| Basic Information | |
|---|---|
| Family ID | F075264 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 75.63 % |
| % of genes near scaffold ends (potentially truncated) | 41.18 % |
| % of genes from short scaffolds (< 2000 bps) | 88.24 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.067 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.605 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.134 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.11% β-sheet: 0.00% Coil/Unstructured: 41.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 12.61 |
| PF00278 | Orn_DAP_Arg_deC | 7.56 |
| PF02784 | Orn_Arg_deC_N | 5.04 |
| PF14018 | DUF4234 | 4.20 |
| PF00106 | adh_short | 1.68 |
| PF08240 | ADH_N | 1.68 |
| PF01209 | Ubie_methyltran | 0.84 |
| PF13602 | ADH_zinc_N_2 | 0.84 |
| PF00355 | Rieske | 0.84 |
| PF01610 | DDE_Tnp_ISL3 | 0.84 |
| PF11695 | DUF3291 | 0.84 |
| PF03992 | ABM | 0.84 |
| PF12680 | SnoaL_2 | 0.84 |
| PF13560 | HTH_31 | 0.84 |
| PF04545 | Sigma70_r4 | 0.84 |
| PF13847 | Methyltransf_31 | 0.84 |
| PF00075 | RNase_H | 0.84 |
| PF00196 | GerE | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 12.61 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 12.61 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.84 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.84 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.07 % |
| All Organisms | root | All Organisms | 31.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01AUL8C | Not Available | 584 | Open in IMG/M |
| 3300000956|JGI10216J12902_105363490 | Not Available | 672 | Open in IMG/M |
| 3300001991|JGI24743J22301_10131639 | Not Available | 553 | Open in IMG/M |
| 3300004463|Ga0063356_105441768 | Not Available | 546 | Open in IMG/M |
| 3300004480|Ga0062592_102109898 | Not Available | 559 | Open in IMG/M |
| 3300004798|Ga0058859_10051297 | Not Available | 830 | Open in IMG/M |
| 3300005164|Ga0066815_10036317 | Not Available | 764 | Open in IMG/M |
| 3300005367|Ga0070667_100338774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes | 1360 | Open in IMG/M |
| 3300005547|Ga0070693_100109692 | Not Available | 1696 | Open in IMG/M |
| 3300005615|Ga0070702_100274987 | Not Available | 1153 | Open in IMG/M |
| 3300005616|Ga0068852_100084069 | All Organisms → cellular organisms → Bacteria | 2831 | Open in IMG/M |
| 3300005718|Ga0068866_10816157 | Not Available | 650 | Open in IMG/M |
| 3300005764|Ga0066903_100427042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2198 | Open in IMG/M |
| 3300005764|Ga0066903_101767948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1180 | Open in IMG/M |
| 3300005764|Ga0066903_108065806 | Not Available | 540 | Open in IMG/M |
| 3300005983|Ga0081540_1006010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8938 | Open in IMG/M |
| 3300005983|Ga0081540_1009373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6750 | Open in IMG/M |
| 3300006173|Ga0070716_100042399 | All Organisms → cellular organisms → Bacteria | 2540 | Open in IMG/M |
| 3300006175|Ga0070712_101549275 | Not Available | 579 | Open in IMG/M |
| 3300006573|Ga0074055_11764806 | Not Available | 1612 | Open in IMG/M |
| 3300006578|Ga0074059_11694082 | Not Available | 616 | Open in IMG/M |
| 3300006578|Ga0074059_12171092 | Not Available | 690 | Open in IMG/M |
| 3300006580|Ga0074049_12724331 | Not Available | 510 | Open in IMG/M |
| 3300006755|Ga0079222_12617913 | Not Available | 507 | Open in IMG/M |
| 3300006804|Ga0079221_11471787 | Not Available | 545 | Open in IMG/M |
