| Basic Information | |
|---|---|
| Family ID | F075276 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GSEDISMEDVLGKGVRKQPAAAKETVDEDVPQVETQTY |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.126 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.370 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.899 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.24% β-sheet: 0.00% Coil/Unstructured: 75.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00889 | EF_TS | 57.98 |
| PF00696 | AA_kinase | 8.40 |
| PF00627 | UBA | 3.36 |
| PF00072 | Response_reg | 0.84 |
| PF14321 | DUF4382 | 0.84 |
| PF05193 | Peptidase_M16_C | 0.84 |
| PF07244 | POTRA | 0.84 |
| PF00884 | Sulfatase | 0.84 |
| PF04879 | Molybdop_Fe4S4 | 0.84 |
| PF00227 | Proteasome | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0264 | Translation elongation factor EF-Ts | Translation, ribosomal structure and biogenesis [J] | 57.98 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.04% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.04% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.36% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.68% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.68% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.84% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.84% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003367 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004608 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026109 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1013978871 | 3300000955 | Soil | AEAAGDDISMEDVLGGGTKKAPASAPESADEVPQVESQTF* |
| JGI12269J14319_101346311 | 3300001356 | Peatlands Soil | GATDLAAVEEPGTEDISMEDVLGSGTRKQSAAAKENASEDVPQVETQTY* |
| JGI12269J14319_103284501 | 3300001356 | Peatlands Soil | ISMEDVLGAGTRKQPAAAKDTVAEDVPQVETQTY* |
| JGI12630J15595_100871181 | 3300001545 | Forest Soil | EGAGEAGSEDISMEDVLGKGTRKQPAPAKETVDEDVPQVETQTY* |
| JGIcombinedJ26739_1013789731 | 3300002245 | Forest Soil | AGAPEAGSEDISMEDVLGKGVRKQPAPANEAVDEDVPQVETQTY* |
| JGI26338J50219_10179741 | 3300003367 | Bog Forest Soil | NASEDGTGEDISMEDVLGAGTRKQPVAAKDSADEVVPQVETQTY* |
| Ga0055468_101239531 | 3300003993 | Natural And Restored Wetlands | GSDYGDEGEDVSMEEVLGAGVRKSPVAAKDEEPQVESQSR* |
| Ga0068924_12774121 | 3300004608 | Peatlands Soil | EEPGTEDISMEDVLGSGTRKQSAAAKENASEDVPQVETQTY* |
| Ga0066395_105326842 | 3300004633 | Tropical Forest Soil | EASGEDISMEDVLGGGTKKSPAAAQDVADEVPQVESQTF* |
| Ga0066688_100107835 | 3300005178 | Soil | HAGADDSASEDISMEEVLGAGTRKQPAAAKEEEAGEVPEVETQTY* |
| Ga0070660_1001567023 | 3300005339 | Corn Rhizosphere | SGSEDISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY* |
