Basic Information | |
---|---|
Family ID | F075460 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 41 residues |
Representative Sequence | VPVWGVVPERVGIAAGPEARLYREGLEEYDKVLRRALRGR |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.52 % |
% of genes near scaffold ends (potentially truncated) | 94.12 % |
% of genes from short scaffolds (< 2000 bps) | 92.44 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.597 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (7.563 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.689 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.580 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF09996 | DUF2237 | 9.24 |
PF04185 | Phosphoesterase | 3.36 |
PF00266 | Aminotran_5 | 2.52 |
PF04545 | Sigma70_r4 | 2.52 |
PF07883 | Cupin_2 | 1.68 |
PF02774 | Semialdhyde_dhC | 1.68 |
PF02653 | BPD_transp_2 | 1.68 |
PF08352 | oligo_HPY | 1.68 |
PF05988 | DUF899 | 1.68 |
PF00005 | ABC_tran | 1.68 |
PF04087 | DUF389 | 1.68 |
PF00557 | Peptidase_M24 | 1.68 |
PF07978 | NIPSNAP | 1.68 |
PF01243 | Putative_PNPOx | 1.68 |
PF14542 | Acetyltransf_CG | 1.68 |
PF01551 | Peptidase_M23 | 0.84 |
PF07837 | FTCD_N | 0.84 |
PF03631 | Virul_fac_BrkB | 0.84 |
PF12897 | Asp_aminotransf | 0.84 |
PF11336 | DUF3138 | 0.84 |
PF09723 | Zn-ribbon_8 | 0.84 |
PF09140 | MipZ | 0.84 |
PF13683 | rve_3 | 0.84 |
PF03841 | SelA | 0.84 |
PF12697 | Abhydrolase_6 | 0.84 |
PF05157 | T2SSE_N | 0.84 |
PF00216 | Bac_DNA_binding | 0.84 |
PF09948 | DUF2182 | 0.84 |
PF01425 | Amidase | 0.84 |
PF12277 | DUF3618 | 0.84 |
PF00587 | tRNA-synt_2b | 0.84 |
PF06262 | Zincin_1 | 0.84 |
PF00903 | Glyoxalase | 0.84 |
PF13191 | AAA_16 | 0.84 |
PF04984 | Phage_sheath_1 | 0.84 |
PF13376 | OmdA | 0.84 |
PF13336 | AcetylCoA_hyd_C | 0.84 |
PF12680 | SnoaL_2 | 0.84 |
PF02775 | TPP_enzyme_C | 0.84 |
PF01042 | Ribonuc_L-PSP | 0.84 |
PF00696 | AA_kinase | 0.84 |
PF13185 | GAF_2 | 0.84 |
PF00174 | Oxidored_molyb | 0.84 |
PF02614 | UxaC | 0.84 |
PF07045 | DUF1330 | 0.84 |
PF03640 | Lipoprotein_15 | 0.84 |
PF00180 | Iso_dh | 0.84 |
PF00248 | Aldo_ket_red | 0.84 |
PF00313 | CSD | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 3.36 |
COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 1.68 |
COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 1.68 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.68 |
COG1808 | Uncharacterized membrane protein AF0785, contains DUF389 domain | Function unknown [S] | 1.68 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.84 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.84 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.84 |
COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
COG3643 | Glutamate formiminotransferase | Amino acid transport and metabolism [E] | 0.84 |
COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.84 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.84 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.84 |
COG1904 | Glucuronate isomerase | Carbohydrate transport and metabolism [G] | 0.84 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.84 |
COG1192 | ParA-like ATPase involved in chromosome/plasmid partitioning or cellulose biosynthesis protein BcsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.84 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.84 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.84 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.60 % |
