| Basic Information | |
|---|---|
| Family ID | F075277 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 42 residues |
| Representative Sequence | ALATWYGVLHQDIRKILDEVGPQQQPVIAPSVGDALHARG |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.48 % |
| % of genes from short scaffolds (< 2000 bps) | 89.08 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.311 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (55.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.908 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (56.303 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF02321 | OEP | 52.10 |
| PF03976 | PPK2 | 10.08 |
| PF13533 | Biotin_lipoyl_2 | 1.68 |
| PF13847 | Methyltransf_31 | 0.84 |
| PF13637 | Ank_4 | 0.84 |
| PF00365 | PFK | 0.84 |
| PF00924 | MS_channel | 0.84 |
| PF00892 | EamA | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 104.20 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 10.08 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.84 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.31 % |
| Unclassified | root | N/A | 22.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_11189370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 521 | Open in IMG/M |
| 3300005764|Ga0066903_108963646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300005843|Ga0068860_101519956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300006172|Ga0075018_10529834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 618 | Open in IMG/M |
| 3300006175|Ga0070712_100842225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 788 | Open in IMG/M |
| 3300006176|Ga0070765_100256042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1606 | Open in IMG/M |
| 3300006176|Ga0070765_101277682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300006176|Ga0070765_101690702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300006954|Ga0079219_11521259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300007258|Ga0099793_10252716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 851 | Open in IMG/M |
| 3300009792|Ga0126374_11722105 | Not Available | 522 | Open in IMG/M |
| 3300010358|Ga0126370_11571801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300010361|Ga0126378_12876742 | Not Available | 549 | Open in IMG/M |
| 3300010362|Ga0126377_11112035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300010362|Ga0126377_13002815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 544 | Open in IMG/M |
| 3300010366|Ga0126379_11229036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300010376|Ga0126381_100112169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3509 | Open in IMG/M |
| 3300012363|Ga0137390_10789728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 908 | Open in IMG/M |
| 3300016341|Ga0182035_11594159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300016357|Ga0182032_11471610 | Not Available | 591 | Open in IMG/M |
| 3300016357|Ga0182032_12060979 | Not Available | 501 | Open in IMG/M |
| 3300016371|Ga0182034_10181665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1611 | Open in IMG/M |
| 3300016371|Ga0182034_10742476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300016371|Ga0182034_11734830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 550 | Open in IMG/M |
| 3300016387|Ga0182040_10575334 | Not Available | 909 | Open in IMG/M |