| Ga0070688_1003000041 | 3300005365 | Switchgrass Rhizosphere | ESGSEDISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY* |
| Ga0070709_107519402 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PEAAEGAAAGEGGGEDISMEDVLGAGTTRKQPAAAAKTEEVPQVESQTTY* |
| Ga0070741_101371274 | 3300005529 | Surface Soil | GEDISMEDVLGGPARKQPAAAKAQADADEVPQIETQTY* |
| Ga0070735_100899264 | 3300005534 | Surface Soil | GAGEDISMEDVLGGPARKQPAAAAKTQADTDEVPQIETQTY* |
| Ga0070697_1002489353 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VDSAATEDISMEDVLGAGVRKPAAAAATEETAEVPQVETF* |
| Ga0066704_106770312 | 3300005557 | Soil | AGGDSSTEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY* |
| Ga0068855_1021192441 | 3300005563 | Corn Rhizosphere | AEELAAAGAPEAGAEDISMEDVLGAGVRKQPAAAKEAVEDEVPQVETQTF* |
| Ga0070762_100090215 | 3300005602 | Soil | AAEDISMEDVLGAGTRKQPVAAKEAADETVPQVETQTY* |
| Ga0066788_101192012 | 3300005944 | Soil | EDISMEDVLGKGVRKQPAPAKEAVEEDVPQVETQTY* |
| Ga0066787_100678241 | 3300005950 | Soil | EGSTEDISMEDVLGGGVKPVAAAKEAVEEVPATVETTS* |
| Ga0066696_102601461 | 3300006032 | Soil | ISMEEVLGKGTRKQPAARKEEVQEEASPVETQTF* |
| Ga0075023_1006199771 | 3300006041 | Watersheds | AIDAGAEDISMEDVLGSGTKKAPAAAKEVADEVPQVESQTF* |
| Ga0075029_1003877781 | 3300006052 | Watersheds | TPESASEDISMEDVLGKGVRKQPAPTKETVDEDVPQVETQTY* |
| Ga0075017_1001225091 | 3300006059 | Watersheds | AGTPESASEDISMEDVLGKGVRKQPAPTKETVDEDVPQVETQTY* |
| Ga0075015_1002886921 | 3300006102 | Watersheds | EDISMEDVLGAGTRKQPAAAKEDSAEVPQVETQTF* |
| Ga0075015_1008738231 | 3300006102 | Watersheds | IDAGAEDISMEDVLGSGTKKAPAAAKEVADEVPQVESQTF* |
| Ga0075018_105535622 | 3300006172 | Watersheds | DLNAAEDASSEEISMEDVLGAGARKQPAAAKESAGENVPQVETQTY* |
| Ga0070716_1002836723 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SPEAGAEDISMEDVLGKGVRKQPAPAKETVDEDVPQVETQTY* |
| Ga0068871_1002317821 | 3300006358 | Miscanthus Rhizosphere | SEDISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY* |
| Ga0068871_1002671844 | 3300006358 | Miscanthus Rhizosphere | DISMEDVLGGGTKKQPAPAKAAAEEAPEVETQTY* |
| Ga0066658_100038551 | 3300006794 | Soil | SMEDVLGGGTRKQHSAAKQRADDEVPQVETQTYP* |
| Ga0079220_120249052 | 3300006806 | Agricultural Soil | AEQEDISMEEVLGKGTRKQPVTAKEEAAEEASPVETQTF* |
| Ga0075425_1017992692 | 3300006854 | Populus Rhizosphere | DSSAEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY* |
| Ga0075426_102610181 | 3300006903 | Populus Rhizosphere | DISMEDVLGGSARKRPEAAKEQAAEEVPQVESQHTF* |
| Ga0099795_104917711 | 3300007788 | Vadose Zone Soil | EDISMEDVLGKGVRKQPAPANETVDEDVPQVETQTY* |
| Ga0116135_11303462 | 3300009665 | Peatland | EDISMEDVLGAGTRKQPAAAKESVADDVPQVETQTY* |
| Ga0116135_12883241 | 3300009665 | Peatland | DAGAEDISMEDVLGAGTRKQPVAAKETVADDVPQVETQTY* |