Unclassified | root | N/A | 8.40 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig65884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
2170459007|GJ61VE201CCEO3 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
2170459008|GA8OVOZ02I6JYX | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
2199352024|deeps__Contig_125351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300000956|JGI10216J12902_115013131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 795 | Open in IMG/M |
3300001398|JGI20207J14881_1000317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17831 | Open in IMG/M |
3300001398|JGI20207J14881_1056056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 690 | Open in IMG/M |
3300003369|JGI24140J50213_10111349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 899 | Open in IMG/M |
3300003369|JGI24140J50213_10265043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
3300004081|Ga0063454_101965248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales | 516 | Open in IMG/M |
3300004092|Ga0062389_100438631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1437 | Open in IMG/M |
3300004152|Ga0062386_100888507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
3300004479|Ga0062595_101643122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
3300005172|Ga0066683_10686039 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300005336|Ga0070680_100905138 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300005455|Ga0070663_100774955 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300005529|Ga0070741_10000590 | All Organisms → cellular organisms → Bacteria | 126482 | Open in IMG/M |
3300005529|Ga0070741_10249986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1690 | Open in IMG/M |
3300005532|Ga0070739_10011162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8518 | Open in IMG/M |
3300005538|Ga0070731_10901596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
3300005546|Ga0070696_100833306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 761 | Open in IMG/M |
3300005557|Ga0066704_10397865 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300005598|Ga0066706_11002838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Mumia | 644 | Open in IMG/M |
3300005712|Ga0070764_10385716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
3300005899|Ga0075271_10077464 | Not Available | 617 | Open in IMG/M |
3300006028|Ga0070717_11857010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
3300006034|Ga0066656_10595329 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300006046|Ga0066652_101794074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
3300006358|Ga0068871_100829988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
3300006638|Ga0075522_10016593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4716 | Open in IMG/M |
3300006638|Ga0075522_10498429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
3300006755|Ga0079222_11604100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
3300006797|Ga0066659_11430403 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300006800|Ga0066660_10863531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 737 | Open in IMG/M |
3300009839|Ga0116223_10331861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 903 | Open in IMG/M |
3300010038|Ga0126315_10349154 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300010325|Ga0134064_10294096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Mumia | 616 | Open in IMG/M |