| 3300016404|Ga0182037_10038664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 3100 | Open in IMG/M |
| 3300016404|Ga0182037_10458687 | Not Available | 1061 | Open in IMG/M |
| 3300016422|Ga0182039_10290650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1350 | Open in IMG/M |
| 3300016445|Ga0182038_10414724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1132 | Open in IMG/M |
| 3300018060|Ga0187765_10237647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1068 | Open in IMG/M |
| 3300018062|Ga0187784_10715780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 801 | Open in IMG/M |
| 3300019789|Ga0137408_1250979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300020199|Ga0179592_10073495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1566 | Open in IMG/M |
| 3300020580|Ga0210403_10204778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1619 | Open in IMG/M |
| 3300021181|Ga0210388_10825890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 802 | Open in IMG/M |
| 3300021433|Ga0210391_11002885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300021439|Ga0213879_10121812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300021560|Ga0126371_12229547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300021560|Ga0126371_13860436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 505 | Open in IMG/M |
| 3300025916|Ga0207663_10313585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1176 | Open in IMG/M |
| 3300026557|Ga0179587_10391995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 904 | Open in IMG/M |
| 3300027605|Ga0209329_1001470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3460 | Open in IMG/M |
| 3300028906|Ga0308309_10582768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300031231|Ga0170824_118575101 | Not Available | 512 | Open in IMG/M |
| 3300031543|Ga0318516_10767663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 545 | Open in IMG/M |
| 3300031544|Ga0318534_10112144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1565 | Open in IMG/M |
| 3300031545|Ga0318541_10598310 | Not Available | 617 | Open in IMG/M |
| 3300031546|Ga0318538_10823592 | Not Available | 504 | Open in IMG/M |
| 3300031549|Ga0318571_10019743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1748 | Open in IMG/M |
| 3300031561|Ga0318528_10474024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300031572|Ga0318515_10131463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1327 | Open in IMG/M |
| 3300031572|Ga0318515_10767150 | Not Available | 509 | Open in IMG/M |
| 3300031713|Ga0318496_10615961 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031736|Ga0318501_10208063 | Not Available | 1026 | Open in IMG/M |
| 3300031747|Ga0318502_10429750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300031748|Ga0318492_10626755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 574 | Open in IMG/M |
| 3300031753|Ga0307477_10224245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1304 | Open in IMG/M |
| 3300031754|Ga0307475_11554708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 506 | Open in IMG/M |
| 3300031764|Ga0318535_10342418 | Not Available | 668 | Open in IMG/M |
| 3300031765|Ga0318554_10267221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 974 | Open in IMG/M |
