NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075264

Metagenome / Metatranscriptome Family F075264

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075264
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 46 residues
Representative Sequence MNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN
Number of Associated Samples 101
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 75.63 %
% of genes near scaffold ends (potentially truncated) 41.18 %
% of genes from short scaffolds (< 2000 bps) 88.24 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (68.067 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.605 % of family members)
Environment Ontology (ENVO) Unclassified
(36.134 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.857 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.11%    β-sheet: 0.00%    Coil/Unstructured: 41.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF13561adh_short_C2 12.61
PF00278Orn_DAP_Arg_deC 7.56
PF02784Orn_Arg_deC_N 5.04
PF14018DUF4234 4.20
PF00106adh_short 1.68
PF08240ADH_N 1.68
PF01209Ubie_methyltran 0.84
PF13602ADH_zinc_N_2 0.84
PF00355Rieske 0.84
PF01610DDE_Tnp_ISL3 0.84
PF11695DUF3291 0.84
PF03992ABM 0.84
PF12680SnoaL_2 0.84
PF13560HTH_31 0.84
PF04545Sigma70_r4 0.84
PF13847Methyltransf_31 0.84
PF00075RNase_H 0.84
PF00196GerE 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0019Diaminopimelate decarboxylaseAmino acid transport and metabolism [E] 12.61
COG1166Arginine decarboxylase (spermidine biosynthesis)Amino acid transport and metabolism [E] 12.61
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.84
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.84
COG3464TransposaseMobilome: prophages, transposons [X] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A68.07 %
All OrganismsrootAll Organisms31.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459019|G14TP7Y01AUL8CNot Available584Open in IMG/M
3300000956|JGI10216J12902_105363490Not Available672Open in IMG/M
3300001991|JGI24743J22301_10131639Not Available553Open in IMG/M
3300004463|Ga0063356_105441768Not Available546Open in IMG/M
3300004480|Ga0062592_102109898Not Available559Open in IMG/M
3300004798|Ga0058859_10051297Not Available830Open in IMG/M
3300005164|Ga0066815_10036317Not Available764Open in IMG/M
3300005367|Ga0070667_100338774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes1360Open in IMG/M
3300005547|Ga0070693_100109692Not Available1696Open in IMG/M
3300005615|Ga0070702_100274987Not Available1153Open in IMG/M
3300005616|Ga0068852_100084069All Organisms → cellular organisms → Bacteria2831Open in IMG/M
3300005718|Ga0068866_10816157Not Available650Open in IMG/M
3300005764|Ga0066903_100427042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2198Open in IMG/M
3300005764|Ga0066903_101767948All Organisms → cellular organisms → Bacteria → Terrabacteria group1180Open in IMG/M
3300005764|Ga0066903_108065806Not Available540Open in IMG/M
3300005983|Ga0081540_1006010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8938Open in IMG/M
3300005983|Ga0081540_1009373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6750Open in IMG/M
3300006173|Ga0070716_100042399All Organisms → cellular organisms → Bacteria2540Open in IMG/M
3300006175|Ga0070712_101549275Not Available579Open in IMG/M
3300006573|Ga0074055_11764806Not Available1612Open in IMG/M
3300006578|Ga0074059_11694082Not Available616Open in IMG/M
3300006578|Ga0074059_12171092Not Available690Open in IMG/M
3300006580|Ga0074049_12724331Not Available510Open in IMG/M
3300006755|Ga0079222_12617913Not Available507Open in IMG/M
3300006804|Ga0079221_11471787Not Available545Open in IMG/M
3300006852|Ga0075433_11363968Not Available614Open in IMG/M
3300006854|Ga0075425_100295116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1865Open in IMG/M
3300006854|Ga0075425_100332137All Organisms → cellular organisms → Bacteria1750Open in IMG/M