3300010373|Ga0134128_10875729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
3300010375|Ga0105239_10834359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1057 | Open in IMG/M |
3300010375|Ga0105239_11598581 | Not Available | 754 | Open in IMG/M |
3300010379|Ga0136449_102809866 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300010379|Ga0136449_103744677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
3300010937|Ga0137776_1693727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
3300011991|Ga0120153_1052557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
3300012204|Ga0137374_10792793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
3300012205|Ga0137362_10952548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300012205|Ga0137362_11627674 | Not Available | 532 | Open in IMG/M |
3300012212|Ga0150985_113352826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
3300012353|Ga0137367_10165802 | Not Available | 1608 | Open in IMG/M |
3300012469|Ga0150984_105529571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300012469|Ga0150984_106950252 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300012685|Ga0137397_10758021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 720 | Open in IMG/M |
3300012925|Ga0137419_11103591 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300012960|Ga0164301_11086641 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300012961|Ga0164302_11604518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
3300012987|Ga0164307_10625032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 834 | Open in IMG/M |
3300013100|Ga0157373_10576665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
3300013105|Ga0157369_11526795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
3300013105|Ga0157369_12689882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
3300013768|Ga0120155_1037838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1488 | Open in IMG/M |
3300014168|Ga0181534_10909535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 526 | Open in IMG/M |
3300014168|Ga0181534_10955720 | Not Available | 515 | Open in IMG/M |
3300014489|Ga0182018_10251589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
3300014495|Ga0182015_10481240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
3300014497|Ga0182008_10890658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
3300014501|Ga0182024_12907691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 507 | Open in IMG/M |
3300014638|Ga0181536_10201233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiales incertae sedis → Allonocardiopsis → Allonocardiopsis opalescens | 992 | Open in IMG/M |
3300014838|Ga0182030_10240445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2088 | Open in IMG/M |
3300014838|Ga0182030_10675793 | Not Available | 975 | Open in IMG/M |
3300016341|Ga0182035_11414333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
3300016422|Ga0182039_10443441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1111 | Open in IMG/M |
3300017973|Ga0187780_10081733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia | 2221 | Open in IMG/M |
3300019787|Ga0182031_1479323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1721 | Open in IMG/M |
3300020080|Ga0206350_10159173 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
3300021073|Ga0210378_10049565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1657 | Open in IMG/M |
