NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075472

Metagenome / Metatranscriptome Family F075472

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075472
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 41 residues
Representative Sequence MSAAARLSLVDRADPALSIVAQCRLLKVARSTLYHRPA
Number of Associated Samples 112
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.19 %
% of genes near scaffold ends (potentially truncated) 89.08 %
% of genes from short scaffolds (< 2000 bps) 98.32 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.319 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(9.244 % of family members)
Environment Ontology (ENVO) Unclassified
(27.731 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.815 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.36%    β-sheet: 0.00%    Coil/Unstructured: 63.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF01527HTH_Tnp_1 44.54
PF13518HTH_28 3.36
PF13683rve_3 2.52
PF13005zf-IS66 1.68
PF10551MULE 1.68
PF13276HTH_21 1.68
PF07592DDE_Tnp_ISAZ013 0.84
PF13817DDE_Tnp_IS66_C 0.84
PF03235DUF262 0.84
PF00872Transposase_mut 0.84
PF03450CO_deh_flav_C 0.84
PF00665rve 0.84
PF01609DDE_Tnp_1 0.84
PF01165Ribosomal_S21 0.84
PF01594AI-2E_transport 0.84
PF03050DDE_Tnp_IS66 0.84
PF13340DUF4096 0.84
PF13551HTH_29 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.84
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 0.84
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 0.84
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.84
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.84
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.84
COG3293TransposaseMobilome: prophages, transposons [X] 0.84
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.84
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.84
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.84
COG3436TransposaseMobilome: prophages, transposons [X] 0.84
COG4584TransposaseMobilome: prophages, transposons [X] 0.84
COG5421TransposaseMobilome: prophages, transposons [X] 0.84
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.84
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.84

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.32 %
UnclassifiedrootN/A1.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459006|GBPF9FW01DR7AJAll Organisms → cellular organisms → Bacteria529Open in IMG/M
3300000313|WSSedB1CaDRAFT_10032368All Organisms → cellular organisms → Bacteria → Proteobacteria1028Open in IMG/M
3300001356|JGI12269J14319_10370665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria501Open in IMG/M
3300001408|JGI20206J14855_1059528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales544Open in IMG/M
3300001412|JGI20173J14856_1048146All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300001566|A2135W6_1113824All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300004092|Ga0062389_104959039All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300005335|Ga0070666_10125740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1780Open in IMG/M
3300005457|Ga0070662_101900689All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300005583|Ga0049085_10181969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria702Open in IMG/M
3300005610|Ga0070763_10770164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Asticcacaulis → Asticcacaulis benevestitus567Open in IMG/M
3300005834|Ga0068851_10059876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1948Open in IMG/M
3300006052|Ga0075029_100285137All Organisms → cellular organisms → Bacteria → Proteobacteria1051Open in IMG/M
3300006059|Ga0075017_101446642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria541Open in IMG/M
3300006102|Ga0075015_100415297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria762Open in IMG/M
