFIGFNRDLARLNNAHRINSQSYPPYD |
(restricted) Ga0247835_11161051 | 3300028114 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKINSQSYPPYDLLKLDEDTYRLSLAIA |
Ga0265593_11745031 | 3300028178 | Saline Water | MVTQFAMDLFNDPFFIGFNRELSRLNTAHKVNSQSYPPYDLLK |
(restricted) Ga0247840_100766141 | 3300028581 | Freshwater | MDLFNDPFFIGFNRELGRLNTAHKINSQSYPPYDLLKLDEDTYRLS |
(restricted) Ga0247840_101896663 | 3300028581 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDE |
(restricted) Ga0247841_100684579 | 3300029286 | Freshwater | MVTKYAMDLFNDPFFIGFGRELSRLNGAYKTNSQSYP |
Ga0238435_1108301 | 3300029349 | Freshwater | MVTTFAMDLFKDPFFIGFNRELDRLNQAHSINAGGFPPYDL |
Ga0315909_103817172 | 3300031857 | Freshwater | MVSNFAMDLFNDPFFIGFNRELSRLNNAHKVNSQS |
Ga0315909_104550955 | 3300031857 | Freshwater | MVSSFALDLFKDPFFIGFNRELERFGNLHKVNSQSYPPYD |
Ga0315901_104136855 | 3300031963 | Freshwater | MVTKYAMDLFNDPFFIGFNKELNRLNTAHKTNSHSYPPYDLIKLDEDRYKISLAV |
Ga0315906_1000482228 | 3300032050 | Freshwater | MVTQFAMDLFKDPFFIGFNRELERFNSLSRVNNTAFPPYDLLK |
Ga0315906_103034311 | 3300032050 | Freshwater | MVTKLAMDLFNDPFFIGFNRELNRLNSAYKTNSQTYPPYDILKLDEDTYRV |
Ga0315905_114463432 | 3300032092 | Freshwater | MVSTFAMDLFNDPFFIGFNRELGRLNTAHKTNLQSYPPYDLLKLDEDTY |
Ga0315903_112108982 | 3300032116 | Freshwater | MVTQFAMDLFNDPFFIGFNRELSRLNNAHKINSQSYPPYDLLKLNEDTYRISIAV |
Ga0334980_0230521_622_735 | 3300033816 | Freshwater | MVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPP |
Ga0334986_0469732_1_123 | 3300034012 | Freshwater | MVVTHAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDL |
Ga0334998_0635045_410_577 | 3300034019 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYRLSIALA |
Ga0334995_0051500_3202_3363 | 3300034062 | Freshwater | MVTQFAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTYKLSLA |
Ga0335019_0361479_2_121 | 3300034066 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYD |
Ga0334990_0024777_1_120 | 3300034068 | Freshwater | MVNTTYTMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPY |
Ga0335020_0052354_1_114 | 3300034082 | Freshwater | MVTKYAMDLFNDPFFIGFNRELSRLNTAHQTNSQSYPP |
Ga0335020_0211210_851_967 | 3300034082 | Freshwater | MVTNLTMDLFNDPFFIGWNRELARLNNAHRTNSQSYPPY |
Ga0335012_0071887_2_160 | 3300034093 | Freshwater | MVTQFAMDLFNDPFFIGFNRELSRLNTAHKTNSQSYPPYDLLKLDEDTYRLSL |
Ga0335012_0119278_1348_1458 | 3300034093 | Freshwater | MVNSFTMDLFNDPFFIGFNRELSRLNNAHKVNSNSYP |
Ga0335029_0102784_2_151 | 3300034102 | Freshwater | MVTQFGLDLFNDPFFIGFNRELSRLNNAHKVNSQSYPPYDLIKLDEDTYR |
Ga0335029_0131276_2_142 | 3300034102 | Freshwater | MVTTFAMDLFKDPFFIGFNRELDRLNQAHSINAGGFPPYDLLKLDDD |
Ga0335030_0154352_1_162 | 3300034103 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYKLSLA |
Ga0335030_0394697_757_897 | 3300034103 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDED |
Ga0335035_0659646_2_163 | 3300034105 | Freshwater | MVTTFAMDLFKDPFFIGFNRELDRLNQAHSINAGGFPPYDLLKLDDDNYIITLA |
Ga0335036_0238189_3_131 | 3300034106 | Freshwater | MVTKYAMDLFNDPFFIGFNRELSRLNTAHQTNSQSYPPYDLLK |
Ga0335050_0306185_649_756 | 3300034108 | Freshwater | MVTQFAMDLFNDPFFIGFNRELSRLSNAHKVNSQSY |
Ga0335055_0014748_3503_3652 | 3300034110 | Freshwater | MDLFKDPFFIGFNRELDRLNQAHSINAGGFPPYDLLKLDDDNYIITLAVA |
Ga0335066_0415756_565_729 | 3300034112 | Freshwater | MVTKYAMDLFNDPFFIGFNRELNRLNTAHKTNSQSYPPYDLLKLDEDTYQISLAI |
Ga0335066_0486011_3_131 | 3300034112 | Freshwater | MVTQFAMDLFNDPFFIGFNRDLARLNTAHKINSQSYPPYDLLK |
Ga0335017_0052370_2292_2408 | 3300034167 | Freshwater | MVTTTLDLFNDPFFIGFNRELVRLNTAHKTNSQTYPPYD |
Ga0335017_0511341_3_155 | 3300034167 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYRL |
Ga0335065_0078830_1_162 | 3300034200 | Freshwater | MVTQFAMDLFKDPFFIGFNRELERFNSLSKVNNTAFPPYDLLKLDEDNYQLSLA |
Ga0335049_0180334_1329_1493 | 3300034272 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLLKLDEDTYRLSLAI |
Ga0335049_0489093_3_116 | 3300034272 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNSAHKTNTQSYPP |
Ga0335007_0198748_1254_1394 | 3300034283 | Freshwater | MVTQFAMDLFNDPFFIGFNRELGRLNTAHKVNSQSYPPYDLIKLDED |
Ga0335048_0056247_3_155 | 3300034356 | Freshwater | MVTTTLDLFNDPFFIGFNRELVRLNTAHKTNSQTYPPYDLLKLDEDTYRIS |
Ga0335048_0527516_401_559 | 3300034356 | Freshwater | MVVTHAMDLFNDPFFIGFNRELGRLNTAHKTNSQTYPPYDLLKLDEDTYRISL |
⦗Top⦘ |