3300021363|Ga0193699_10402497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300025604|Ga0207930_1067554 | Not Available | 861 | Open in IMG/M |
3300025854|Ga0209176_10029408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1166 | Open in IMG/M |
3300025862|Ga0209483_1248781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
3300025909|Ga0207705_10065549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2626 | Open in IMG/M |
3300025909|Ga0207705_10120284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1948 | Open in IMG/M |
3300025909|Ga0207705_10537518 | Not Available | 908 | Open in IMG/M |
3300025913|Ga0207695_10683080 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300025916|Ga0207663_11307630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300025917|Ga0207660_10334906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1210 | Open in IMG/M |
3300025919|Ga0207657_10326590 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300025919|Ga0207657_10653629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
3300025924|Ga0207694_11047523 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300025927|Ga0207687_11617189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
3300025929|Ga0207664_10824644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
3300025929|Ga0207664_11793116 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
3300025929|Ga0207664_11988857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
3300026325|Ga0209152_10470830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300027574|Ga0208982_1098269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 595 | Open in IMG/M |
3300027634|Ga0209905_1050761 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300027773|Ga0209810_1032241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3070 | Open in IMG/M |
3300027867|Ga0209167_10350073 | Not Available | 803 | Open in IMG/M |
3300028558|Ga0265326_10032443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1487 | Open in IMG/M |
3300028577|Ga0265318_10234078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 670 | Open in IMG/M |
3300028877|Ga0302235_10081534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 1493 | Open in IMG/M |
3300029915|Ga0311358_11006095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 573 | Open in IMG/M |
3300030503|Ga0311370_12178780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 546 | Open in IMG/M |
3300030519|Ga0302193_10294645 | Not Available | 857 | Open in IMG/M |
3300030617|Ga0311356_11318107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10020381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1705 | Open in IMG/M |
3300031234|Ga0302325_12339387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
3300031239|Ga0265328_10117983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 988 | Open in IMG/M |
3300031543|Ga0318516_10233071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1064 | Open in IMG/M |
3300031561|Ga0318528_10296327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 868 | Open in IMG/M |
3300031670|Ga0307374_10655180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300031711|Ga0265314_10254139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1007 | Open in IMG/M |
3300031859|Ga0318527_10139212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1014 | Open in IMG/M |