| 3300031768|Ga0318509_10597923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300031770|Ga0318521_10839909 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031771|Ga0318546_10053731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2518 | Open in IMG/M |
| 3300031779|Ga0318566_10193570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1009 | Open in IMG/M |
| 3300031781|Ga0318547_10078932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1839 | Open in IMG/M |
| 3300031781|Ga0318547_11037924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300031792|Ga0318529_10457682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 594 | Open in IMG/M |
| 3300031798|Ga0318523_10074498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1636 | Open in IMG/M |
| 3300031805|Ga0318497_10035543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2509 | Open in IMG/M |
| 3300031821|Ga0318567_10232496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1033 | Open in IMG/M |
| 3300031821|Ga0318567_10423966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300031831|Ga0318564_10182084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 936 | Open in IMG/M |
| 3300031835|Ga0318517_10507398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300031846|Ga0318512_10048271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1892 | Open in IMG/M |
| 3300031846|Ga0318512_10710729 | Not Available | 515 | Open in IMG/M |
| 3300031859|Ga0318527_10183120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300031860|Ga0318495_10203612 | Not Available | 891 | Open in IMG/M |
| 3300031860|Ga0318495_10245407 | Not Available | 802 | Open in IMG/M |
| 3300031879|Ga0306919_10076431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2296 | Open in IMG/M |
| 3300031879|Ga0306919_10248317 | Not Available | 1338 | Open in IMG/M |
| 3300031880|Ga0318544_10139136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 927 | Open in IMG/M |
| 3300031893|Ga0318536_10573036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 565 | Open in IMG/M |
| 3300031896|Ga0318551_10062473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1908 | Open in IMG/M |
| 3300031897|Ga0318520_10243581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1071 | Open in IMG/M |
| 3300031897|Ga0318520_10670832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 647 | Open in IMG/M |
| 3300031910|Ga0306923_11525354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300031912|Ga0306921_10104945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3278 | Open in IMG/M |
| 3300031941|Ga0310912_10275469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1299 | Open in IMG/M |
| 3300031941|Ga0310912_10291942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1261 | Open in IMG/M |
| 3300031942|Ga0310916_10184347 | Not Available | 1740 | Open in IMG/M |
| 3300031945|Ga0310913_10442442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300031947|Ga0310909_10869415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300031947|Ga0310909_11294928 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300031947|Ga0310909_11604658 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031954|Ga0306926_10242347 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
| 3300031959|Ga0318530_10497002 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031959|Ga0318530_10509811 | Not Available | 500 | Open in IMG/M |