3300006162|Ga0075030_101159094All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300006172|Ga0075018_10756649All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300006175|Ga0070712_101531000All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300006581|Ga0074048_12723710All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300006893|Ga0073928_10433064All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300009500|Ga0116229_11190062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales608Open in IMG/M
3300009500|Ga0116229_11393559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales556Open in IMG/M
3300009698|Ga0116216_10737401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales591Open in IMG/M
3300009700|Ga0116217_10937594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales530Open in IMG/M
3300010341|Ga0074045_10789753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales601Open in IMG/M
3300010357|Ga0116249_10932678All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300010396|Ga0134126_12898484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales519Open in IMG/M
3300010860|Ga0126351_1228420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales587Open in IMG/M
3300010876|Ga0126361_10196880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales587Open in IMG/M
3300010877|Ga0126356_10677177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales540Open in IMG/M
3300010880|Ga0126350_12429450All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales538Open in IMG/M
3300012212|Ga0150985_109907383All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300012404|Ga0134024_1111922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales517Open in IMG/M
3300012924|Ga0137413_11342457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales575Open in IMG/M
3300012984|Ga0164309_10961376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales701Open in IMG/M
3300014325|Ga0163163_12725922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales551Open in IMG/M
3300014487|Ga0182000_10280602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales684Open in IMG/M
3300014499|Ga0182012_10426601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales871Open in IMG/M
3300014654|Ga0181525_10779006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales539Open in IMG/M
3300016270|Ga0182036_11512365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales564Open in IMG/M
3300017946|Ga0187879_10666611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales579Open in IMG/M
3300018019|Ga0187874_10328701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales620Open in IMG/M
3300018034|Ga0187863_10162159All Organisms → cellular organisms → Bacteria → Proteobacteria1247Open in IMG/M
3300018034|Ga0187863_10843946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales520Open in IMG/M
3300018042|Ga0187871_10814007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales521Open in IMG/M
3300018043|Ga0187887_10627064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales635Open in IMG/M
3300018043|Ga0187887_10960715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria505Open in IMG/M
3300018046|Ga0187851_10449483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300018046|Ga0187851_10693101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales574Open in IMG/M
3300018047|Ga0187859_10759582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales554Open in IMG/M
3300018057|Ga0187858_10753306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales579Open in IMG/M
3300018062|Ga0187784_11063488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales643Open in IMG/M
3300019888|Ga0193751_1142003All Organisms → cellular organisms → Bacteria → Proteobacteria871Open in IMG/M
3300020005|Ga0193697_1049095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Asticcacaulis1050Open in IMG/M
3300021388|Ga0213875_10587067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales538Open in IMG/M