| Ga0116223_102648321 | 3300009839 | Peatlands Soil | EDISMEDVLGSGTRKQSAAAKENASEDVPQVETQTY* |
| Ga0126380_119351171 | 3300010043 | Tropical Forest Soil | TAEAGAEDISMEDVLGGGTKKAPATAKEEADEVPQVESQTF* |
| Ga0126382_106859522 | 3300010047 | Tropical Forest Soil | AEAGFDAGSDDISMEDVLGSGTKKAPAADKETADEVPQVESQTF* |
| Ga0134063_105870201 | 3300010335 | Grasslands Soil | QEDISMEEVLGKGTRKQPVAAKEEAAEEASPVETQTF* |
| Ga0134126_101154701 | 3300010396 | Terrestrial Soil | TGEDISMEDVLGGSTRKRPEAAKEAAAEEVPQVESQHTY* |
| Ga0138573_12028651 | 3300011089 | Peatlands Soil | EDISMEEVLGAGTRKQPVAAKESVDETIPQVETQTY* |
| Ga0137392_107179811 | 3300011269 | Vadose Zone Soil | ISMEDVLGGRTRKQPDAAKERVREDVPEVETQTY* |
| Ga0137389_103349681 | 3300012096 | Vadose Zone Soil | EDISMEEVLGAGTRKQAETAKEEASEVPEVETQTY* |
| Ga0137389_103865821 | 3300012096 | Vadose Zone Soil | VAEAEQEDISMEEVLGKGTRKQPVTAKEEAAEEASPVETQTF* |
| Ga0137399_109155712 | 3300012203 | Vadose Zone Soil | TGEDISMEDVLGGPTRKQPATAAKAEAAPQVETQTTYS* |
| Ga0137362_116000321 | 3300012205 | Vadose Zone Soil | GEDISMEDVLGGGTKKAPAAAQDVADEVPQVESQTF* |
| Ga0137381_106492501 | 3300012207 | Vadose Zone Soil | GAEDISMEDVLGGGTKKAPSTAQDAADEVPQVESQTF* |
| Ga0137376_101261351 | 3300012208 | Vadose Zone Soil | GEDISMEEVLGAGVRKQPAAAKEAVDEEDVPQVETQTY* |
| Ga0137376_109864391 | 3300012208 | Vadose Zone Soil | ISMEEVLGKGTRKQPVTAKEEAAEEASPVETQTF* |
| Ga0137387_106615632 | 3300012349 | Vadose Zone Soil | EQEDISMEEVLGKGTRKQPVTAKEEAAEEASPVETQTF* |
| Ga0137361_103345941 | 3300012362 | Vadose Zone Soil | GSEDISMEDVLGKGVRKQPAPANEAVDEDVPQVETQTY* |
| Ga0137398_108735842 | 3300012683 | Vadose Zone Soil | SEDISMEDVLGKGVRKQPAPANETVDEDAPQVETQTY* |
| Ga0137396_112378782 | 3300012918 | Vadose Zone Soil | ELQAAGAPEAGSEDISMEDVLGKGVRKQPAPANETVDEDVPQVETQTY* |
| Ga0137419_107571792 | 3300012925 | Vadose Zone Soil | GEAGLDAGAEDISMEDVLGSGTKKAPAAEKAAADEVPQVESQTF* |
| Ga0137416_117570222 | 3300012927 | Vadose Zone Soil | GADDSASEDISMEEVLGAGTRKQPAAAKEEEAGEVPEVETQTY* |
| Ga0137407_112703091 | 3300012930 | Vadose Zone Soil | TGEDISMEEVLGAGVRKQPAAAKEAVDEDVPQVETQTY* |
| Ga0153915_110600531 | 3300012931 | Freshwater Wetlands | GPGTENVSMEEVLGGGRKGPAGAKEESDVPQVETQTF* |
| Ga0164300_102856891 | 3300012951 | Soil | EAGAEDISMEDVLGGGTKKAPATAQDAAEEVPRVESQTL* |
| Ga0164303_100824901 | 3300012957 | Soil | EDISMEDVLGGGTKKAPATAQDAAEEVPQVESQTL* |
| Ga0164303_115385672 | 3300012957 | Soil | SPEAGAEDISMEDVLGKGVRKQPAPSKETVDEDVPQVETQTY* |
| Ga0153916_125922811 | 3300012964 | Freshwater Wetlands | AEAGGEDLTMEDVLGAGTRKQPAAAKAAKQEESEVPQTQTF* |
| Ga0164304_117489611 | 3300012986 | Soil | EELAAAGAPESGSEDISMEDVLGKGVRKQPAAASETADEDVPQVETQTY* |
| Ga0164305_100358265 | 3300012989 | Soil | AEAGAEDISMEDVLGGGTKKAPATAQDAAEEVPQVESQTL* |
