NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075276

Metagenome / Metatranscriptome Family F075276

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075276
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 41 residues
Representative Sequence GSEDISMEDVLGKGVRKQPAAAKETVDEDVPQVETQTY
Number of Associated Samples 110
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 0.00 %
% of genes from short scaffolds (< 2000 bps) 0.00 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (100.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.126 % of family members)
Environment Ontology (ENVO) Unclassified
(24.370 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.899 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.24%    β-sheet: 0.00%    Coil/Unstructured: 75.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00889EF_TS 57.98
PF00696AA_kinase 8.40
PF00627UBA 3.36
PF00072Response_reg 0.84
PF14321DUF4382 0.84
PF05193Peptidase_M16_C 0.84
PF07244POTRA 0.84
PF00884Sulfatase 0.84
PF04879Molybdop_Fe4S4 0.84
PF00227Proteasome 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0264Translation elongation factor EF-TsTranslation, ribosomal structure and biogenesis [J] 57.98
COG063820S proteasome, alpha and beta subunitsPosttranslational modification, protein turnover, chaperones [O] 0.84
COG3484Predicted proteasome-type proteasePosttranslational modification, protein turnover, chaperones [O] 0.84
COG5405ATP-dependent protease HslVU (ClpYQ), peptidase subunitPosttranslational modification, protein turnover, chaperones [O] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

NameRankTaxonomyDistribution
UnclassifiedrootN/A100.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds6.72%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.04%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.04%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.04%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.36%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.52%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.68%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.68%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.68%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.68%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.84%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.84%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.84%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.84%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003367Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3EnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004608Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 9 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011089Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025633Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026109Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10139788713300000955SoilAEAAGDDISMEDVLGGGTKKAPASAPESADEVPQVESQTF*
JGI12269J14319_1013463113300001356Peatlands SoilGATDLAAVEEPGTEDISMEDVLGSGTRKQSAAAKENASEDVPQVETQTY*
JGI12269J14319_1032845013300001356Peatlands SoilISMEDVLGAGTRKQPAAAKDTVAEDVPQVETQTY*
JGI12630J15595_1008711813300001545Forest SoilEGAGEAGSEDISMEDVLGKGTRKQPAPAKETVDEDVPQVETQTY*
JGIcombinedJ26739_10137897313300002245Forest SoilAGAPEAGSEDISMEDVLGKGVRKQPAPANEAVDEDVPQVETQTY*