3300006903|Ga0075426_10122099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes1872Open in IMG/M
3300006934|Ga0080680_1241295Not Available549Open in IMG/M
3300006953|Ga0074063_14106475Not Available661Open in IMG/M
3300006954|Ga0079219_10097445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1434Open in IMG/M
3300006954|Ga0079219_11599802Not Available597Open in IMG/M
3300009098|Ga0105245_12525709Not Available567Open in IMG/M
3300009174|Ga0105241_11112495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300009174|Ga0105241_11137333Not Available737Open in IMG/M
3300009177|Ga0105248_10302619All Organisms → cellular organisms → Bacteria1801Open in IMG/M
3300009545|Ga0105237_10079251All Organisms → cellular organisms → Bacteria3275Open in IMG/M
3300009545|Ga0105237_11988349Not Available590Open in IMG/M
3300009551|Ga0105238_10129065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2506Open in IMG/M
3300009551|Ga0105238_10129412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2503Open in IMG/M
3300010043|Ga0126380_11831337Not Available550Open in IMG/M
3300010047|Ga0126382_11568244Not Available609Open in IMG/M
3300010134|Ga0127484_1131056All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300010154|Ga0127503_10188640Not Available534Open in IMG/M
3300010154|Ga0127503_11020577Not Available608Open in IMG/M
3300010359|Ga0126376_12212715Not Available595Open in IMG/M
3300010366|Ga0126379_13333512All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300010375|Ga0105239_10085714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3472Open in IMG/M
3300010403|Ga0134123_12737701Not Available561Open in IMG/M
3300011106|Ga0151489_1213441Not Available678Open in IMG/M
3300011107|Ga0151490_1498812Not Available700Open in IMG/M
3300012200|Ga0137382_10347352Not Available1040Open in IMG/M
3300012208|Ga0137376_10449573Not Available1118Open in IMG/M
3300012371|Ga0134022_1146757Not Available608Open in IMG/M
3300012395|Ga0134044_1239657Not Available534Open in IMG/M
3300012915|Ga0157302_10365151Not Available583Open in IMG/M
3300012955|Ga0164298_10739306Not Available695Open in IMG/M
3300012955|Ga0164298_11133298Not Available588Open in IMG/M
3300012957|Ga0164303_10169575Not Available1177Open in IMG/M
3300012957|Ga0164303_10643081Not Available706Open in IMG/M
3300012957|Ga0164303_11344858Not Available531Open in IMG/M
3300012960|Ga0164301_10162072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes1382Open in IMG/M
3300012961|Ga0164302_10970177Not Available659Open in IMG/M
3300012971|Ga0126369_10898076Not Available971Open in IMG/M
3300012971|Ga0126369_12525883Not Available599Open in IMG/M
3300013308|Ga0157375_10264195Not Available1882Open in IMG/M
3300014157|Ga0134078_10171205Not Available868Open in IMG/M
3300014326|Ga0157380_10210927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1731Open in IMG/M
3300014969|Ga0157376_10137320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WAC052922189Open in IMG/M
3300015371|Ga0132258_10737209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Rothia → Rothia mucilaginosa → Rothia mucilaginosa DY-182482Open in IMG/M
3300015371|Ga0132258_10949976Not Available2171Open in IMG/M
3300016270|Ga0182036_11090385Not Available661Open in IMG/M
3300019233|Ga0184645_1227347Not Available663Open in IMG/M
3300019255|Ga0184643_1308048Not Available524Open in IMG/M
3300019259|Ga0184646_1359480Not Available516Open in IMG/M
3300019263|Ga0184647_1487081Not Available562Open in IMG/M
3300019279|Ga0184642_1261050Not Available667Open in IMG/M
3300019361|Ga0173482_10662944Not Available534Open in IMG/M
3300020069|Ga0197907_10821471Not Available508Open in IMG/M
3300020080|Ga0206350_10340119Not Available517Open in IMG/M
3300021478|Ga0210402_11369744Not Available635Open in IMG/M
3300021560|Ga0126371_12214180Not Available663Open in IMG/M
3300024279|Ga0247692_1050393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia645Open in IMG/M