3300031902|Ga0302322_100262370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1923 | Open in IMG/M |
3300031912|Ga0306921_12753659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 504 | Open in IMG/M |
3300031938|Ga0308175_102322512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
3300032066|Ga0318514_10772520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
3300032783|Ga0335079_10670911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
3300033824|Ga0334840_051328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1225 | Open in IMG/M |
3300033887|Ga0334790_032671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2131 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 7.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.56% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.04% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.36% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.36% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.36% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.52% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.52% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.52% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.52% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.68% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.68% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.68% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.68% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.68% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.68% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.68% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.68% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.84% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.84% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.84% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.84% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.84% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.84% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.84% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.84% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
2170459008 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cm | Environmental | Open in IMG/M |
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001398 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 | Environmental | Open in IMG/M |
3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027634 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0884.00003850 | 2166559005 | Simulated | VAVWGVIPERVGIAAGPEARLYRDGLAEYDAVFRRVARKL |
L02_02359810 | 2170459007 | Grass Soil | IAVWGVVPERVAIASGPEANLSREGLELYAAVLRKAQG |
F48_04758810 | 2170459008 | Grass Soil | VIPERVGIAAGPEARLYRQGLDEYDAVFRRVLRRI |
deeps_02269020 | 2199352024 | Soil | VPVWGVVPERVGIAAGPEARLYREGLEEYDKVLRRALRGR |
JGI10216J12902_1150131311 | 3300000956 | Soil | IPERVGIAAGPEARLYREGLSEYGTVLQRALRRR* |
JGI20207J14881_100031716 | 3300001398 | Arctic Peat Soil | EQKVALWGVIPERVGIAAGPEARLSREGLEGYDAVLRRALRGWY* |
JGI20207J14881_10560561 | 3300001398 | Arctic Peat Soil | IWGIIPERVGIASGPEARLYREGLDAYDTVLKKALRKR* |
JGI24140J50213_101113493 | 3300003369 | Arctic Peat Soil | ENQVPIWGVIPERVGIASGPEARLYREGLDAYAGVLKKAVRRRS* |
JGI24140J50213_102650431 | 3300003369 | Arctic Peat Soil | EIWGVIPERVGIAAGPEARLSRDGLEGYDAVLHRALRGWR* |
Ga0063454_1019652481 | 3300004081 | Soil | WWKGEGVPIWGVVPERVGIAAGPEARLYREGLDEYGKVLRYALRSR* |