JGI26338J50219_101797413300003367Bog Forest SoilNASEDGTGEDISMEDVLGAGTRKQPVAAKDSADEVVPQVETQTY*
Ga0055468_1012395313300003993Natural And Restored WetlandsGSDYGDEGEDVSMEEVLGAGVRKSPVAAKDEEPQVESQSR*
Ga0068924_127741213300004608Peatlands SoilEEPGTEDISMEDVLGSGTRKQSAAAKENASEDVPQVETQTY*
Ga0066395_1053268423300004633Tropical Forest SoilEASGEDISMEDVLGGGTKKSPAAAQDVADEVPQVESQTF*
Ga0066688_1001078353300005178SoilHAGADDSASEDISMEEVLGAGTRKQPAAAKEEEAGEVPEVETQTY*
Ga0070660_10015670233300005339Corn RhizosphereSGSEDISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY*
Ga0070688_10030000413300005365Switchgrass RhizosphereESGSEDISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY*
Ga0070709_1075194023300005434Corn, Switchgrass And Miscanthus RhizospherePEAAEGAAAGEGGGEDISMEDVLGAGTTRKQPAAAAKTEEVPQVESQTTY*
Ga0070741_1013712743300005529Surface SoilGEDISMEDVLGGPARKQPAAAKAQADADEVPQIETQTY*
Ga0070735_1008992643300005534Surface SoilGAGEDISMEDVLGGPARKQPAAAAKTQADTDEVPQIETQTY*
Ga0070697_10024893533300005536Corn, Switchgrass And Miscanthus RhizosphereVDSAATEDISMEDVLGAGVRKPAAAAATEETAEVPQVETF*
Ga0066704_1067703123300005557SoilAGGDSSTEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY*
Ga0068855_10211924413300005563Corn RhizosphereAEELAAAGAPEAGAEDISMEDVLGAGVRKQPAAAKEAVEDEVPQVETQTF*
Ga0070762_1000902153300005602SoilAAEDISMEDVLGAGTRKQPVAAKEAADETVPQVETQTY*
Ga0066788_1011920123300005944SoilEDISMEDVLGKGVRKQPAPAKEAVEEDVPQVETQTY*
Ga0066787_1006782413300005950SoilEGSTEDISMEDVLGGGVKPVAAAKEAVEEVPATVETTS*
Ga0066696_1026014613300006032SoilISMEEVLGKGTRKQPAARKEEVQEEASPVETQTF*
Ga0075023_10061997713300006041WatershedsAIDAGAEDISMEDVLGSGTKKAPAAAKEVADEVPQVESQTF*
Ga0075029_10038777813300006052WatershedsTPESASEDISMEDVLGKGVRKQPAPTKETVDEDVPQVETQTY*
Ga0075017_10012250913300006059WatershedsAGTPESASEDISMEDVLGKGVRKQPAPTKETVDEDVPQVETQTY*
Ga0075015_10028869213300006102WatershedsEDISMEDVLGAGTRKQPAAAKEDSAEVPQVETQTF*
Ga0075015_10087382313300006102WatershedsIDAGAEDISMEDVLGSGTKKAPAAAKEVADEVPQVESQTF*
Ga0075018_1055356223300006172WatershedsDLNAAEDASSEEISMEDVLGAGARKQPAAAKESAGENVPQVETQTY*
Ga0070716_10028367233300006173Corn, Switchgrass And Miscanthus RhizosphereSPEAGAEDISMEDVLGKGVRKQPAPAKETVDEDVPQVETQTY*
Ga0068871_10023178213300006358Miscanthus RhizosphereSEDISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY*
Ga0068871_10026718443300006358Miscanthus RhizosphereDISMEDVLGGGTKKQPAPAKAAAEEAPEVETQTY*
Ga0066658_1000385513300006794SoilSMEDVLGGGTRKQHSAAKQRADDEVPQVETQTYP*
Ga0079220_1202490523300006806Agricultural SoilAEQEDISMEEVLGKGTRKQPVTAKEEAAEEASPVETQTF*
Ga0075425_10179926923300006854Populus RhizosphereDSSAEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY*
Ga0075426_1026101813300006903Populus RhizosphereDISMEDVLGGSARKRPEAAKEQAAEEVPQVESQHTF*
Ga0099795_1049177113300007788Vadose Zone SoilEDISMEDVLGKGVRKQPAPANETVDEDVPQVETQTY*
Ga0116135_113034623300009665PeatlandEDISMEDVLGAGTRKQPAAAKESVADDVPQVETQTY*
Ga0116135_128832413300009665PeatlandDAGAEDISMEDVLGAGTRKQPVAAKETVADDVPQVETQTY*
Ga0116223_1026483213300009839Peatlands SoilEDISMEDVLGSGTRKQSAAAKENASEDVPQVETQTY*
Ga0126380_1193511713300010043Tropical Forest SoilTAEAGAEDISMEDVLGGGTKKAPATAKEEADEVPQVESQTF*
Ga0126382_1068595223300010047Tropical Forest SoilAEAGFDAGSDDISMEDVLGSGTKKAPAADKETADEVPQVESQTF*
Ga0134063_1058702013300010335Grasslands SoilQEDISMEEVLGKGTRKQPVAAKEEAAEEASPVETQTF*