3300025898|Ga0207692_10679233Not Available667Open in IMG/M
3300025900|Ga0207710_10096194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes1392Open in IMG/M
3300025900|Ga0207710_10648991Not Available553Open in IMG/M
3300025901|Ga0207688_10019567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3691Open in IMG/M
3300025903|Ga0207680_10657141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia751Open in IMG/M
3300025905|Ga0207685_10220381Not Available902Open in IMG/M
3300025911|Ga0207654_10676767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia740Open in IMG/M
3300025913|Ga0207695_10289877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes1529Open in IMG/M
3300025929|Ga0207664_10517438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. WAC052921069Open in IMG/M
3300025934|Ga0207686_10465433Not Available975Open in IMG/M
3300025941|Ga0207711_10275656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes1548Open in IMG/M
3300025941|Ga0207711_11434933Not Available633Open in IMG/M
3300026075|Ga0207708_10285067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces diastatochromogenes1339Open in IMG/M
3300027787|Ga0209074_10167065Not Available804Open in IMG/M
3300028379|Ga0268266_10326195Not Available1438Open in IMG/M
3300028381|Ga0268264_10010339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces7720Open in IMG/M
3300028799|Ga0307284_10322489Not Available623Open in IMG/M
3300028811|Ga0307292_10309675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300028884|Ga0307308_10574925Not Available540Open in IMG/M
3300030969|Ga0075394_11943411Not Available535Open in IMG/M
3300031231|Ga0170824_113974753Not Available576Open in IMG/M
3300031561|Ga0318528_10801364Not Available504Open in IMG/M
3300031716|Ga0310813_10768990Not Available865Open in IMG/M
3300031716|Ga0310813_11288997Not Available675Open in IMG/M
3300031765|Ga0318554_10364036Not Available822Open in IMG/M
3300031777|Ga0318543_10382383Not Available631Open in IMG/M
3300031897|Ga0318520_10737012All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300031910|Ga0306923_11099115All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300031912|Ga0306921_11034245Not Available925Open in IMG/M
3300032008|Ga0318562_10590065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. 4G55642Open in IMG/M
3300032009|Ga0318563_10294957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria877Open in IMG/M
3300032075|Ga0310890_10387349Not Available1034Open in IMG/M
3300032205|Ga0307472_102511072Not Available524Open in IMG/M
3300033412|Ga0310810_10488073Not Available1231Open in IMG/M
3300033550|Ga0247829_11258392Not Available613Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere7.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.88%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment4.20%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.20%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere4.20%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.36%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.52%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.68%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.68%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.68%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.68%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.84%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.84%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006934Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A1 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010134Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012371Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300019233Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4MG_028460802170459019Switchgrass, Maize And Mischanthus LitterMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARAN
JGI10216J12902_10536349023300000956SoilMNGSHGRTQRIVKQLVEIWRDSRYASQRLTAINRPWIGE*