3300021405|Ga0210387_11894657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300022557|Ga0212123_10859592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales538Open in IMG/M
3300024347|Ga0179591_1041383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3198Open in IMG/M
3300025414|Ga0208935_1037094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales648Open in IMG/M
3300025505|Ga0207929_1101755All Organisms → cellular organisms → Bacteria → Proteobacteria537Open in IMG/M
3300025903|Ga0207680_10417833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → unclassified Roseomonas → Roseomonas sp. B5949Open in IMG/M
3300026058|Ga0208421_1024812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Rhizorhabdus → Rhizorhabdus wittichii552Open in IMG/M
3300026075|Ga0207708_10293319All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300027535|Ga0209734_1040977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas870Open in IMG/M
3300027552|Ga0209982_1008834All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans1483Open in IMG/M
3300027807|Ga0209208_10507478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales562Open in IMG/M
3300027819|Ga0209514_10362955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales637Open in IMG/M
3300027824|Ga0209040_10500387All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300027825|Ga0209039_10429457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales501Open in IMG/M
3300027862|Ga0209701_10576733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales600Open in IMG/M
3300027911|Ga0209698_10523895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria916Open in IMG/M
3300028138|Ga0247684_1064665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Rhizorhabdus → Rhizorhabdus wittichii597Open in IMG/M
3300028178|Ga0265593_1023676All Organisms → cellular organisms → Bacteria → Proteobacteria1918Open in IMG/M
3300028560|Ga0302144_10231522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales598Open in IMG/M
3300028652|Ga0302166_10179478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria502Open in IMG/M
3300028704|Ga0307321_1130890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales525Open in IMG/M
3300028712|Ga0307285_10218326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales537Open in IMG/M
3300028780|Ga0302225_10348389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium699Open in IMG/M
3300028791|Ga0307290_10332884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales556Open in IMG/M
3300028877|Ga0302235_10512116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales509Open in IMG/M
3300029913|Ga0311362_11235170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales552Open in IMG/M
3300029915|Ga0311358_10766206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas697Open in IMG/M
3300029915|Ga0311358_10961981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales592Open in IMG/M
3300029917|Ga0311326_10483595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales606Open in IMG/M
3300029922|Ga0311363_11199850All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas640Open in IMG/M
3300029944|Ga0311352_11493285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales506Open in IMG/M
3300029951|Ga0311371_11781013All Organisms → cellular organisms → Bacteria → Proteobacteria667Open in IMG/M
3300029954|Ga0311331_11371565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales584Open in IMG/M
3300029982|Ga0302277_1064965Not Available1699Open in IMG/M
3300029987|Ga0311334_11118889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales658Open in IMG/M
3300029999|Ga0311339_11524725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales594Open in IMG/M
3300030002|Ga0311350_10248991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1583Open in IMG/M