Ga0062389_1004386311 | 3300004092 | Bog Forest Soil | KAEKVPIWGIIPERVGIAAGPEARLFREGLDEYDKVLRKALRRG* |
Ga0062386_1008885071 | 3300004152 | Bog Forest Soil | VPVWGIIPERVGIAAGPAGRIHPEGLEQYRAVLKRAMRGAR* |
Ga0062595_1016431221 | 3300004479 | Soil | VWGVVPERVGIAAGPEARLYREGLTEYDKVLRRVLRGSR* |
Ga0066683_106860391 | 3300005172 | Soil | AWWKTERVPIWGLIPERVGIAAGPEARLYREGRERYATVLQRALRQKH* |
Ga0070680_1009051383 | 3300005336 | Corn Rhizosphere | WWKGEGVPIWGVVPERVAIAAGPEARLYREGLAEYDTVLRKALKR* |
Ga0070663_1007749551 | 3300005455 | Corn Rhizosphere | DVPIWGVVPERVGIAAGPEARLYREGLDEYGHVLRRVLRSRR* |
Ga0070741_100005901 | 3300005529 | Surface Soil | EKVPIWGVVPERVGIAAGPEARLYREGLEEYAKVLRRALRGGR* |
Ga0070741_102499861 | 3300005529 | Surface Soil | WGIVPERVGIASGPEARLSREGLALYSGVLRRARGRR* |
Ga0070739_100111621 | 3300005532 | Surface Soil | PIWGVIPERVGIAAGPEARLYREGLEEYASVLKRALRRVK* |
Ga0070731_109015962 | 3300005538 | Surface Soil | WKGESVPVWAVVPERVGIAAGPESRLYRDGLDEYDRLLRRVLRAL* |
Ga0070696_1008333063 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | PIWGVVPERVGIAAGPEARLYRDGLDEYGKVLRRVMRTR* |
Ga0066704_103978651 | 3300005557 | Soil | PVWGVVPERVAIAAGPEARLYREGLEEYDAVLRRALRRR* |
Ga0066706_110028381 | 3300005598 | Soil | VWGVIPERVGIAAGPESRLYREGLDEYDKVLRRALRGTR* |
Ga0070764_103857162 | 3300005712 | Soil | TAGVPVWGVIPERVGIAAGPSGRIYAEGLEEYQGVLKKALRGLR* |
Ga0075271_100774642 | 3300005899 | Rice Paddy Soil | GVIPERVGIAAGPEGRLYREGLTEYDAVLRRALRGRR* |
Ga0070717_118570102 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KTPIWGIVPERVGIASGPEARLSREGLALYSAVLRRARGRR* |
Ga0066656_105953292 | 3300006034 | Soil | IPERVGIASGPEGRLYREGLNEYDAVLKRALRGKR* |
Ga0066652_1017940743 | 3300006046 | Soil | WGLIPERVGIAAGPDARLYREGRERYATVLQRALRQKH* |
Ga0068871_1008299881 | 3300006358 | Miscanthus Rhizosphere | WGVIPERVGIAAGPEARLYREGLNEYEAVLRRALRKR* |
Ga0075522_100165931 | 3300006638 | Arctic Peat Soil | IWGVIPERVGIAAGPEARLYRQGLDEYGSVLRRVLRKR* |
Ga0075522_104984291 | 3300006638 | Arctic Peat Soil | EIWGVIPERVGIAAGPEARLSREGLEGYDAVLHRALRGWH* |
Ga0079222_116041002 | 3300006755 | Agricultural Soil | VVPERVGIAAGPEARLYRDGLDEYAKMLRRIRRTN* |
Ga0066659_114304032 | 3300006797 | Soil | GVIPERVGIAAGPEGRLYREGLNEYDAVLRRALRGKR* |
Ga0066660_108635313 | 3300006800 | Soil | WGVIPERVGIASGPEARLDREGLQLYTGVLRRAQRGLR* |
Ga0116223_103318611 | 3300009839 | Peatlands Soil | KVPIWGVIPERVGIASGPASRIYREGLEAYQEILRKVMRAVR* |
Ga0126315_103491541 | 3300010038 | Serpentine Soil | IWGVIPERVGIAAGPEARLYRDGLDEYGHVLRQVLRSS* |
Ga0134064_102940961 | 3300010325 | Grasslands Soil | KVPVWGVIPERVAIAAGPESRLYREGLDEYDKVLRRALRGTR* |
Ga0134128_108757291 | 3300010373 | Terrestrial Soil | KKEGVRIWGVIPERVGIAAGPEARLYREGLQGYDGVLRAALRATR* |
Ga0105239_108343591 | 3300010375 | Corn Rhizosphere | PIWGVVPERVGIAAGPEARLYRDGLDEYGKVLRRVMRSR* |
Ga0105239_115985811 | 3300010375 | Corn Rhizosphere | KVPIWGVVPERVGIAAGPEARLYRDGLDEYGNVLRRVLRAAR* |
Ga0136449_1028098662 | 3300010379 | Peatlands Soil | VIPERVGIAAGPEARLYREGLNEYDVVLRRVLRGTR* |
Ga0136449_1037446771 | 3300010379 | Peatlands Soil | VPVWGVIPERVGIAAGPEARLYAGGLESYDAVLRRALRQRSS* |
Ga0137776_16937272 | 3300010937 | Sediment | RVAVWGVIPERVGIAAGPEARLHREGIERYSAVLRRALRKG* |
Ga0120153_10525572 | 3300011991 | Permafrost | AWWKGENVSVWGVIPERVGIAAGPEARLYREGLHEYEAILRRALRKR* |
Ga0137374_107927933 | 3300012204 | Vadose Zone Soil | GVVPERVGIAAGPEARLYREGLVEYDKVLRRVLRGRR* |
Ga0137362_109525482 | 3300012205 | Vadose Zone Soil | PLWGVIPERVAIAAGPEARLYRQGLEEYDAVLRRALRAR* |