JGI24743J22301_1013163913300001991Corn, Switchgrass And Miscanthus RhizosphereMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRAS
Ga0063356_10544176823300004463Arabidopsis Thaliana RhizosphereMNDSPTRTGRIVGRLVAIWHDSRYASQRLTAINRPWIAQRPSAQTN*
Ga0062592_10210989823300004480SoilMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASAR
Ga0058859_1005129713300004798Host-AssociatedMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN*
Ga0066815_1003631723300005164SoilMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRTRAQTN*
Ga0070667_10033877413300005367Switchgrass RhizosphereYSHPRKSEHPLERYTTNNSRTRTGRIFERLVAMWQDTQHASQRLTAINRPWIAQRASARSN*
Ga0070693_10010969233300005547Corn, Switchgrass And Miscanthus RhizosphereMNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAKR
Ga0070702_10027498723300005615Corn, Switchgrass And Miscanthus RhizosphereMNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAQRTSARSS*
Ga0068852_10008406943300005616Corn RhizosphereMNKSRNRTGRIFERLSAIWQDTRNASERLSAINRPWVAKRTSARSS*
Ga0068866_1081615723300005718Miscanthus RhizosphereELPVERYSMNKSRNRTGRIFERLTAIWQDTRYASERLSAINRPWVAKRTSARSS*
Ga0066903_10042704213300005764Tropical Forest SoilMNESRTRTGRIFERLAAIWQDTRYASQRLAAVNRPWIQRTNAPAK*
Ga0066903_10176794823300005764Tropical Forest SoilMNASRTRTGRIRDQLAAIWHDTRYASQRLTAINRPWIAQQTSTRAT*
Ga0066903_10806580623300005764Tropical Forest SoilMNESRTRTGRIFDRLAAIWQDTRYASQRLTAINRPWIAQRESAQPN*
Ga0081540_100601093300005983Tabebuia Heterophylla RhizosphereMNESRTRTGRIFGWLAAIWHDTRYASQRLTAINRPWIAQRTSAQAN*
Ga0081540_100937333300005983Tabebuia Heterophylla RhizosphereMNETDNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRSTARSN*
Ga0070716_10004239913300006173Corn, Switchgrass And Miscanthus RhizosphereMNKSRNRTGRIFERLMAIWQDTRYASERLSAINRPWIAQQTSARSS*
Ga0070712_10154927523300006175Corn, Switchgrass And Miscanthus RhizosphereMNESRTRTGRIFERLVAIWQDTRYASQRITAINRPWIAQRASARAN*
Ga0074055_1176480613300006573SoilMNDSRTRTGRIVGRLVAIWQDTRYASQRLTAINRPWIAQRTRAQTN*
Ga0074059_1169408223300006578SoilMNDSRTRTGRIVGRLVAIWQDTRHASQRLTAINRPWIAQRTRAQTN*
Ga0074059_1217109213300006578SoilYSHPSKSEHPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRITAINRPWIAQRASARAN*
Ga0074049_1272433123300006580SoilMNESPTRTGRIFDRLVAIWHDTRYASQRLTAINRPWIAQRTSARTN*
Ga0079222_1261791313300006755Agricultural SoilSRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN*
Ga0079221_1147178723300006804Agricultural SoilMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRVSARSN*
Ga0075433_1136396823300006852Populus RhizosphereMNESRTRTGRIFQRLVAVWQDTRYTSQRRTAINRP*
Ga0075425_10029511643300006854Populus RhizosphereNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN*
Ga0075425_10033213753300006854Populus RhizosphereMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRP
Ga0075426_1012209923300006903Populus RhizosphereMNESRIRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN*
Ga0080680_124129513300006934Tropical Rainforest SoilMNESRTRTGQIFQRLAAIWQDTRYASQRLSAVNRPWIAQRTSAREN*
Ga0074063_1410647513300006953SoilVNPNTHLERYSMNDSRTRTGRIVGRLVAIWQDTRHASQRLTAINRPWIAQRTRAQTN*
Ga0079219_1009744513300006954Agricultural SoilPGQATHIQSEYELPVEMYSMNKSRNRTGRIFERLAAIRQDIRYASERLSAINRPWVAQRTSARSS*
Ga0079219_1159980213300006954Agricultural SoilMNKSRNRTGRIFERLTAVWQDTRYASERLSAINRPWVAKRTSARSS*
Ga0105245_1252570913300009098Miscanthus RhizosphereMNKSRTRTERIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN*
Ga0105241_1111249513300009174Corn RhizosphereKHPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN*
Ga0105241_1113733333300009174Corn RhizosphereMNKSRNRTGRIFERLSAIWQDTRNASERLSAINRP
Ga0105248_1030261933300009177Switchgrass RhizosphereLERYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN*
Ga0105237_1007925133300009545Corn RhizosphereMNESRTRTERIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN*
Ga0105237_1198834923300009545Corn RhizosphereMNESRTRTGWIFDRLAAIWQDTSYASQRLTAINRPWIAQRTSARPEVIAQAPA*