3300030011|Ga0302270_10088826Not Available1982Open in IMG/M
3300030020|Ga0311344_11425871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales506Open in IMG/M
3300030020|Ga0311344_11437843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales503Open in IMG/M
3300030053|Ga0302177_10635023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales543Open in IMG/M
3300030399|Ga0311353_10957293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales720Open in IMG/M
3300030503|Ga0311370_12428093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales506Open in IMG/M
3300030586|Ga0265393_1205842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales522Open in IMG/M
3300030617|Ga0311356_11287888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales669Open in IMG/M
3300030618|Ga0311354_11670531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales558Open in IMG/M
3300030743|Ga0265461_13957879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales504Open in IMG/M
3300030872|Ga0265723_1016875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria592Open in IMG/M
3300031057|Ga0170834_106041984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria971Open in IMG/M
3300031231|Ga0170824_105910256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria540Open in IMG/M
3300031231|Ga0170824_126069749All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300031242|Ga0265329_10235525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales608Open in IMG/M
3300031470|Ga0272432_1230065All Organisms → cellular organisms → Bacteria → Proteobacteria697Open in IMG/M
3300031474|Ga0170818_113060995All Organisms → cellular organisms → Bacteria → Proteobacteria580Open in IMG/M
3300031680|Ga0318574_10849188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales535Open in IMG/M
3300031722|Ga0311351_10879655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales684Open in IMG/M
3300031726|Ga0302321_100106680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2814Open in IMG/M
3300031788|Ga0302319_10503906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1299Open in IMG/M
3300032060|Ga0318505_10576398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales529Open in IMG/M
3300032756|Ga0315742_10682075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria931Open in IMG/M
3300032895|Ga0335074_11074899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria697Open in IMG/M
3300033486|Ga0316624_10426744All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300034061|Ga0334987_0119696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales1986Open in IMG/M
3300034111|Ga0335063_0602221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales517Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.24%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog9.24%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.88%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.04%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.04%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.20%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil3.36%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.52%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.52%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.52%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated2.