Ga0137362_116276741 | 3300012205 | Vadose Zone Soil | AEKVAIWGVIPERVGIAAGPEARLYRQGLDEYDAVLRRVLRAS* |
Ga0150985_1133528262 | 3300012212 | Avena Fatua Rhizosphere | WKGESVPIWGVVPERVGIAAGPEARLYRDGLDEYGNVLRRVLRSR* |
Ga0137367_101658021 | 3300012353 | Vadose Zone Soil | KEQKVPVWGVIPERVGIAAGPEARLYREGLDEYGTVLLRALRRRR* |
Ga0150984_1055295712 | 3300012469 | Avena Fatua Rhizosphere | VPIWAVVPERVGIAAGPESRLYREGLEEYDKALRRALAGR* |
Ga0150984_1069502521 | 3300012469 | Avena Fatua Rhizosphere | VPIWGVVPERVGIAAGPEARLYRDGLDEYGSVLRRVLRSR* |
Ga0137397_107580212 | 3300012685 | Vadose Zone Soil | VIPERVGIASGPEARLYREGLDAYDAVLKKALRKR* |
Ga0137419_111035912 | 3300012925 | Vadose Zone Soil | AEKVPIWGVVPERVGIAAGPEARLYREGLDEYDKVLRRALRAR* |
Ga0164301_110866411 | 3300012960 | Soil | WWKGEGGPIWGVVPERVGIAAGPEARLYREGLDEYGKVLRSVLRTR* |
Ga0164302_116045181 | 3300012961 | Soil | EKVPVWGVIPERVGIAAGPEARLYRQGLDEYDAVLRRLLRKL* |
Ga0164307_106250323 | 3300012987 | Soil | WGVVPERVGIAAGPEARLYREGLDEYGKVLRRVLRAT* |
Ga0157373_105766651 | 3300013100 | Corn Rhizosphere | EGVPIWGVIPERVAIAAGPEGRLHREGLDLYADVLRKARARR* |
Ga0157369_115267952 | 3300013105 | Corn Rhizosphere | SVWGVIPERVAIAAGPEGRLHREGLDLYADVLRKARARR* |
Ga0157369_126898821 | 3300013105 | Corn Rhizosphere | VPVWGVIPERVGIAAGPEARLYRQGLDEYDAVLRRLLRKL* |
Ga0120155_10378383 | 3300013768 | Permafrost | VWGVIPERVGIAAGPEARLYREGLNEYEAILRRALRKRA* |
Ga0181534_109095352 | 3300014168 | Bog | VWGIIPERVGIASGPESRLYREGLEAYETVLKKAQKAVRKR* |
Ga0181534_109557201 | 3300014168 | Bog | IWGIIPERVGIASGPEARLYREGLDAYDAVLKKALRKR* |
Ga0182018_102515892 | 3300014489 | Palsa | AWWKEQKVPVWGVIPERVGIAAGPEARLFREGLEEYDAVLRQALRAKRR* |
Ga0182015_104812402 | 3300014495 | Palsa | WGVIPERVGIAAGPEARLFREGLEEYDAVLRQALRAKRR* |
Ga0182008_108906582 | 3300014497 | Rhizosphere | VWGVIPERVGIAAGPEARLYREGLDLYADVLKRAQRRR* |
Ga0182024_129076912 | 3300014501 | Permafrost | PIWGIIPERVGIAAGPEARLYREGLEAYGAVLKKVLRKRSA* |
Ga0181536_102012331 | 3300014638 | Bog | GVIPERVAIATGPEARLSREGLEGYDAVLRRALRGRR* |
Ga0182030_102404451 | 3300014838 | Bog | QKVEIWGVIPERVGIAAGPEAHLSREGLNGYDAVLSRALRGWK* |
Ga0182030_106757931 | 3300014838 | Bog | QKVEIWGVIPERVGIAAGPEAHLSREGLNGYDAVLSRALRAWK* |
Ga0182035_114143333 | 3300016341 | Soil | PVWGVVPERVGIAAGPEARLHRDGLEHYSGVLKRATRAAR |
Ga0182039_104434411 | 3300016422 | Soil | AYWRSEQVPVWGVVPERVGIAAGPEARLHRDGLEHYSGVLKRATRAAR |
Ga0187780_100817331 | 3300017973 | Tropical Peatland | PVWGVVPERVAIASGPASSLSAEGLEHYDKVLRRAIAKPR |
Ga0182031_14793232 | 3300019787 | Bog | EAAITWWKEQKIEIWGVIPERVGIAAGPERRLSREGVEGYDSVLHQALRGWR |
Ga0206350_101591731 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | IPERVGIAAGPEGRLYREGLNEYDAVLRRALRGKR |
Ga0210378_100495654 | 3300021073 | Groundwater Sediment | WGVIPERVGIAAGPEARLYREGLNEYGTVLQRALRRRR |
Ga0193699_104024972 | 3300021363 | Soil | ENVPVWGVIPERVGIAAGPEARLYRDGLTEYDTVLRRALRKR |
Ga0207930_10675541 | 3300025604 | Arctic Peat Soil | WWKEQKMEVWGVIPERVGIAAGPEARLSREGLEGYDAVLHQALRGWR |
Ga0209176_100294082 | 3300025854 | Arctic Peat Soil | AERVPIWGVIPERVGIASGPESKLYREGLDAYDAVLKKALRKRWQ |
Ga0209483_12487812 | 3300025862 | Arctic Peat Soil | VALWGVIPERVGIAAGPEARLSREGLEGYDAVLRRALRGWH |
Ga0207705_100655491 | 3300025909 | Corn Rhizosphere | VIPERVGIAAGPEARLYREGLIEYDTVLRRALRKR |
Ga0207705_101202841 | 3300025909 | Corn Rhizosphere | RAEKVPIWGVIPERVGIAAGPEARLYRQGLDEYDAVLRRALRGR |
Ga0207705_105375184 | 3300025909 | Corn Rhizosphere | PIWGVVPERVGIAAGPEARLYRDGLDEYDSVLKRVLRGR |