Ga0105238_1012906533300009551Corn RhizosphereMNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVA
Ga0105238_1012941213300009551Corn RhizosphereRYSMNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAKRTSARSS*
Ga0126380_1183133723300010043Tropical Forest SoilFERNTMNASRTRTGRILDQLAAIWHDTRYASQRLTAINRPWIAQQTSTRAT*
Ga0126382_1156824423300010047Tropical Forest SoilMNASRTRTGRILDQLAAIWHDTRYASQRLTAINRPWIAQQTSTRAT*
Ga0127484_113105623300010134Grasslands SoilMNESRNRTGRIFEQLVAIWQDTRYASQRLTAINRPWIAQQTTTRVGI*
Ga0127503_1018864013300010154SoilMNESRNRTGRIFERLAAIWQDTRYASQRLTAINRPWIAQRTNTRPN*
Ga0127503_1102057713300010154SoilEHPLERYTMNESRTQTGRIFERLVAIWQDTRYASQRITAINRPWIAQRASARAN*
Ga0126376_1221271513300010359Tropical Forest SoilMNESRIRTGRIFERLAAIWQDTRYASQRLTAINRPWIGQRTNTRA
Ga0126379_1333351213300010366Tropical Forest SoilMNESRTRTGRIFERLAAIWQDTRYASQRLTAINRPWIAQRTRAQTS*
Ga0105239_1008571433300010375Corn RhizosphereMNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAKRTSARSS*
Ga0134123_1273770113300010403Terrestrial SoilMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASPRAN*
Ga0151489_121344123300011106SoilMNDSRTRTGRIVGRLVAIWQDTRYASQRLTAINRPWIAQRTSARTN*
Ga0151490_149881223300011107SoilMNDSGTRTGRIVGRLVAIWQDTRYASQRLTAINRPWIAQRTRAQTN*
Ga0137382_1034735213300012200Vadose Zone SoilMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRTN*
Ga0137376_1044957333300012208Vadose Zone SoilMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQ
Ga0134022_114675713300012371Grasslands SoilMNESPTRTGRIFDRLAAIWQDTSYAPERLTAINRPWIAQQTSARPEVIAQAPA*
Ga0134044_123965723300012395Grasslands SoilMNKSRNRTGRIFERLTAIWQDTRYASQRLSAINRPWIAQRTTA
Ga0157302_1036515123300012915SoilMNKSRNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN*
Ga0164298_1073930623300012955SoilRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARAN*
Ga0164298_1113329823300012955SoilIQHPFERYTMNESRTRTGRLFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN*
Ga0164303_1016957513300012957SoilMNESRTRTGWIFQRLVAIWQDTRYASQRLTAINRPWIAQRATARSN*
Ga0164303_1064308123300012957SoilMNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAQRS
Ga0164303_1134485813300012957SoilESRTRTGWIFDQLAAIWQDTSYASQRLTAINRPWIAERTSGSRQLV*
Ga0164301_1016207223300012960SoilMNESRTRTGRIFERLVAIWQDTRYASQRVTAINRPWIAQRASARSN*
Ga0164302_1097017713300012961SoilMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARAN*
Ga0126369_1089807613300012971Tropical Forest SoilPEHPRERYTMNESRTRTGRIFDRLAAIWQDTRYASQRLTAINRPWIAQRTSAQPN*
Ga0126369_1252588313300012971Tropical Forest SoilMNASRTRTGRIRDRLAAIWHDTRYASQRLTAINRPW
Ga0157375_1026419533300013308Miscanthus RhizosphereMNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAQ
Ga0134078_1017120523300014157Grasslands SoilMNESRTRTGGIFERLVAIWQDTRYASQRLTAINRPWIAQRTNTRPN*
Ga0157380_1021092713300014326Switchgrass RhizosphereTSKHPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRPTAINRP*
Ga0157376_1013732033300014969Miscanthus RhizosphereMNESRTRTGRIFERLVAIWQDTRYASQRLTATNRPWIAQRASARSN*
Ga0132258_1073720933300015371Arabidopsis RhizosphereMNESRTRTGRIFERLAAIWQDTRYASQRLTAINRPWIAQRASARSN*
Ga0132258_1094997633300015371Arabidopsis RhizosphereMNDSPTRTGRIVGRLAAIWHDTRYASQRLTAINRPWITQPARN*
Ga0182036_1109038523300016270SoilMNESRTRTGRIFDRLAAVWQDTRYASQRLTAINRPWIAQRTSAQPN
Ga0184645_122734713300019233Groundwater SedimentMNESRNRTGRIFARLVAIWQDTRYASQRLTAINRPWIAQRTN
Ga0184643_130804813300019255Groundwater SedimentMNESRNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRTNTRPN
Ga0184646_135948013300019259Groundwater SedimentMNESRNRTGRIFERLVAIWQDTRYASQPLSAINRPWIAQRTN
Ga0184647_148708113300019263Groundwater SedimentMNKSRNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRTN
Ga0184642_126105013300019279Groundwater SedimentMNESRNRTGRIFERLVAIWQDTRYASQRLSAINRPWIAQRTN
Ga0173482_1066294413300019361SoilESMNESHTRTGRIFTRLVAIWHDTRYASQRLTAINRPWIAQRTSARTT