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.68%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.68%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.84%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.84%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.84%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.84%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.84%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.84%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.84%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.84%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.84%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.84%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.84%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.84%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.84%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.84%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.84%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.84%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459006Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cmEnvironmentalOpen in IMG/M
3300000313Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 CattailEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001408Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012EnvironmentalOpen in IMG/M
3300001412Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300001566Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-35cm)- 6 week illuminaEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010357AD_USSTcaEngineeredOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010860Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012404Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025505Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026058Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027552Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027807Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028178Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36mEnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028652Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030586Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030872Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031470Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nordEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
L01_007134602170459006Grass SoilMSRPERLALVDHDDQAMPIVAQCQLLKVARSTLYYRPA
WSSedB1CaDRAFT_1003236833300000313WetlandMSAAARRTLVDRDDPALPVAAQCRLPKIAHSTLYY*
JGI12269J14319_1037066523300001356Peatlands SoilMSPGTRRSLVDRADPVLSIVAQCQLLKVARSTLYYRPAAGS
JGI20206J14855_105952813300001408Arctic Peat SoilMSGAARLALVERADGALSIVAQCRMLRVARSTLYWRPAPVRADDLDLM
JGI20173J14856_104814623300001412Arctic Peat SoilMNRSERLALVDHDDPVLPIVAQCRLLKVARSTLYYRPVPMSGDDLA
A2135W6_111382413300001566PermafrostMNQVVRLSLVDRADAELSIVAQCRLLKVARSSLYWRSATVSEDDLR
Ga0062389_10495903923300004092Bog Forest SoilMSGAARLALVDRADAALSIVAQCRMLRVARSTLYWRPAPVSAND
Ga0070666_1012574013300005335Switchgrass RhizosphereMSAVARRALVDRSDPHVSVAAQCRLLRVARSTLYYRSAAVSEG
Ga0070662_10190068913300005457Corn RhizosphereMSRIARLSLVDRAEVGLSIAAQCRLLKIARSTLYWRAVPVSEDDLRLM
Ga0049085_1018196913300005583Freshwater LenticMKSAARLALVDRADADLSIVAQCRLLRVARSTLYWRPAPV
Ga0070763_1077016413300005610SoilLFLEKVWCLSLSARLSLVERSEPDLPIAAQCRLLKVARSTLY
Ga0068851_1005987633300005834Corn RhizosphereMSALARRALVDRSDPHVSVAAQCRLLRVARSTLYYRPAAV
Ga0075029_10028513733300006052WatershedsMNRAERLALVDHDDPVLPVTAQCRLLKVARSTLYYQP
Ga0075017_10144664213300006059WatershedsMNQVTRLSLVDRADADLSIVAQCRPLKLARSSLYWH
Ga0075015_10041529723300006102WatershedsMSRPERLALVDHDDPLMALVTQCQLLKVARSTLYYRPVPVSANDRR*
Ga0075030_10115909413300006162WatershedsMKRGERLALVDHDDPVLPVAAQCRLLKVARSTLYYQP
Ga0075018_1075664923300006172WatershedsMSRPERLALVDPDDQVVPVVAQCRLLKVARSSLYYR
Ga0070712_10153100013300006175Corn, Switchgrass And Miscanthus RhizosphereMTPAVRRALVDRDDPALPVAVQCRLLKVARSTLYYRP
Ga0074048_1272371023300006581SoilMNRAERLALVDHDDPALPVSAQCRLLRVARSTLYYQ
Ga0073928_1043306413300006893Iron-Sulfur Acid SpringMNQITRLSLVDRSDADLSIVAQCRLLKVARSTLYYRAAAVSADDLRLMRW
Ga0116229_1119006223300009500Host-AssociatedMSGAARLALVDRADGALSLVAQCRMLRVARSTLYWRPAAASAGDLDLMHRLDVQY
Ga0116229_1139355923300009500Host-AssociatedMSSPARLALVDAAEPGLSIVAQCRLLKVARSTLYYRPASENA
Ga0116216_1073740123300009698Peatlands SoilMKAAERRAIVDHNDPVLPIVAQCRLLKIARSTLYYRPV