Ga0134126_1011547013300010396Terrestrial SoilTGEDISMEDVLGGSTRKRPEAAKEAAAEEVPQVESQHTY*
Ga0138573_120286513300011089Peatlands SoilEDISMEEVLGAGTRKQPVAAKESVDETIPQVETQTY*
Ga0137392_1071798113300011269Vadose Zone SoilISMEDVLGGRTRKQPDAAKERVREDVPEVETQTY*
Ga0137389_1033496813300012096Vadose Zone SoilEDISMEEVLGAGTRKQAETAKEEASEVPEVETQTY*
Ga0137389_1038658213300012096Vadose Zone SoilVAEAEQEDISMEEVLGKGTRKQPVTAKEEAAEEASPVETQTF*
Ga0137399_1091557123300012203Vadose Zone SoilTGEDISMEDVLGGPTRKQPATAAKAEAAPQVETQTTYS*
Ga0137362_1160003213300012205Vadose Zone SoilGEDISMEDVLGGGTKKAPAAAQDVADEVPQVESQTF*
Ga0137381_1064925013300012207Vadose Zone SoilGAEDISMEDVLGGGTKKAPSTAQDAADEVPQVESQTF*
Ga0137376_1012613513300012208Vadose Zone SoilGEDISMEEVLGAGVRKQPAAAKEAVDEEDVPQVETQTY*
Ga0137376_1098643913300012208Vadose Zone SoilISMEEVLGKGTRKQPVTAKEEAAEEASPVETQTF*
Ga0137387_1066156323300012349Vadose Zone SoilEQEDISMEEVLGKGTRKQPVTAKEEAAEEASPVETQTF*
Ga0137361_1033459413300012362Vadose Zone SoilGSEDISMEDVLGKGVRKQPAPANEAVDEDVPQVETQTY*
Ga0137398_1087358423300012683Vadose Zone SoilSEDISMEDVLGKGVRKQPAPANETVDEDAPQVETQTY*
Ga0137396_1123787823300012918Vadose Zone SoilELQAAGAPEAGSEDISMEDVLGKGVRKQPAPANETVDEDVPQVETQTY*
Ga0137419_1075717923300012925Vadose Zone SoilGEAGLDAGAEDISMEDVLGSGTKKAPAAEKAAADEVPQVESQTF*
Ga0137416_1175702223300012927Vadose Zone SoilGADDSASEDISMEEVLGAGTRKQPAAAKEEEAGEVPEVETQTY*
Ga0137407_1127030913300012930Vadose Zone SoilTGEDISMEEVLGAGVRKQPAAAKEAVDEDVPQVETQTY*
Ga0153915_1106005313300012931Freshwater WetlandsGPGTENVSMEEVLGGGRKGPAGAKEESDVPQVETQTF*
Ga0164300_1028568913300012951SoilEAGAEDISMEDVLGGGTKKAPATAQDAAEEVPRVESQTL*
Ga0164303_1008249013300012957SoilEDISMEDVLGGGTKKAPATAQDAAEEVPQVESQTL*
Ga0164303_1153856723300012957SoilSPEAGAEDISMEDVLGKGVRKQPAPSKETVDEDVPQVETQTY*
Ga0153916_1259228113300012964Freshwater WetlandsAEAGGEDLTMEDVLGAGTRKQPAAAKAAKQEESEVPQTQTF*
Ga0164304_1174896113300012986SoilEELAAAGAPESGSEDISMEDVLGKGVRKQPAAASETADEDVPQVETQTY*
Ga0164305_1003582653300012989SoilAEAGAEDISMEDVLGGGTKKAPATAQDAAEEVPQVESQTL*
Ga0157373_1004942243300013100Corn RhizosphereAAAGAPESGSEDISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY*
Ga0182024_1154095813300014501PermafrostSAPAEGAVEAGAEDISMEDVLGTGGRKQPAVVEEDEGEVPHQLETRTF*
Ga0132258_1037237663300015371Arabidopsis RhizosphereSEAAPDTAAEAGGEDISMEEVLGAGVRKQPAASKEAVDEDVPQVETQTY*
Ga0132257_10002444513300015373Arabidopsis RhizosphereISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY*
Ga0187802_1022526923300017822Freshwater SedimentAEEAAAARAADGASQFADVEEAGAEDISMEDVLDGGARKQPAAAKDDASADVPQVETQTY
Ga0187802_1029570313300017822Freshwater SedimentAEDAGTEDISMEDVLGAGTRKQPAAAKDTVAEDVPQVETQTY
Ga0187825_1007345833300017930Freshwater SedimentGEDISMEDVLGGGTKKAAAAAQDAADEVPQVESQTF
Ga0187819_1078333713300017943Freshwater SedimentAEDISMEDVLGGDARKQPAAAPEPEADIPQVETRSF
Ga0187785_1063305813300017947Tropical PeatlandDISMEEVLGAGVRKQPAPAKEVVDEDVPQVETQTY
Ga0187872_1004565613300018017PeatlandEAGTEDISMEEVLGAGTRKQPVAAKESVDEAVPQVETQTY
Ga0187855_1016279913300018038PeatlandASEDGTGEDISMEDVLGAGTRKQPAAAKESVADDVPQVETQTY
Ga0187765_1033130313300018060Tropical PeatlandATLHAASEEESAAAAVVPAGEDAEDISMEDVLGAGTRKQPAAAKQETEVPQVETQTF
Ga0187770_1001682353300018090Tropical PeatlandVGMTASADDSAAEEISMEEVLGAGMPKQPATHNEAGEAAPEVEHQTH
Ga0193715_109001413300019878SoilEAGAEDISMEEVLGSGVRKQPAAAKEVVDEDVPQVETQTY
Ga0210407_1092946623300020579SoilSESSEEAIGEDISMEDVLGAGTKKAPAAAKEVAEEVPQVESQTF