| 3300006852|Ga0075433_11363968 | Not Available | 614 | Open in IMG/M |
| 3300006854|Ga0075425_100295116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1865 | Open in IMG/M |
| 3300006854|Ga0075425_100332137 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300006903|Ga0075426_10122099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes | 1872 | Open in IMG/M |
| 3300006934|Ga0080680_1241295 | Not Available | 549 | Open in IMG/M |
| 3300006953|Ga0074063_14106475 | Not Available | 661 | Open in IMG/M |
| 3300006954|Ga0079219_10097445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1434 | Open in IMG/M |
| 3300006954|Ga0079219_11599802 | Not Available | 597 | Open in IMG/M |
| 3300009098|Ga0105245_12525709 | Not Available | 567 | Open in IMG/M |
| 3300009174|Ga0105241_11112495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300009174|Ga0105241_11137333 | Not Available | 737 | Open in IMG/M |
| 3300009177|Ga0105248_10302619 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300009545|Ga0105237_10079251 | All Organisms → cellular organisms → Bacteria | 3275 | Open in IMG/M |
| 3300009545|Ga0105237_11988349 | Not Available | 590 | Open in IMG/M |
| 3300009551|Ga0105238_10129065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2506 | Open in IMG/M |
| 3300009551|Ga0105238_10129412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2503 | Open in IMG/M |
| 3300010043|Ga0126380_11831337 | Not Available | 550 | Open in IMG/M |
| 3300010047|Ga0126382_11568244 | Not Available | 609 | Open in IMG/M |
| 3300010134|Ga0127484_1131056 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010154|Ga0127503_10188640 | Not Available | 534 | Open in IMG/M |
| 3300010154|Ga0127503_11020577 | Not Available | 608 | Open in IMG/M |
| 3300010359|Ga0126376_12212715 | Not Available | 595 | Open in IMG/M |
| 3300010366|Ga0126379_13333512 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010375|Ga0105239_10085714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3472 | Open in IMG/M |
| 3300010403|Ga0134123_12737701 | Not Available | 561 | Open in IMG/M |
| 3300011106|Ga0151489_1213441 | Not Available | 678 | Open in IMG/M |
| 3300011107|Ga0151490_1498812 | Not Available | 700 | Open in IMG/M |
| 3300012200|Ga0137382_10347352 | Not Available | 1040 | Open in IMG/M |
| 3300012208|Ga0137376_10449573 | Not Available | 1118 | Open in IMG/M |
| 3300012371|Ga0134022_1146757 | Not Available | 608 | Open in IMG/M |
| 3300012395|Ga0134044_1239657 | Not Available | 534 | Open in IMG/M |
| 3300012915|Ga0157302_10365151 | Not Available | 583 | Open in IMG/M |
| 3300012955|Ga0164298_10739306 | Not Available | 695 | Open in IMG/M |
| 3300012955|Ga0164298_11133298 | Not Available | 588 | Open in IMG/M |
| 3300012957|Ga0164303_10169575 | Not Available | 1177 | Open in IMG/M |
| 3300012957|Ga0164303_10643081 | Not Available | 706 | Open in IMG/M |
| 3300012957|Ga0164303_11344858 | Not Available | 531 | Open in IMG/M |
| 3300012960|Ga0164301_10162072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes | 1382 | Open in IMG/M |
| 3300012961|Ga0164302_10970177 | Not Available | 659 | Open in IMG/M |
| 3300012971|Ga0126369_10898076 | Not Available | 971 | Open in IMG/M |
| 3300012971|Ga0126369_12525883 | Not Available | 599 | Open in IMG/M |
| 3300013308|Ga0157375_10264195 | Not Available | 1882 | Open in IMG/M |
| 3300014157|Ga0134078_10171205 | Not Available | 868 | Open in IMG/M |
| 3300014326|Ga0157380_10210927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1731 | Open in IMG/M |