Ga0116217_1093759423300009700Peatlands SoilMSAPDRRTLVDRDDPVLAIVAQCRLLKIARSTLYYR
Ga0074045_1078975313300010341Bog Forest SoilMSSAARLSLVDRADPAFSIVAQCQLLKVARSTLYYRP
Ga0116249_1093267833300010357Anaerobic Digestor SludgeMSRAARLALVDRDDPAMPVAAQCRLLKVARSTLYHQPCPVSDDDLAV
Ga0134126_1289848413300010396Terrestrial SoilMNQITRLSLVERPDADLSIVAQCRLLKVARSTLYHRAAP
Ga0126351_122842023300010860Boreal Forest SoilMNRPERLALVDHDDPALPVVAQCRLLKVARSTLYYQ
Ga0126361_1019688033300010876Boreal Forest SoilMNRPDRLALVDHDDPALPVVAQCRLLKVARSTLYYQPV
Ga0126356_1067717733300010877Boreal Forest SoilMSLGERRALVERDDPDLSVAAQCRLLNVARSTLYYQPGPMN
Ga0126350_1242945023300010880Boreal Forest SoilMTRPERLALVDHGDPALPVVAQCRLLKVARSTLYYQ
Ga0150985_10990738323300012212Avena Fatua RhizosphereMSAAQRLALVDRADSALSVAAQCRLLKVARSTLYYQ
Ga0134024_111192213300012404Grasslands SoilMSPAQRLALVERDDAALSVAAQCRLLKLARSTLYYQP
Ga0137413_1134245713300012924Vadose Zone SoilMSRPERLALVDHDDQVLPVVAQCRLLKVARSTLYYRPAPVSMDD
Ga0164309_1096137633300012984SoilMSRSDRLALVDHGDRVVPVVAQCRLLKVTRSSLYYRPAPVS
Ga0163163_1272592223300014325Switchgrass RhizosphereMNQITRLSLVDRSDADLSIVAQCRLLKVARSTLYY
Ga0182000_1028060223300014487SoilMSAVERRALVDRSDPHVSVAAQCRLLRVARSTLYYRPAAVSED
Ga0182012_1042660133300014499BogMSAAARLALVDRADTALSIVAQCRMLRVARSTLYAS
Ga0181525_1077900613300014654BogMSSPARLALVDAAEPALSIVAQCRLLKVARSTLYYRPAS
Ga0182036_1151236523300016270SoilMSAVERRGLVDNADQALSVVAQCRLLKIARSTLYYRPVP
Ga0187879_1066661123300017946PeatlandMSAPERRALVDRDDPVLPVVAQCRLLKIARSTLYY
Ga0187874_1032870133300018019PeatlandMNRAARLALVDHDDPVLPIAAQCRLLQVARSTLYYQPVPASAD
Ga0187863_1016215913300018034PeatlandMNRRERLALVDQDDPVLTVSAQCRLLEVARSTLYHRPVPASPDD
Ga0187863_1084394613300018034PeatlandMSSAARLGLVDPSEPALSIVAQCRLLQVARSTLYYRAMPVSAED
Ga0187871_1081400723300018042PeatlandMNRAERLARVDHEDPVLAIAAQCRLLKVARSTLYYQPVPAGAGP
Ga0187887_1062706433300018043PeatlandMSLPERRAMVDPDDPVLPIVAQCRLLKIARSTLYY
Ga0187887_1096071523300018043PeatlandVRLSLVDRSEPDLPIAAQCRLLKVARSTLYYRPLPVSVDDLRL
Ga0187851_1044948313300018046PeatlandMNRLERLALVDHDDPVLPVVVQCRLLKVARSTLYYRPVPVSADDLAVMRR
Ga0187851_1069310113300018046PeatlandMSAVARLSLVDRADPVLSIAAQCRLLKVARSTLYY
Ga0187859_1075958223300018047PeatlandMSRSERLALVDHDDAALPVVTQCRLLKVARSTLYY
Ga0187858_1075330613300018057PeatlandMNRAERLALVDHDDQVLPVTAQCRLLKVARSTLYYQPVPAGYYQPVPAGADELVVMRRIDEL
Ga0187784_1106348823300018062Tropical PeatlandMSAPDRRALVDPDDPVLPIVAQCRLLKIARSTLYY
Ga0193751_114200313300019888SoilMNRSERLALVGDDDPTLPVVAQCRLLKIARSTLYYRPVPVS
Ga0193697_104909523300020005SoilMSRSDRLALVDHGDRVVPVVAQCRLLKVTRSSLYYRPAPVSADDLCGDAADG
Ga0213875_1058706723300021388Plant RootsMSRSDRQALIDRADSQLSIARQCQLLKVARSTLYYRP
Ga0210387_1189465713300021405SoilMSPVERLALVDRDDPDLPIAAQCRLLKVARSTLYYQPAPM
Ga0212123_1085959223300022557Iron-Sulfur Acid SpringMNQITRLSLVDRSDADLSIVAQCRLLKVARSTLYYRAAAVSADDLRLMRWL
Ga0179591_104138353300024347Vadose Zone SoilMNQVARLSLVDRGDVDLSIVAQCRLLKVARSSLYLAFGSGE
Ga0208935_103709433300025414PeatlandMNRAERLALVDHDDPVLQVTAQCRLLKVARSTLYYQ
Ga0207929_110175523300025505Arctic Peat SoilMNQMTRLSLVDRADTDLSIVAQCRLLKVARSTLYYRAAPV
Ga0207680_1041783313300025903Switchgrass RhizosphereMSALARRALVDRSDPHVSVAAQCRLLRVARSTLYYRSAAVSEG
Ga0208421_102481223300026058Natural And Restored WetlandsMSRIARLSLVDRAEVGLSIAAQCRLLKIARSTLYWRAVPVSEDDLRLMRRI
Ga0207708_1029331913300026075Corn, Switchgrass And Miscanthus RhizosphereMSAVARRALVDRSDPHVSVAAQCRLLRVARSTLYYRPAAVSEG
Ga0209734_104097733300027535Forest SoilMNRPDRLALVDHDDPALPIIAQCRLLKVARSTLYYQPVPARWTIW
Ga0209982_100883413300027552Arabidopsis Thaliana RhizospherePERQALIDGEAAMPITRQCQLLGVARSTLYYQPQG
Ga0209208_1050747823300027807Host-AssociatedMSAPARRALVDAAAPALSIVSQCRLLKVARSTLYYRPAAVS
Ga0209514_1036295523300027819GroundwaterMNRPERLALVDHDDPALPVVAQCRLLKIARSTLYYRPVPVSS
Ga0209040_1050038723300027824Bog Forest SoilMNQFARLSLVDRADADLSIVAQCRLLKVARSSLYWRPA
Ga0209039_1042945713300027825Bog Forest SoilMNQTARLSLVDRAERELSITAQCQLLKLARSTLYYRPSPVSA