| Ga0157373_100494224 | 3300013100 | Corn Rhizosphere | AAAGAPESGSEDISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY* |
| Ga0182024_115409581 | 3300014501 | Permafrost | SAPAEGAVEAGAEDISMEDVLGTGGRKQPAVVEEDEGEVPHQLETRTF* |
| Ga0132258_103723766 | 3300015371 | Arabidopsis Rhizosphere | SEAAPDTAAEAGGEDISMEEVLGAGVRKQPAASKEAVDEDVPQVETQTY* |
| Ga0132257_1000244451 | 3300015373 | Arabidopsis Rhizosphere | ISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY* |
| Ga0187802_102252692 | 3300017822 | Freshwater Sediment | AEEAAAARAADGASQFADVEEAGAEDISMEDVLDGGARKQPAAAKDDASADVPQVETQTY |
| Ga0187802_102957031 | 3300017822 | Freshwater Sediment | AEDAGTEDISMEDVLGAGTRKQPAAAKDTVAEDVPQVETQTY |
| Ga0187825_100734583 | 3300017930 | Freshwater Sediment | GEDISMEDVLGGGTKKAAAAAQDAADEVPQVESQTF |
| Ga0187819_107833371 | 3300017943 | Freshwater Sediment | AEDISMEDVLGGDARKQPAAAPEPEADIPQVETRSF |
| Ga0187785_106330581 | 3300017947 | Tropical Peatland | DISMEEVLGAGVRKQPAPAKEVVDEDVPQVETQTY |
| Ga0187872_100456561 | 3300018017 | Peatland | EAGTEDISMEEVLGAGTRKQPVAAKESVDEAVPQVETQTY |
| Ga0187855_101627991 | 3300018038 | Peatland | ASEDGTGEDISMEDVLGAGTRKQPAAAKESVADDVPQVETQTY |
| Ga0187765_103313031 | 3300018060 | Tropical Peatland | ATLHAASEEESAAAAVVPAGEDAEDISMEDVLGAGTRKQPAAAKQETEVPQVETQTF |
| Ga0187770_100168235 | 3300018090 | Tropical Peatland | VGMTASADDSAAEEISMEEVLGAGMPKQPATHNEAGEAAPEVEHQTH |
| Ga0193715_10900141 | 3300019878 | Soil | EAGAEDISMEEVLGSGVRKQPAAAKEVVDEDVPQVETQTY |
| Ga0210407_109294662 | 3300020579 | Soil | SESSEEAIGEDISMEDVLGAGTKKAPAAAKEVAEEVPQVESQTF |
| Ga0179596_103285351 | 3300021086 | Vadose Zone Soil | LQAAGAPEAGSEDISMEDVLGKGVRKQPAPANEAVDEDVPQVETQTY |
| Ga0210397_107330642 | 3300021403 | Soil | DDGTGEDISMEDVLGAGTRKQPSAAKESVAEDVPQVETQTY |
| Ga0210394_103964252 | 3300021420 | Soil | DISMEDVLGAGTRKQPSAAKESVSEDIPQVETQTY |
| Ga0126371_127177452 | 3300021560 | Tropical Forest Soil | GEMPGDDISMEDVLGGGTKKAPAAAKEEADEVPQVESQTF |
| Ga0207656_101290031 | 3300025321 | Corn Rhizosphere | PESGSEDISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY |
| Ga0208480_11365582 | 3300025633 | Arctic Peat Soil | TGTETEDISMEEVLGAGTRKQPIAAKESAVEAPEVEHQTF |
| Ga0207692_104308112 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EHAAEASGEDISMEDVLGGGTKKAPAAAQDVADEVPQVESQTF |
| Ga0207645_110213432 | 3300025907 | Miscanthus Rhizosphere | AGAEDISMEDVLGKGVRKQPAPAKETVDEDVPQVETQTY |
| Ga0207695_105443822 | 3300025913 | Corn Rhizosphere | EDISMEDVLGGGVRKQPAAAKDEEPADAPQVETQAF |
| Ga0207700_110540321 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EGAETTGEDISMEDVLGGSTRKRPEAAKEAAAEEVPQVESQHTY |