| 3300031981|Ga0318531_10165659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 992 | Open in IMG/M |
| 3300031981|Ga0318531_10389028 | Not Available | 631 | Open in IMG/M |
| 3300031981|Ga0318531_10532887 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300032001|Ga0306922_10548814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1229 | Open in IMG/M |
| 3300032001|Ga0306922_10976126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300032010|Ga0318569_10243565 | Not Available | 835 | Open in IMG/M |
| 3300032043|Ga0318556_10073353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1697 | Open in IMG/M |
| 3300032052|Ga0318506_10001506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5993 | Open in IMG/M |
| 3300032055|Ga0318575_10217799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 960 | Open in IMG/M |
| 3300032059|Ga0318533_10373137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1040 | Open in IMG/M |
| 3300032059|Ga0318533_11077699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 589 | Open in IMG/M |
| 3300032059|Ga0318533_11343094 | Not Available | 522 | Open in IMG/M |
| 3300032064|Ga0318510_10385301 | Not Available | 595 | Open in IMG/M |
| 3300032066|Ga0318514_10258366 | Not Available | 918 | Open in IMG/M |
| 3300032066|Ga0318514_10656230 | Not Available | 558 | Open in IMG/M |
| 3300032068|Ga0318553_10228889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300032090|Ga0318518_10224656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 963 | Open in IMG/M |
| 3300032205|Ga0307472_100098830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2001 | Open in IMG/M |
| 3300033290|Ga0318519_10208386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1117 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 55.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.36% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.68% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.84% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.84% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_111893701 | 3300004080 | Bog Forest Soil | LATWYRLLHEDIRKILDEVGPEPLLRVAPSVGDPLHAAG* |
| Ga0066903_1089636462 | 3300005764 | Tropical Forest Soil | SGRCEHLTALATWYRLLHQDIREILDQVGPQPQPAIAPPVGDVLHAAG* |
| Ga0068860_1015199562 | 3300005843 | Switchgrass Rhizosphere | ATWYGVLHQGIRKILDEVAPQPQSVIEPSGGDPLHATG* |
| Ga0075018_105298342 | 3300006172 | Watersheds | TWYGVLHQDIRKILDEIGPQPQSVIEPSVGDALHATG* |
| Ga0070712_1008422251 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG* |
| Ga0070765_1002560421 | 3300006176 | Soil | DHLAAFATWYRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG* |
| Ga0070765_1012776822 | 3300006176 | Soil | ATWYRLLHEDIRKILDEVGPQPQLPIMPSFGDALHATG* |
| Ga0070765_1016907022 | 3300006176 | Soil | DHLAAFATWYRLLHEDIRKILDEVGPQPQLPITPSFGDAFHATG* |
| Ga0079219_115212592 | 3300006954 | Agricultural Soil | HLTALATWYGVLHHDIRKILDEVGPQPRPVTAPSVGDAFHATG* |
| Ga0099793_102527161 | 3300007258 | Vadose Zone Soil | AAWYGVLHQDIRKILDEVGPQPRPVIAPSVEDALHASG* |
| Ga0126374_117221051 | 3300009792 | Tropical Forest Soil | NRRPYDQLTALATWYGVLHHDIRKILDEVGPQLHPMTSPSVEDALHATG* |
| Ga0126380_102025642 | 3300010043 | Tropical Forest Soil | WYGLLHQDIRNILDEAGPQPQRPIPSPAGEALHAVR* |
| Ga0126370_115718012 | 3300010358 | Tropical Forest Soil | QLTALATWYGVLHQDSRKILDEVGPQLHPMTSPSVEDALHATG* |