Ga0209701_1057673313300027862Vadose Zone SoilMSRPERLTLVDHDDQAVPVVAQCRLLKVARSTLYYRQAPVSMD
Ga0209698_1052389513300027911WatershedsMNRRERLPQVDHGDPLLPVAAQCRLLRVARSTLYH
Ga0247684_106466523300028138SoilMSRIARLSLVDRAEVGLSIAAQCRLLKIARSTLYWRAVPVSEDDLRLMRR
Ga0265593_102367623300028178Saline WaterMSRAVRLGLVDRDDPAMAVAAQCRLLKVARSTLYHQSCPVSDDDLAVGCDSTLWGVL
Ga0302144_1023152213300028560BogMSAPERRALVDRDDPVLPVVAQCRLLKIARSTLYYLPAAVDPDDL
Ga0302166_1017947813300028652FenMTQSERLALVDRDDPDVPVVNQCRLLKIARSTLYYRPVPVSSD
Ga0307321_113089023300028704SoilMSRPERLALVDPDDQAMPVVAQCQLLKVARSTLYYRPAP
Ga0307285_1021832633300028712SoilMKPSERVGLVDHADPVLPVVAQCQLLKVARSTVYYRP
Ga0302225_1034838923300028780PalsaMNRVERLALVDHDDAVLSIRAQCHLLRVARSTLYYQPVLSSP
Ga0307290_1033288423300028791SoilMSRGERLALVDRADAALSSVEQCLLLKVARSTLYYQPAPVSA
Ga0302235_1051211613300028877PalsaMSPDTRRSQVDRAEAVLSIVAQCRLLKVVRSTLYY
Ga0311362_1123517013300029913BogMSAVVRLSLVDRADPDMSIVEQCRLLKVSRSTLYY
Ga0311358_1076620613300029915BogMNQAERLSLVDRADDQMSIVTQCRLLRVARSTLYYRPVA
Ga0311358_1096198133300029915BogMNQVARLSQVDRGDAELSVVVQCRLLKVARSSLYWRPAAVSEDDLRL
Ga0311326_1048359523300029917BogMSAAARLSLVDRADPALSIVAQCRLLKVARSTLYHRP
Ga0311363_1119985013300029922FenMNQAARLSLVDRADDQMSIVTQCRLLRVARSTLYYRPVAAS
Ga0311352_1149328523300029944PalsaMSAAERLVLVDGAESGLSIAAQCRLLKVARSTLYYRPLPVS
Ga0311371_1178101323300029951PalsaMSTAARLPLVDRTDLILSVVAQCRLLKIARSTLYYRPDGA
Ga0311331_1137156523300029954BogMSAAARLSLVDRADPALSIVAQCRLLKVARSTLYHRPAPV
Ga0302277_106496523300029982BogMNAAARLSLVDRTDSALSIVAQCRMLKIARSTLYWRPAAASDG
Ga0311334_1111888913300029987FenMNQVARLSLVDGADADLSIVAQCRLLKVARSSLYWRPAAVSEDD
Ga0311339_1152472523300029999PalsaMSPAVRLTLVDRADGQLSIVAQCRLLQVARSTLYW
Ga0311350_1024899133300030002FenMSQATRLTLVDSASDELSIVAQCRLLKIARSTLYWRPAAVSEDDL
Ga0302270_1008882613300030011BogMNAAARLSLVDRTDSALSIVAQCRMLKIARSTLYW
Ga0311344_1142587113300030020BogMSAAARLSLVDRADPALSIVAQCRLLKVARSTLYHRPA
Ga0311344_1143784313300030020BogMSPAARLSLVDRADSAVSIMAQCQLLKVARSALYYRPA
Ga0302177_1063502323300030053PalsaMNRAERLALVDHDDPVLPVTAQCRLLKVARSTLYYQSIPADADELAV
Ga0311353_1095729323300030399PalsaMPDEGMSPGERRALAERDDTDPIAAQYRLLNVARSTLHYQPAPMHPDDLA
Ga0311370_1242809313300030503PalsaMNRAERLALVDHDDPVLPVAAQCRLLKVARSPLYYQPIPADADELA
Ga0265393_120584213300030586SoilMNRSDRLALVDHDDPALPVVAQCRLLKVARSTLYYRPVPVSAD
Ga0311356_1128788823300030617PalsaMNRAERLALVDHDDPVLPVTAQCRLLKVARSTLYY
Ga0311354_1167053123300030618PalsaMSGVARLALVDRADGALSIVAQCRMLRVARSTLYWRPAPV
Ga0265461_1395787923300030743SoilMTRIARLSLVDRADASLSIAAQCRLLKIARSSLYWRPAAMSEDEKQRRKRK
Ga0265723_101687523300030872SoilMSPGERRALVDRDDPDLPIAVQCRLLKVARSTLYYQPTPVDPDDL
Ga0170834_10604198423300031057Forest SoilMSSAERLALVEHADPVLSVVAQCRLLKVVRSTLYYPPGTGEPG
Ga0170824_10591025613300031231Forest SoilMNRAERLALVDHDDPVLPVTAQCRLLKVARSTLYYQPVSASAE
Ga0170824_12606974923300031231Forest SoilMNRPERLALVDHDDPVLPVTAQCRLLKVARSTLYYQP
Ga0265329_1023552533300031242RhizosphereMTRPERLALVDHDDLALPVVVQCRLLKVARSTLYYRPVPVSADD
Ga0272432_123006533300031470RockVEKVGAMSPGERRALVDRDDPDLSVAAQCRLLKVARST
Ga0170818_11306099513300031474Forest SoilMSRPERLALVDHDDPVPPVVAQCQLLKVARSTLYYRP
Ga0318574_1084918813300031680SoilMSAVERRGLVDNADQALSVVAQCRLLKIARSTLYYR
Ga0311351_1087965533300031722FenMNEVARLSLVDGADADLSIVAQCRLLKVARSSLYW
Ga0302321_10010668043300031726FenMSPSARLALVDSADPVLSVVAQCRLLKVARSTLYYRPAPLR
Ga0302319_1050390613300031788BogMNQVARLSLVDRADAGLSIVAQCRLLKVARSSLYWRPAAVSE
Ga0318505_1057639823300032060SoilMSAVERRGLVDNADQALSVVAQCRLLKIARSTLYYRPVPI
Ga0315742_1068207513300032756Forest SoilMNRAERLVLVAHDDPVLPVTTQCRLLQVARSTLYYQPVPAGSD
Ga0335074_1107489913300032895SoilMSPTDRLLLVDRADPRLSIVAQCRLLKIARSTLYYRPA
Ga0316624_1042674413300033486SoilMNQMTRLSLVDRSDADLSIVAQCRLLKVARSTLYYRA
Ga0334987_0119696_1123_12453300034061FreshwaterMSRAARLALVDRDDPAMPVTAQCRLLKVARSTLYHRKRCG
Ga0335063_0602221_17_1393300034111FreshwaterMSRATRLALVDRDDPAMPVTAQCRLLKVARSTLYHRKRCG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.