Ga0197907_1082147123300020069Corn, Switchgrass And Miscanthus RhizosphereMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN
Ga0206350_1034011923300020080Corn, Switchgrass And Miscanthus RhizosphereMNESRTRTERIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN
Ga0210402_1136974423300021478SoilMNESRTRTGRIFERLVAIWQDTRYASQRITAINRPWIAQRASARSN
Ga0126371_1221418013300021560Tropical Forest SoilMNETRNQTGRIFARLVAIWQDTRYASQRLTAINRPWVAQRT
Ga0247692_105039313300024279SoilRYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN
Ga0207692_1067923313300025898Corn, Switchgrass And Miscanthus RhizosphereMNKSRNRTGRIFERLSAIWQDTRNASERLSAINRPW
Ga0207710_1009619423300025900Switchgrass RhizosphereHPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN
Ga0207710_1064899113300025900Switchgrass RhizosphereSEYELPVERYSMNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWVAQRTSSRSS
Ga0207688_1001956733300025901Corn, Switchgrass And Miscanthus RhizosphereMNKSRNRTGRIFERLSAIWQDTRNASERLSAINRPWVAKRTSARSS
Ga0207680_1065714123300025903Switchgrass RhizosphereSKHPLERYTMNESRTRTERIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN
Ga0207685_1022038133300025905Corn, Switchgrass And Miscanthus RhizosphereMNKSRNRTGRIFERLSAIWQDTRNASERLSAINRPWV
Ga0207654_1067676713300025911Corn RhizosphereKHPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN
Ga0207695_1028987723300025913Corn RhizosphereMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSTNRAGSA
Ga0207664_1051743823300025929Agricultural SoilIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN
Ga0207686_1046543313300025934Miscanthus RhizosphereMNKSRNRTGRIFERLSAIWQDTRNASERLSAINRPWVAKRTSARS
Ga0207711_1027565623300025941Switchgrass RhizosphereTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN
Ga0207711_1143493333300025941Switchgrass RhizosphereMNESRTRTGWIFDQLAAIWQDTSYASQRLTAINRP
Ga0207708_1028506723300026075Corn, Switchgrass And Miscanthus RhizosphereSKHPLERYTMNESRTRTGRIFERLMAIWQDTRYASQRLTAINRPWIAQRASARSN
Ga0209074_1016706513300027787Agricultural SoilMNKSRNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASARSN
Ga0268266_1032619533300028379Switchgrass RhizosphereMNKSRNRTGRIFERLAAIWQDTRYASERLSAINRPWV
Ga0268264_1001033923300028381Switchgrass RhizosphereMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRASSRSN
Ga0307284_1032248913300028799SoilERYTMNESRNRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRTNTRPN
Ga0307292_1030967523300028811SoilMNESRNRTGRIFARLVAIWQDTRYASQRLTAINRPWIAQRTNTRPN
Ga0307308_1057492523300028884SoilQSAGHSRGCIKVNPSIHLERYSMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIALRTSARTN
Ga0075394_1194341113300030969SoilMNESCTRTGRIFQRLVAICQDTRYASQRLTAINRPWIAQRTSARSN
Ga0170824_11397475323300031231Forest SoilMNESRTRTGRIFERLVAIWQDIRYASQRLTAINRPWIAERANAQAN
Ga0318528_1080136413300031561SoilMNDLRTRTGRIFERLAAIWQDTRYASQRLTAINRPWIAQRTSAQPN
Ga0310813_1076899023300031716SoilMNESHTRTGRIFTRLVAIWHDTRYASQRLTAINRLY
Ga0310813_1128899713300031716SoilSEHPLERYTMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRPSARSN
Ga0318554_1036403623300031765SoilMNESRTRTGRIFDWLAAIWQDTRYASQRLTAINRPWIAQRTSAQPN
Ga0318543_1038238323300031777SoilMNDLRTRTGRIFERLAAIWQDTRYASQRLTAINRPWIAQR
Ga0318520_1073701223300031897SoilMNETRNQTGRIFARLVAIWQDTRYASQRLTAINRPWVAQRTSARPN
Ga0306923_1109911513300031910SoilMNESRTRTGRIFDRLAAIWQDTRYASQRLTAINRPWIAQRTSAQPN
Ga0306921_1103424513300031912SoilMNETRNQTGRIFARLVAIWQDTRYASQRLTAINRPWIAQRTSAQPN
Ga0318562_1059006513300032008SoilMNDLRTRTGKIFERLAAIWQDTRYASQRLTAINRPWIAQRTSAQPN
Ga0318563_1029495723300032009SoilMNESRTRTGRIFDWLAAIWQDTRYASQRLTAINRPWIAQRTNAQPN
Ga0310890_1038734923300032075SoilMNESRTRTGRIFQRLVAIWQDTRYASQRLTAINRPWIAQRASARSN
Ga0307472_10251107223300032205Hardwood Forest SoilMNESRTRTRRIFQRLVAIWHDTRYASQRLTAINQPWIAQRTSARTN
Ga0310810_1048807313300033412SoilMNESRTRTGRIFERLVAIWQDTRYASQRLTAINRPWIAQRPSARSN
Ga0247829_1125839223300033550SoilMSEPPTRTGRIFERLVAIWQDTRYASQRLAINRPWIAQGESARSN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.