| Ga0126378_128767422 | 3300010361 | Tropical Forest Soil | LATWYRLLHEDIRKILDEVGPQPQPLIAPPVGDALHAAG* |
| Ga0126377_111120351 | 3300010362 | Tropical Forest Soil | LTALATWYGVLHEDIRNILDEVGPQPGPVMAPSVGDALHATG* |
| Ga0126377_130028152 | 3300010362 | Tropical Forest Soil | DHLAALATWYGVLHQDIRKILDEVGPRRQTVIEPSVVDPLHAAG* |
| Ga0126379_112290361 | 3300010366 | Tropical Forest Soil | LSGPGDHLTALATWYGVLHQDIRKILDEVGPRRQTVIEPSVVDPLHAAG* |
| Ga0126381_1001121694 | 3300010376 | Tropical Forest Soil | LATWYGVLHQDIRKILDEVGPQATPLVPQPVRDAWHAAG* |
| Ga0137390_107897281 | 3300012363 | Vadose Zone Soil | WYGVLHQDIRKILDEVGPQPRPVIAPSVGDVFHATG* |
| Ga0182035_115941592 | 3300016341 | Soil | SLAMWYGLLHQDIRKILDEVGPQATPLVPQPVRDAWHAAG |
| Ga0182032_114716101 | 3300016357 | Soil | GPGDHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG |
| Ga0182032_120609792 | 3300016357 | Soil | ILSGPGDQLTALATWYGLLHQDIRRILDEVGPRRDPVIAPSVGRALHAAG |
| Ga0182034_101816652 | 3300016371 | Soil | LSGPGDHLTALATWYGVLHQDIRKILDEVGPQATPLVPQPVRDVWHAAG |
| Ga0182034_107424761 | 3300016371 | Soil | TWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG |
| Ga0182034_117348302 | 3300016371 | Soil | TALTTWYGVLHQDIRKILNEVGPQPQAVLTPWVEDVLHAVG |
| Ga0182040_105753341 | 3300016387 | Soil | TALATWYGLLHQDIRKILDEVGPEATPLIQQPVGDALHAAG |
| Ga0182037_100386641 | 3300016404 | Soil | TWYRVLHEDIREILDKVGPQPQPLIAPSVGDALHATG |
| Ga0182037_104586871 | 3300016404 | Soil | DHLTALATWYGLLHQDIRNVLDEVGPRRPPMIEPSVGDALHAAG |
| Ga0182037_108980121 | 3300016404 | Soil | ALATWYGLLHQDIRNILDKVGPEPQPVKVPSVGDALHATG |
| Ga0182039_102906501 | 3300016422 | Soil | TWYGVLHEDIRKILDEVGPQPRPMTAPVGAALHATG |
| Ga0182038_104147242 | 3300016445 | Soil | LATWYGLLHQDIRKILDEVGPQATPLIPQPVGDALHAAG |
| Ga0187765_102376471 | 3300018060 | Tropical Peatland | GDRLMALATWYGVLHNDIVKILDEVGPQSKAVTAPSIGDALHAAG |
| Ga0187784_107157801 | 3300018062 | Tropical Peatland | PDDPLTALAAWHGLLHQDIRNILDEVGPQPQPTTAPSLGEALRAAG |
| Ga0137408_12509792 | 3300019789 | Vadose Zone Soil | TWYGVLHHDIRKILDEVGPQPRPVIAPSVGDAFHATG |
| Ga0179592_100734952 | 3300020199 | Vadose Zone Soil | GPGDHLTALATWYGVLHQDIRKILDEVGPQPQPVIAPPVGDAFHAAG |
| Ga0210403_102047782 | 3300020580 | Soil | DPGDHLTALATWYGVLHQDIRKILDEVGPQPQPVIAPSVGDAVHAAG |
| Ga0210388_108258902 | 3300021181 | Soil | PPLSGPGDHLAAFATWYRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG |
| Ga0210391_110028852 | 3300021433 | Soil | AFTTWYRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG |
| Ga0213879_101218122 | 3300021439 | Bulk Soil | ATWYRLLHQDIREILGQVGPQPQPMIAPSVRDPLHADG |
| Ga0126371_122295472 | 3300021560 | Tropical Forest Soil | LATWYRLLHEDIRKILDEVGPQPQPLIAPSVGDALHAAG |
| Ga0126371_138604361 | 3300021560 | Tropical Forest Soil | TWYGLLYQDIRRILDQVGPQPQPVTATSVRDALHAAG |
| Ga0207663_103135852 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AAFATWYRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG |
| Ga0179587_103919951 | 3300026557 | Vadose Zone Soil | RTALATWYGVLHQDIRRILDEVGPQPQPVIAPPVGDAFHAAG |
| Ga0209329_10014704 | 3300027605 | Forest Soil | LAAFATWYRLLHEDIRKILDEVGPQPQLPITPSFGDALHATG |
| Ga0308309_105827681 | 3300028906 | Soil | HFTALARWYRLLHEDIRKILDEVGPQPQLPIMPSFGDALHATG |
| Ga0170824_1185751011 | 3300031231 | Forest Soil | PGDHLTALATWYGMLHQDICKILDEVGPQPQPIAPPVGDGFRAIG |