| 3300014969|Ga0157376_10137320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WAC05292 | 2189 | Open in IMG/M |
| 3300015371|Ga0132258_10737209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Rothia → Rothia mucilaginosa → Rothia mucilaginosa DY-18 | 2482 | Open in IMG/M |
| 3300015371|Ga0132258_10949976 | Not Available | 2171 | Open in IMG/M |
| 3300016270|Ga0182036_11090385 | Not Available | 661 | Open in IMG/M |
| 3300019233|Ga0184645_1227347 | Not Available | 663 | Open in IMG/M |
| 3300019255|Ga0184643_1308048 | Not Available | 524 | Open in IMG/M |
| 3300019259|Ga0184646_1359480 | Not Available | 516 | Open in IMG/M |
| 3300019263|Ga0184647_1487081 | Not Available | 562 | Open in IMG/M |
| 3300019279|Ga0184642_1261050 | Not Available | 667 | Open in IMG/M |
| 3300019361|Ga0173482_10662944 | Not Available | 534 | Open in IMG/M |
| 3300020069|Ga0197907_10821471 | Not Available | 508 | Open in IMG/M |
| 3300020080|Ga0206350_10340119 | Not Available | 517 | Open in IMG/M |
| 3300021478|Ga0210402_11369744 | Not Available | 635 | Open in IMG/M |
| 3300021560|Ga0126371_12214180 | Not Available | 663 | Open in IMG/M |
| 3300024279|Ga0247692_1050393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300025898|Ga0207692_10679233 | Not Available | 667 | Open in IMG/M |
| 3300025900|Ga0207710_10096194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes | 1392 | Open in IMG/M |
| 3300025900|Ga0207710_10648991 | Not Available | 553 | Open in IMG/M |
| 3300025901|Ga0207688_10019567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3691 | Open in IMG/M |
| 3300025903|Ga0207680_10657141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
| 3300025905|Ga0207685_10220381 | Not Available | 902 | Open in IMG/M |
| 3300025911|Ga0207654_10676767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 740 | Open in IMG/M |
| 3300025913|Ga0207695_10289877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes | 1529 | Open in IMG/M |
| 3300025929|Ga0207664_10517438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WAC05292 | 1069 | Open in IMG/M |
| 3300025934|Ga0207686_10465433 | Not Available | 975 | Open in IMG/M |
| 3300025941|Ga0207711_10275656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes | 1548 | Open in IMG/M |
| 3300025941|Ga0207711_11434933 | Not Available | 633 | Open in IMG/M |
| 3300026075|Ga0207708_10285067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes | 1339 | Open in IMG/M |
| 3300027787|Ga0209074_10167065 | Not Available | 804 | Open in IMG/M |
| 3300028379|Ga0268266_10326195 | Not Available | 1438 | Open in IMG/M |
| 3300028381|Ga0268264_10010339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 7720 | Open in IMG/M |
| 3300028799|Ga0307284_10322489 | Not Available | 623 | Open in IMG/M |
| 3300028811|Ga0307292_10309675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300028884|Ga0307308_10574925 | Not Available | 540 | Open in IMG/M |
| 3300030969|Ga0075394_11943411 | Not Available | 535 | Open in IMG/M |
| 3300031231|Ga0170824_113974753 | Not Available | 576 | Open in IMG/M |
| 3300031561|Ga0318528_10801364 | Not Available | 504 | Open in IMG/M |
| 3300031716|Ga0310813_10768990 | Not Available | 865 | Open in IMG/M |
| 3300031716|Ga0310813_11288997 | Not Available | 675 | Open in IMG/M |
| 3300031765|Ga0318554_10364036 | Not Available | 822 | Open in IMG/M |
| 3300031777|Ga0318543_10382383 | Not Available | 631 | Open in IMG/M |
| 3300031897|Ga0318520_10737012 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300031910|Ga0306923_11099115 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300031912|Ga0306921_11034245 | Not Available | 925 | Open in IMG/M |