| Ga0207665_112764092 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | IAEGDSATEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY |
| Ga0207668_114903472 | 3300025972 | Switchgrass Rhizosphere | AAAGAPESGSEDISMEDVLGKGVRKQPAAASETADEDVPQVETQTY |
| Ga0207676_101875231 | 3300026095 | Switchgrass Rhizosphere | TGEEISKEDVLGGGTKKQPAPAKAAAEEAPEVETQTY |
| Ga0208774_10497531 | 3300026109 | Rice Paddy Soil | ILAAEAGAGEDISMEDVLGGGANRKQPAAAKAAADSDEVPQIETQTY |
| Ga0209687_12490412 | 3300026322 | Soil | SASEDTGEDISMEDVLGGGTKKQPAPAKAAAEEAPEVETQTY |
| Ga0209152_102212912 | 3300026325 | Soil | SSAEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY |
| Ga0209802_10890773 | 3300026328 | Soil | AESGAEEAGAEDISMEEVLGAGTRKQAETAKEEAGEVPEVETQTY |
| Ga0209057_11494311 | 3300026342 | Soil | QEDISMEEVLGKGTRKQPVAAKEEAAEEASPVETQTF |
| Ga0257164_10565742 | 3300026497 | Soil | EDISMEDVLGKGVRKQAAPAIENVDEDVPQVETQTY |
| Ga0209808_11487862 | 3300026523 | Soil | LTASDSSTEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY |
| Ga0209160_10990051 | 3300026532 | Soil | AEEAGAEDISMEEVLGAGTRKQAETAKEEAGEVPEVETQTY |
| Ga0209161_104789812 | 3300026548 | Soil | GDSSAEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY |
| Ga0209474_105532392 | 3300026550 | Soil | GTEDISMEDVLGGGTKKQPSAAKEGAEELPQVETQTYS |
| Ga0209734_10421572 | 3300027535 | Forest Soil | SDAGSEDISMEDVLGKGVRKQPAAAKETVDEDVPQVETQTY |
| Ga0208043_11672171 | 3300027570 | Peatlands Soil | ASEDAGAEDISMEDVLGAGTRKQPVAAKESVADDVPQVETQTY |
| Ga0209220_10933321 | 3300027587 | Forest Soil | GSEDISMEDVLGKGTRKQPAPAKETVDEDVPQVETQTY |
| Ga0209733_10864021 | 3300027591 | Forest Soil | ISAADDSGGEDISMEDVLGAGTRKQPAATKDTVAEDIPQVETQTY |
| Ga0208324_10487641 | 3300027604 | Peatlands Soil | RGMDINAVEDAGTEDISMEDVLGAGTRKQPAAAKDAVAEEVPQVETQTY |
| Ga0209810_13636442 | 3300027773 | Surface Soil | IMAAEAGAGEDISMEDVLGGPTRKQPAPAKTQADTDEVPQIETQTY |
| Ga0209060_105407072 | 3300027826 | Surface Soil | EIMAAEAGAGEDISMEDVLGGPARKQPAAAKAQADTDEVPQIETQTY |
| Ga0209693_105295471 | 3300027855 | Soil | GGEDISMEDVLGGGTKKAPSAAQDVADEVPQVESQTF |
| Ga0209275_105895661 | 3300027884 | Soil | ESGIDIDASEDGAAEDISMEDVLGAGTRKQPVAAKEAADETVPQVETQTY |
| Ga0209068_105095822 | 3300027894 | Watersheds | EAGAEDISMEDVLGKGVRKQPAPANETVDEDVPQVETQTY |
| Ga0209068_108946212 | 3300027894 | Watersheds | GGVDIRAAEDAGAEDISMEDVLGAGTRKQPAAAKDSTAEDVPQVETQTY |
| Ga0209526_104251692 | 3300028047 | Forest Soil | QAAGAPEAGSEDISMEDVLGKGVRKQPAPANETVDEDVPQVETQTY |
| Ga0137415_112259692 | 3300028536 | Vadose Zone Soil | GADDSASEDISMEEVLGAGTRKQPAAAKEEEAGEVPEVETQTY |
| Ga0170823_105665892 | 3300031128 | Forest Soil | GSEDISMEDVLGKGVRKQPAAAKETVDEDVPQVETQTY |
| Ga0307468_1001295083 | 3300031740 | Hardwood Forest Soil | PAAEAAGDDISMEDVLGGGTKKAPASAPESADEVPQVESQTF |
| ⦗Top⦘ |