| Ga0318516_107676632 | 3300031543 | Soil | LTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG |
| Ga0318534_101121441 | 3300031544 | Soil | EPPILTGPGDHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG |
| Ga0318541_105983101 | 3300031545 | Soil | SDDHLIAFATWYGVLHEDIRKILDEIGPQPQPAIAQSVTDALRAAG |
| Ga0318538_108235921 | 3300031546 | Soil | TWYGLLHQDIRNVLDEVGPRRPPMIEPSVGDALHAAG |
| Ga0318571_100197431 | 3300031549 | Soil | PGDHLTALATWYGLLHQDIRKILDEVGPRRQPVIEPSVGDALHAAG |
| Ga0318528_104740242 | 3300031561 | Soil | GDHLTALATWYGVLHQDIRKILDEVGPQPRLVAAPSVGEALHAAG |
| Ga0318573_104955421 | 3300031564 | Soil | AALATWYGLLHQDIRNILDKVGPEPQPVKVPSVGDALHAAG |
| Ga0318515_101314631 | 3300031572 | Soil | LATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG |
| Ga0318515_107671502 | 3300031572 | Soil | VLSGPGDHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG |
| Ga0318496_106159611 | 3300031713 | Soil | TWYGVLHEDIRKILDEVGPQPRPAIARPVADALHAAG |
| Ga0318501_102080631 | 3300031736 | Soil | YGLLHQDIRSILDEVGPQPQPVIAPSVGGALHAAG |
| Ga0318502_104297502 | 3300031747 | Soil | GDHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG |
| Ga0318492_106267552 | 3300031748 | Soil | LALATWYGVLHQDIRSILDEVGPQPQPVTAPPVRDALHAAR |
| Ga0307477_102242452 | 3300031753 | Hardwood Forest Soil | AAFATWYRLLHEDIRKILDEVGPRPQLPITPSFGDALHATG |
| Ga0307475_115547081 | 3300031754 | Hardwood Forest Soil | YRLLHEDIRKILDEVGPQPQLPITPSFGDAFHATG |
| Ga0318535_103424181 | 3300031764 | Soil | TGPGDHLTALATWYGLLHQDIRKILDEVGPEATPLIQQPVGDALHAAG |
| Ga0318554_102672212 | 3300031765 | Soil | GPGDHLTALATWYGVLRQDIRNILDEVGPQPRPVIARSVADALHAAG |
| Ga0318509_105979232 | 3300031768 | Soil | LILTGPGDQFTALATWYGVLHRDIRKILDEVGPQATPLVPHPVGDALRAAG |
| Ga0318521_108399092 | 3300031770 | Soil | GPGDHLTALATWYGVLHQDIRKVLDEVGPQRQPVIEPSVGDALHAAG |
| Ga0318546_100537311 | 3300031771 | Soil | LATWHGVLHEDIRKILDQVGPQPQPARAPVGDALHAAG |
| Ga0318566_101935702 | 3300031779 | Soil | YRLLHEDIREILDEVGPQPQPLTAQSVGDALHAAG |
| Ga0318547_100789323 | 3300031781 | Soil | YGVLHQDIRSILDEVGPQPQPVTVPSVGDALHATG |
| Ga0318547_110379241 | 3300031781 | Soil | PTLSGRGDHLTALATWYGVLHQDIRKILDEVGPQQQPVIAPSVGDALHARG |
| Ga0318529_104576822 | 3300031792 | Soil | GDHLTALATWYGVLRQDIRNILDEVGPQPRPVIVRSVADALHAAG |
| Ga0318523_100744981 | 3300031798 | Soil | TALATWYGLLHQDIRKILDEVGPQPQPLMAQPVGDALHAAG |
| Ga0318497_100355431 | 3300031805 | Soil | YGLLHQDIHKILDEVGPEATPLIQQPVGDALHAAG |
| Ga0318567_102324961 | 3300031821 | Soil | ATWYGVLHQDIRRILDEVGPQPQPGIEPSVRDALHAAG |
| Ga0318567_104239662 | 3300031821 | Soil | DHLAALATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG |
| Ga0318564_101820842 | 3300031831 | Soil | GDQLAALATWYRVLHQDIRKILDEVGPQPVNAPSVGDPLHAAG |
| Ga0318517_105073981 | 3300031835 | Soil | HLTALATWYGVLHQDIRKILDEVGPQQQPVIAPSVGDALHARG |
| Ga0318512_100482711 | 3300031846 | Soil | GDHLTALATWYGVLHQDVRNILDEVGPQPRPVTEPPVGDALHAAG |
| Ga0318512_107107292 | 3300031846 | Soil | TWYGVLHQDIRKVLDEVGPQRQPVIEPSVGDALHAAG |
| Ga0318527_101831201 | 3300031859 | Soil | SGPGDHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG |
| Ga0318495_102036122 | 3300031860 | Soil | TTALATWYGVLHQDIRKVLDEVGPQRQPVIEPSVGDALHAAG |
| Ga0318495_102454072 | 3300031860 | Soil | AFATWYGLLHQDIRKILDEVGPEATPLIQQPVGDALHAAG |
| Ga0306919_100764313 | 3300031879 | Soil | TALATWHGVLHEDIRKILDQVGPQPQPARAPVGDALHAGG |
| Ga0306919_102483174 | 3300031879 | Soil | SGVLHQDIRKILDEVGPQRQPVIEPSVGDALHAAG |