| 3300032008|Ga0318562_10590065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. 4G55 | 642 | Open in IMG/M |
| 3300032009|Ga0318563_10294957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
| 3300032075|Ga0310890_10387349 | Not Available | 1034 | Open in IMG/M |
| 3300032205|Ga0307472_102511072 | Not Available | 524 | Open in IMG/M |
| 3300033412|Ga0310810_10488073 | Not Available | 1231 | Open in IMG/M |
| 3300033550|Ga0247829_11258392 | Not Available | 613 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 7.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 4.20% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.20% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.36% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.52% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.68% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.68% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.84% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006934 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A1 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_02846080 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARAN |
| JGI10216J12902_1053634902 | 3300000956 | Soil | MNGSHGRTQRIVKQLVEIWRDSRYASQRLTAINRPWIGE* |
| JGI24743J22301_101316391 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRAS |
| Ga0063356_1054417682 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MNDSPTRTGRIVGRLVAIWHDSRYASQRLTAINRPWIAQRPSAQTN* |
| Ga0062592_1021098982 | 3300004480 | Soil | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASAR |
| Ga0058859_100512971 | 3300004798 | Host-Associated | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN* |
| Ga0066815_100363172 | 3300005164 | Soil | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRTRAQTN* |
| Ga0070667_1003387741 | 3300005367 | Switchgrass Rhizosphere | YSHPRKSEHPLERYTTNNSRTRTGRIFERLVAMWQDTQHASQRLTAINRPWIAQRASARSN* |
| Ga0070693_1001096923 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAKR |
| Ga0070702_1002749872 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAQRTSARSS* |
| Ga0068852_1000840694 | 3300005616 | Corn Rhizosphere | MNKSRNRTGRIFERLSAIWQDTRNASERLSAINRPWVAKRTSARSS* |
| Ga0068866_108161572 | 3300005718 | Miscanthus Rhizosphere | ELPVERYSMNKSRNRTGRIFERLTAIWQDTRYASERLSAINRPWVAKRTSARSS* |
| Ga0066903_1004270421 | 3300005764 | Tropical Forest Soil | MNESRTRTGRIFERLAAIWQDTRYASQRLAAVNRPWIQRTNAPAK* |
| Ga0066903_1017679482 | 3300005764 | Tropical Forest Soil | MNASRTRTGRIRDQLAAIWHDTRYASQRLTAINRPWIAQQTSTRAT* |
| Ga0066903_1080658062 | 3300005764 | Tropical Forest Soil | MNESRTRTGRIFDRLAAIWQDTRYASQRLTAINRPWIAQRESAQPN* |
| Ga0081540_10060109 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MNESRTRTGRIFGWLAAIWHDTRYASQRLTAINRPWIAQRTSAQAN* |
| Ga0081540_10093733 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MNETDNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRSTARSN* |
| Ga0070716_1000423991 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKSRNRTGRIFERLMAIWQDTRYASERLSAINRPWIAQQTSARSS* |
| Ga0070712_1015492752 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNESRTRTGRIFERLVAIWQDTRYASQRITAINRPWIAQRASARAN* |
| Ga0074055_117648061 | 3300006573 | Soil | MNDSRTRTGRIVGRLVAIWQDTRYASQRLTAINRPWIAQRTRAQTN* |
| Ga0074059_116940822 | 3300006578 | Soil | MNDSRTRTGRIVGRLVAIWQDTRHASQRLTAINRPWIAQRTRAQTN* |
| Ga0074059_121710921 | 3300006578 | Soil | YSHPSKSEHPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRITAINRPWIAQRASARAN* |
| Ga0074049_127243312 | 3300006580 | Soil | MNESPTRTGRIFDRLVAIWHDTRYASQRLTAINRPWIAQRTSARTN* |
| Ga0079222_126179131 | 3300006755 | Agricultural Soil | SRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN* |
| Ga0079221_114717872 | 3300006804 | Agricultural Soil | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRVSARSN* |
| Ga0075433_113639682 | 3300006852 | Populus Rhizosphere | MNESRTRTGRIFQRLVAVWQDTRYTSQRRTAINRP* |
| Ga0075425_1002951164 | 3300006854 | Populus Rhizosphere | NESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN* |
| Ga0075425_1003321375 | 3300006854 | Populus Rhizosphere | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRP |
| Ga0075426_101220992 | 3300006903 | Populus Rhizosphere | MNESRIRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN* |
| Ga0080680_12412951 | 3300006934 | Tropical Rainforest Soil | MNESRTRTGQIFQRLAAIWQDTRYASQRLSAVNRPWIAQRTSAREN* |
| Ga0074063_141064751 | 3300006953 | Soil | VNPNTHLERYSMNDSRTRTGRIVGRLVAIWQDTRHASQRLTAINRPWIAQRTRAQTN* |
| Ga0079219_100974451 | 3300006954 | Agricultural Soil | PGQATHIQSEYELPVEMYSMNKSRNRTGRIFERLAAIRQDIRYASERLSAINRPWVAQRTSARSS* |
| Ga0079219_115998021 | 3300006954 | Agricultural Soil | MNKSRNRTGRIFERLTAVWQDTRYASERLSAINRPWVAKRTSARSS* |
| Ga0105245_125257091 | 3300009098 | Miscanthus Rhizosphere | MNKSRTRTERIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN* |
| Ga0105241_111124951 | 3300009174 | Corn Rhizosphere | KHPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN* |
| Ga0105241_111373333 | 3300009174 | Corn Rhizosphere | MNKSRNRTGRIFERLSAIWQDTRNASERLSAINRP |
| Ga0105248_103026193 | 3300009177 | Switchgrass Rhizosphere | LERYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN* |
| Ga0105237_100792513 | 3300009545 | Corn Rhizosphere | MNESRTRTERIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN* |
| Ga0105237_119883492 | 3300009545 | Corn Rhizosphere | MNESRTRTGWIFDRLAAIWQDTSYASQRLTAINRPWIAQRTSARPEVIAQAPA* |
| Ga0105238_101290653 | 3300009551 | Corn Rhizosphere | MNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVA |
| Ga0105238_101294121 | 3300009551 | Corn Rhizosphere | RYSMNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAKRTSARSS* |
| Ga0126380_118313372 | 3300010043 | Tropical Forest Soil | FERNTMNASRTRTGRILDQLAAIWHDTRYASQRLTAINRPWIAQQTSTRAT* |
| Ga0126382_115682442 | 3300010047 | Tropical Forest Soil | MNASRTRTGRILDQLAAIWHDTRYASQRLTAINRPWIAQQTSTRAT* |
| Ga0127484_11310562 | 3300010134 | Grasslands Soil | MNESRNRTGRIFEQLVAIWQDTRYASQRLTAINRPWIAQQTTTRVGI* |
| Ga0127503_101886401 | 3300010154 | Soil | MNESRNRTGRIFERLAAIWQDTRYASQRLTAINRPWIAQRTNTRPN* |
| Ga0127503_110205771 | 3300010154 | Soil | EHPLERYTMNESRTQTGRIFERLVAIWQDTRYASQRITAINRPWIAQRASARAN* |
| Ga0126376_122127151 | 3300010359 | Tropical Forest Soil | MNESRIRTGRIFERLAAIWQDTRYASQRLTAINRPWIGQRTNTRA |
| Ga0126379_133335121 | 3300010366 | Tropical Forest Soil | MNESRTRTGRIFERLAAIWQDTRYASQRLTAINRPWIAQRTRAQTS* |
| Ga0105239_100857143 | 3300010375 | Corn Rhizosphere | MNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAKRTSARSS* |
| Ga0134123_127377011 | 3300010403 | Terrestrial Soil | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASPRAN* |
| Ga0151489_12134412 | 3300011106 | Soil | MNDSRTRTGRIVGRLVAIWQDTRYASQRLTAINRPWIAQRTSARTN* |
| Ga0151490_14988122 | 3300011107 | Soil | MNDSGTRTGRIVGRLVAIWQDTRYASQRLTAINRPWIAQRTRAQTN* |
| Ga0137382_103473521 | 3300012200 | Vadose Zone Soil | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRTN* |