Ga0179596_1032853513300021086Vadose Zone SoilLQAAGAPEAGSEDISMEDVLGKGVRKQPAPANEAVDEDVPQVETQTY
Ga0210397_1073306423300021403SoilDDGTGEDISMEDVLGAGTRKQPSAAKESVAEDVPQVETQTY
Ga0210394_1039642523300021420SoilDISMEDVLGAGTRKQPSAAKESVSEDIPQVETQTY
Ga0126371_1271774523300021560Tropical Forest SoilGEMPGDDISMEDVLGGGTKKAPAAAKEEADEVPQVESQTF
Ga0207656_1012900313300025321Corn RhizospherePESGSEDISMEDVLGKGVRKQPAAAGETADEDVPQVETQTY
Ga0208480_113655823300025633Arctic Peat SoilTGTETEDISMEEVLGAGTRKQPIAAKESAVEAPEVEHQTF
Ga0207692_1043081123300025898Corn, Switchgrass And Miscanthus RhizosphereEHAAEASGEDISMEDVLGGGTKKAPAAAQDVADEVPQVESQTF
Ga0207645_1102134323300025907Miscanthus RhizosphereAGAEDISMEDVLGKGVRKQPAPAKETVDEDVPQVETQTY
Ga0207695_1054438223300025913Corn RhizosphereEDISMEDVLGGGVRKQPAAAKDEEPADAPQVETQAF
Ga0207700_1105403213300025928Corn, Switchgrass And Miscanthus RhizosphereEGAETTGEDISMEDVLGGSTRKRPEAAKEAAAEEVPQVESQHTY
Ga0207665_1127640923300025939Corn, Switchgrass And Miscanthus RhizosphereIAEGDSATEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY
Ga0207668_1149034723300025972Switchgrass RhizosphereAAAGAPESGSEDISMEDVLGKGVRKQPAAASETADEDVPQVETQTY
Ga0207676_1018752313300026095Switchgrass RhizosphereTGEEISKEDVLGGGTKKQPAPAKAAAEEAPEVETQTY
Ga0208774_104975313300026109Rice Paddy SoilILAAEAGAGEDISMEDVLGGGANRKQPAAAKAAADSDEVPQIETQTY
Ga0209687_124904123300026322SoilSASEDTGEDISMEDVLGGGTKKQPAPAKAAAEEAPEVETQTY
Ga0209152_1022129123300026325SoilSSAEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY
Ga0209802_108907733300026328SoilAESGAEEAGAEDISMEEVLGAGTRKQAETAKEEAGEVPEVETQTY
Ga0209057_114943113300026342SoilQEDISMEEVLGKGTRKQPVAAKEEAAEEASPVETQTF
Ga0257164_105657423300026497SoilEDISMEDVLGKGVRKQAAPAIENVDEDVPQVETQTY
Ga0209808_114878623300026523SoilLTASDSSTEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY
Ga0209160_109900513300026532SoilAEEAGAEDISMEEVLGAGTRKQAETAKEEAGEVPEVETQTY
Ga0209161_1047898123300026548SoilGDSSAEDISMEDVLGAGTRRKAAAAKEEAGEDVPQVETQAY
Ga0209474_1055323923300026550SoilGTEDISMEDVLGGGTKKQPSAAKEGAEELPQVETQTYS
Ga0209734_104215723300027535Forest SoilSDAGSEDISMEDVLGKGVRKQPAAAKETVDEDVPQVETQTY
Ga0208043_116721713300027570Peatlands SoilASEDAGAEDISMEDVLGAGTRKQPVAAKESVADDVPQVETQTY
Ga0209220_109333213300027587Forest SoilGSEDISMEDVLGKGTRKQPAPAKETVDEDVPQVETQTY
Ga0209733_108640213300027591Forest SoilISAADDSGGEDISMEDVLGAGTRKQPAATKDTVAEDIPQVETQTY
Ga0208324_104876413300027604Peatlands SoilRGMDINAVEDAGTEDISMEDVLGAGTRKQPAAAKDAVAEEVPQVETQTY
Ga0209810_136364423300027773Surface SoilIMAAEAGAGEDISMEDVLGGPTRKQPAPAKTQADTDEVPQIETQTY
Ga0209060_1054070723300027826Surface SoilEIMAAEAGAGEDISMEDVLGGPARKQPAAAKAQADTDEVPQIETQTY
Ga0209693_1052954713300027855SoilGGEDISMEDVLGGGTKKAPSAAQDVADEVPQVESQTF
Ga0209275_1058956613300027884SoilESGIDIDASEDGAAEDISMEDVLGAGTRKQPVAAKEAADETVPQVETQTY
Ga0209068_1050958223300027894WatershedsEAGAEDISMEDVLGKGVRKQPAPANETVDEDVPQVETQTY
Ga0209068_1089462123300027894WatershedsGGVDIRAAEDAGAEDISMEDVLGAGTRKQPAAAKDSTAEDVPQVETQTY
Ga0209526_1042516923300028047Forest SoilQAAGAPEAGSEDISMEDVLGKGVRKQPAPANETVDEDVPQVETQTY
Ga0137415_1122596923300028536Vadose Zone SoilGADDSASEDISMEEVLGAGTRKQPAAAKEEEAGEVPEVETQTY
Ga0170823_1056658923300031128Forest SoilGSEDISMEDVLGKGVRKQPAAAKETVDEDVPQVETQTY
Ga0307468_10012950833300031740Hardwood Forest SoilPAAEAAGDDISMEDVLGGGTKKAPASAPESADEVPQVESQTF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.