| Ga0318544_101391361 | 3300031880 | Soil | MLSGRGDQLTALATWYGVLHEDIRKILDEVGPQPRPMTAPVGAALHATG |
| Ga0318536_105730362 | 3300031893 | Soil | WYRVLHEDIREILDKVGPQPQPLIAPSVGDALHATG |
| Ga0318551_100624734 | 3300031896 | Soil | LAALATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG |
| Ga0318520_102435812 | 3300031897 | Soil | TWYGVLHQDIRKILNEVGPQPQAVLTPLVEDVLHAVG |
| Ga0318520_106708322 | 3300031897 | Soil | GDHQTALVTWYGLLHQDIRKILDDVGPRRQPATAPPVGDALHAAG |
| Ga0306923_115253541 | 3300031910 | Soil | WYRLLHEDIRKILDEVGPQPQSVIAPSVRDALDAAG |
| Ga0306921_101049451 | 3300031912 | Soil | ILTGPGDQFTALATWYGVLHRDIRKILDEVGPQATPLVPHPVGDALRAAG |
| Ga0310912_102754691 | 3300031941 | Soil | DHLTALATWYGLLHQDIRKILDEVGPEATPLIPQPVGDALHAAG |
| Ga0310912_102919421 | 3300031941 | Soil | DQLAALATWYRVLHQDIRKILDEVGPQPVNAPSVGDPLHAAG |
| Ga0310916_101843472 | 3300031942 | Soil | EPPILSGPGDHLTALATWYGLLHQDIRKILNEVGPQSQPVTVPPVGDALHATG |
| Ga0310913_104424422 | 3300031945 | Soil | DHLTALTTWYGVLHQDIRKILNEVGPQPQAVLTPWVEDVLHAVG |
| Ga0310909_108694152 | 3300031947 | Soil | ALATWYGLLHQDIRRILDEVGPRRDPVIAPSVGRALHAAG |
| Ga0310909_112949281 | 3300031947 | Soil | QGDHLTALATWYGLLHQDFRKVLDEIGPQTQPAIAQSVADALHAAG |
| Ga0310909_116046581 | 3300031947 | Soil | LTTWYRLLHEDICEILDQVGPQPQSVTAPSVGDALHAAG |
| Ga0306926_102423471 | 3300031954 | Soil | ATWFDLLHQDIRSILDEVGPQPQPVIAPSVGGALHAAG |
| Ga0318530_104970022 | 3300031959 | Soil | ALATWYGVLHQDIRKILDEVGPQQQPVIAPSVGDALHARG |
| Ga0318530_105098112 | 3300031959 | Soil | TWYGVLHQDIRRILDEVGPQPQPGIEPSVRDALHAAG |
| Ga0318531_101656591 | 3300031981 | Soil | HLTGLATWYGLLHQDIRKILDEVGPQATPLIPQPVGDALHAAG |
| Ga0318531_103890282 | 3300031981 | Soil | CYGVLYQDIRNILDEVGPQPQALIASSFGNALHRTG |
| Ga0318531_105328871 | 3300031981 | Soil | LTALATWYGLLHQDIRKILDEVGPQATPLIPQPVGDALHVIS |
| Ga0306922_105488142 | 3300032001 | Soil | LAAWHGVLHQDIRNILDEVGPQPHRATAPSVEDALHAAG |
| Ga0306922_109761262 | 3300032001 | Soil | YGLLHQDIRRILDEIGPQPQPAATPSLGDAFHALG |
| Ga0318569_102435651 | 3300032010 | Soil | GDHLTALATWYGLLHQDIRSILDEVGPQPQPVIAPSVGGALHAAG |
| Ga0318556_100733531 | 3300032043 | Soil | GDHLAALATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG |
| Ga0318506_100015061 | 3300032052 | Soil | DHLTALATWYGVLHQDIRKILDEVGPQATPLVPQPVRDVWHAAG |
| Ga0318575_102177991 | 3300032055 | Soil | AEPPTLSGAGDHLAALATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG |
| Ga0318533_103731371 | 3300032059 | Soil | GDHLTGLATWYGLLHQDIRKILDEVGPQATPLIPQPVGDALHAAG |
| Ga0318533_110776992 | 3300032059 | Soil | WYRLLHEDIRNILDEVGPQPQPAIARSVGDALHAAG |
| Ga0318533_113430941 | 3300032059 | Soil | GPGDHLAALATWYGVLHRDIRNILDEVGPQPHRATAPPVEDALHATG |
| Ga0318510_103853012 | 3300032064 | Soil | ALATWYGLLHQDIRKILDEVGPEATPLIQQPVGDALHAAG |
| Ga0318514_102583663 | 3300032066 | Soil | SGVLHQDIRKILDEGGPQRQPVIEPSVGDALHAAG |
| Ga0318514_106562302 | 3300032066 | Soil | SGPGDHLTALATWYGLLHQDIRNILNEVGPQPHLVTAPSVREALHAAG |
| Ga0318553_102288892 | 3300032068 | Soil | GDHLTALATWYGVLHQDICKILEEVGPQPRPVTAPSVGDALHAAG |
| Ga0318518_102246561 | 3300032090 | Soil | GPAEPPTLSGAGDHLAALATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG |
| Ga0307472_1000988301 | 3300032205 | Hardwood Forest Soil | PGDYLTALATWYGLLHEDIRKIIDVVDPQSQPVTSPSVRNSLHAAG |
| Ga0318519_102083862 | 3300033290 | Soil | ATWYHLLHGDIRKILDEVGPQSPPVTSPSVRNALHAAG |
| ⦗Top⦘ |