| Ga0137376_104495733 | 3300012208 | Vadose Zone Soil | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQ |
| Ga0134022_11467571 | 3300012371 | Grasslands Soil | MNESPTRTGRIFDRLAAIWQDTSYAPERLTAINRPWIAQQTSARPEVIAQAPA* |
| Ga0134044_12396572 | 3300012395 | Grasslands Soil | MNKSRNRTGRIFERLTAIWQDTRYASQRLSAINRPWIAQRTTA |
| Ga0157302_103651512 | 3300012915 | Soil | MNKSRNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN* |
| Ga0164298_107393062 | 3300012955 | Soil | RTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARAN* |
| Ga0164298_111332982 | 3300012955 | Soil | IQHPFERYTMNESRTRTGRLFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN* |
| Ga0164303_101695751 | 3300012957 | Soil | MNESRTRTGWIFQRLVAIWQDTRYASQRLTAINRPWIAQRATARSN* |
| Ga0164303_106430812 | 3300012957 | Soil | MNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAQRS |
| Ga0164303_113448581 | 3300012957 | Soil | ESRTRTGWIFDQLAAIWQDTSYASQRLTAINRPWIAERTSGSRQLV* |
| Ga0164301_101620722 | 3300012960 | Soil | MNESRTRTGRIFERLVAIWQDTRYASQRVTAINRPWIAQRASARSN* |
| Ga0164302_109701771 | 3300012961 | Soil | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARAN* |
| Ga0126369_108980761 | 3300012971 | Tropical Forest Soil | PEHPRERYTMNESRTRTGRIFDRLAAIWQDTRYASQRLTAINRPWIAQRTSAQPN* |
| Ga0126369_125258831 | 3300012971 | Tropical Forest Soil | MNASRTRTGRIRDRLAAIWHDTRYASQRLTAINRPW |
| Ga0157375_102641953 | 3300013308 | Miscanthus Rhizosphere | MNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAQ |
| Ga0134078_101712052 | 3300014157 | Grasslands Soil | MNESRTRTGGIFERLVAIWQDTRYASQRLTAINRPWIAQRTNTRPN* |
| Ga0157380_102109271 | 3300014326 | Switchgrass Rhizosphere | TSKHPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRPTAINRP* |
| Ga0157376_101373203 | 3300014969 | Miscanthus Rhizosphere | MNESRTRTGRIFERLVAIWQDTRYASQRLTATNRPWIAQRASARSN* |
| Ga0132258_107372093 | 3300015371 | Arabidopsis Rhizosphere | MNESRTRTGRIFERLAAIWQDTRYASQRLTAINRPWIAQRASARSN* |
| Ga0132258_109499763 | 3300015371 | Arabidopsis Rhizosphere | MNDSPTRTGRIVGRLAAIWHDTRYASQRLTAINRPWITQPARN* |
| Ga0182036_110903852 | 3300016270 | Soil | MNESRTRTGRIFDRLAAVWQDTRYASQRLTAINRPWIAQRTSAQPN |
| Ga0184645_12273471 | 3300019233 | Groundwater Sediment | MNESRNRTGRIFARLVAIWQDTRYASQRLTAINRPWIAQRTN |
| Ga0184643_13080481 | 3300019255 | Groundwater Sediment | MNESRNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRTNTRPN |
| Ga0184646_13594801 | 3300019259 | Groundwater Sediment | MNESRNRTGRIFERLVAIWQDTRYASQPLSAINRPWIAQRTN |
| Ga0184647_14870811 | 3300019263 | Groundwater Sediment | MNKSRNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRTN |
| Ga0184642_12610501 | 3300019279 | Groundwater Sediment | MNESRNRTGRIFERLVAIWQDTRYASQRLSAINRPWIAQRTN |
| Ga0173482_106629441 | 3300019361 | Soil | ESMNESHTRTGRIFTRLVAIWHDTRYASQRLTAINRPWIAQRTSARTT |
| Ga0197907_108214712 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Ga0206350_103401192 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MNESRTRTERIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Ga0210402_113697442 | 3300021478 | Soil | MNESRTRTGRIFERLVAIWQDTRYASQRITAINRPWIAQRASARSN |
| Ga0126371_122141801 | 3300021560 | Tropical Forest Soil | MNETRNQTGRIFARLVAIWQDTRYASQRLTAINRPWVAQRT |
| Ga0247692_10503931 | 3300024279 | Soil | RYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Ga0207692_106792331 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKSRNRTGRIFERLSAIWQDTRNASERLSAINRPW |
| Ga0207710_100961942 | 3300025900 | Switchgrass Rhizosphere | HPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Ga0207710_106489911 | 3300025900 | Switchgrass Rhizosphere | SEYELPVERYSMNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAQRTSSRSS |
| Ga0207688_100195673 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKSRNRTGRIFERLSAIWQDTRNASERLSAINRPWVAKRTSARSS |
| Ga0207680_106571412 | 3300025903 | Switchgrass Rhizosphere | SKHPLERYTMNESRTRTERIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Ga0207685_102203813 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKSRNRTGRIFERLSAIWQDTRNASERLSAINRPWV |
| Ga0207654_106767671 | 3300025911 | Corn Rhizosphere | KHPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Ga0207695_102898772 | 3300025913 | Corn Rhizosphere | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSTNRAGSA |
| Ga0207664_105174382 | 3300025929 | Agricultural Soil | IFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Ga0207686_104654331 | 3300025934 | Miscanthus Rhizosphere | MNKSRNRTGRIFERLSAIWQDTRNASERLSAINRPWVAKRTSARS |
| Ga0207711_102756562 | 3300025941 | Switchgrass Rhizosphere | TGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Ga0207711_114349333 | 3300025941 | Switchgrass Rhizosphere | MNESRTRTGWIFDQLAAIWQDTSYASQRLTAINRP |
| Ga0207708_102850672 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | SKHPLERYTMNESRTRTGRIFERLMAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Ga0209074_101670651 | 3300027787 | Agricultural Soil | MNKSRNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Ga0268266_103261953 | 3300028379 | Switchgrass Rhizosphere | MNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWV |
| Ga0268264_100103392 | 3300028381 | Switchgrass Rhizosphere | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASSRSN |
| Ga0307284_103224891 | 3300028799 | Soil | ERYTMNESRNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRTNTRPN |
| Ga0307292_103096752 | 3300028811 | Soil | MNESRNRTGRIFARLVAIWQDTRYASQRLTAINRPWIAQRTNTRPN |
| Ga0307308_105749252 | 3300028884 | Soil | QSAGHSRGCIKVNPSIHLERYSMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIALRTSARTN |
| Ga0075394_119434111 | 3300030969 | Soil | MNESCTRTGRIFQRLVAICQDTRYASQRLTAINRPWIAQRTSARSN |
| Ga0170824_1139747532 | 3300031231 | Forest Soil | MNESRTRTGRIFERLVAIWQDIRYASQRLTAINRPWIAERANAQAN |
| Ga0318528_108013641 | 3300031561 | Soil | MNDLRTRTGRIFERLAAIWQDTRYASQRLTAINRPWIAQRTSAQPN |
| Ga0310813_107689902 | 3300031716 | Soil | MNESHTRTGRIFTRLVAIWHDTRYASQRLTAINRLY |
| Ga0310813_112889971 | 3300031716 | Soil | SEHPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRPSARSN |
| Ga0318554_103640362 | 3300031765 | Soil | MNESRTRTGRIFDWLAAIWQDTRYASQRLTAINRPWIAQRTSAQPN |
| Ga0318543_103823832 | 3300031777 | Soil | MNDLRTRTGRIFERLAAIWQDTRYASQRLTAINRPWIAQR |
| Ga0318520_107370122 | 3300031897 | Soil | MNETRNQTGRIFARLVAIWQDTRYASQRLTAINRPWVAQRTSARPN |
| Ga0306923_110991151 | 3300031910 | Soil | MNESRTRTGRIFDRLAAIWQDTRYASQRLTAINRPWIAQRTSAQPN |
| Ga0306921_110342451 | 3300031912 | Soil | MNETRNQTGRIFARLVAIWQDTRYASQRLTAINRPWIAQRTSAQPN |
| Ga0318562_105900651 | 3300032008 | Soil | MNDLRTRTGKIFERLAAIWQDTRYASQRLTAINRPWIAQRTSAQPN |
| Ga0318563_102949572 | 3300032009 | Soil | MNESRTRTGRIFDWLAAIWQDTRYASQRLTAINRPWIAQRTNAQPN |
| Ga0310890_103873492 | 3300032075 | Soil | MNESRTRTGRIFQRLVAIWQDTRYASQRLTAINRPWIAQRASARSN |
| Ga0307472_1025110722 | 3300032205 | Hardwood Forest Soil | MNESRTRTRRIFQRLVAIWHDTRYASQRLTAINQPWIAQRTSARTN |
| Ga0310810_104880731 | 3300033412 | Soil | MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRPSARSN |
| Ga0247829_112583922 | 3300033550 | Soil | MSEPPTRTGRIFERLVAIWQDTRYASQRLAINRPWIAQGESARSN |
| ⦗Top⦘ |