Ga0207695_106830801 | 3300025913 | Corn Rhizosphere | WGVIPERVGIAAGPEGRLYREGLNEYDAVLRRALRGKR |
Ga0207663_113076301 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AWWKGENVAVWGVIPERVGIAAGPEARLYRDGLAEYDAVFRRVARKL |
Ga0207660_103349062 | 3300025917 | Corn Rhizosphere | VSVWGVIPERVAIAAGPEGRLHREGLDLYADVLRKARARR |
Ga0207657_103265903 | 3300025919 | Corn Rhizosphere | GVVPERVGIAAGPGARLYREGLDEYGHVLRRVLRSRR |
Ga0207657_106536292 | 3300025919 | Corn Rhizosphere | VIPERVGIAAGPEARLYREGLNEYETVLRRALRKR |
Ga0207694_110475233 | 3300025924 | Corn Rhizosphere | GVVPERVAIAAGPEARLYREGLAEYDTVLRKALKR |
Ga0207687_116171891 | 3300025927 | Miscanthus Rhizosphere | KNENVPIWGVVPERVGIAAGPEARLYRDGLDEYGKVLRRVMRTR |
Ga0207664_108246442 | 3300025929 | Agricultural Soil | KLPIWGVIPERVGIAAGPDARLNRDGLDHYAGVLRRALRQAH |
Ga0207664_117931162 | 3300025929 | Agricultural Soil | GVAIWGVIPERVGIAAGPESRLYREGLDLYADVLKRAQRRR |
Ga0207664_119888571 | 3300025929 | Agricultural Soil | GVVPERVGIAAGPEARLYREGLDEYGKVLRRVLRATRSTAH |
Ga0209152_104708302 | 3300026325 | Soil | IPERVGIAAGPEARLYREGLDLYDEVLRKALRKRA |
Ga0208982_10982691 | 3300027574 | Forest Soil | PERVGIAAGPEARLYREGLDEYDAVLKKALRKRPG |
Ga0209905_10507612 | 3300027634 | Thawing Permafrost | EIWGVIPERVGIAAGPEARLSREGLEGYDVVLSRALRGWR |
Ga0209810_10322411 | 3300027773 | Surface Soil | PIWGVIPERVGIAAGPEARLYREGLEEYASVLKRALRRVK |
Ga0209167_103500731 | 3300027867 | Surface Soil | PERVAIASGPEARLSREGIEAYAGVLRRATRRRPH |
Ga0265326_100324433 | 3300028558 | Rhizosphere | WWKSQSVAIWGVIPERVGVAAGPEARLYREGLNEYDVVLRRALRRTR |
Ga0265318_102340784 | 3300028577 | Rhizosphere | QKVAIWGVIPERVGIAAGPESRLYREGLNEYAAVLRRALRGAR |
Ga0302235_100815344 | 3300028877 | Palsa | SKVPIWGIIPERVGIASGPEARLYREGLDAYDAVLKKALRKR |
Ga0311358_110060952 | 3300029915 | Bog | WGIIPERVGIASGPEARLYREGLDAYSAVLKKAIRKRPS |
Ga0311370_121787802 | 3300030503 | Palsa | IVPERVGIAAGPEARLYRDGLDEYDAVLKKALRKRPG |
Ga0302193_102946451 | 3300030519 | Bog | IPERVGIAAGPESKLYRDGIEAYDAVLKKALRKRQA |
Ga0311356_113181072 | 3300030617 | Palsa | VPIWGVIPERVGIATGPAGRIYREGLEAYQEILRKVMRAALR |
(restricted) Ga0255310_100203811 | 3300031197 | Sandy Soil | WWREQKTPIWGIVPERVGIASGPEARLSREGLALYAAVLRRARR |
Ga0302325_123393871 | 3300031234 | Palsa | VAIWGVVPERVGIAAGPEARLFRDGLESYEAILRTILKQRRSRAAR |
Ga0265328_101179832 | 3300031239 | Rhizosphere | QSVAIWGVIPERVGVAAGPEARLYREGLNEYDVVLRRALRRTR |
Ga0318516_102330712 | 3300031543 | Soil | KSQNVPIWGVVPERVGIAAGPEARLYRDGLDEYGKVFRRVLRTS |
Ga0318528_102963271 | 3300031561 | Soil | VWGVVPERVGIAAGPEARLHRDGLEHYSGVLKRATRAAR |
Ga0307374_106551801 | 3300031670 | Soil | IAWWKEQKVELWGVIPERVGIAAGPEARLSREGLEGYDAVLRRALRGWH |
Ga0265314_102541391 | 3300031711 | Rhizosphere | SQSVTIWGVIPERVGVAAGPEARLYREGLNEYDVVLRRALRRTR |
Ga0318527_101392121 | 3300031859 | Soil | VPVWGVVPERVGIAAGPEARLHRDGLEHYSGVLKRATRAAR |
Ga0302322_1002623701 | 3300031902 | Fen | VWGVIPERVGIAAGPEARLYRDGLHEYEAILRRALRKR |
Ga0306921_127536591 | 3300031912 | Soil | IWGVIPERVGIAAGPEARLFREGLDAYDAVLKKALRRRSG |
Ga0308175_1023225123 | 3300031938 | Soil | EGVPVWGVVPERVAIAAGPEARLYREGLDEYDGVLRKALRGR |
Ga0318514_107725201 | 3300032066 | Soil | WRAEKVPIWGVIPERVGIAAGPEARLYRPGLNEYDAVLRRALRSRRRD |
Ga0335079_106709111 | 3300032783 | Soil | IPERVGIAAGPDARLYREGLNEYDKVLRRALRGKR |
Ga0334840_051328_1081_1206 | 3300033824 | Soil | MEIWGVIPERVGIAAGPERRLSREGLEGYDAVLHQALRGWR |
Ga0334790_032671_2002_2130 | 3300033887 | Soil | KLEIWGVIPERVGIAAGPEARLSREGLEGYDAVLNRALRGWR |
⦗Top⦘ |