| Basic Information | |
|---|---|
| Family ID | F075246 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTMKLVIAPLTFVSLAVLLVYTEPHIPCVVMVLAKFAGHVSL |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.79 % |
| % of genes near scaffold ends (potentially truncated) | 24.37 % |
| % of genes from short scaffolds (< 2000 bps) | 67.23 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.471 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.370 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.092 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.185 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF12867 | DinB_2 | 32.77 |
| PF00912 | Transgly | 2.52 |
| PF03795 | YCII | 1.68 |
| PF13360 | PQQ_2 | 1.68 |
| PF11453 | DUF2950 | 1.68 |
| PF16640 | Big_3_5 | 1.68 |
| PF00144 | Beta-lactamase | 0.84 |
| PF12833 | HTH_18 | 0.84 |
| PF00296 | Bac_luciferase | 0.84 |
| PF10099 | RskA | 0.84 |
| PF03460 | NIR_SIR_ferr | 0.84 |
| PF05985 | EutC | 0.84 |
| PF02687 | FtsX | 0.84 |
| PF00487 | FA_desaturase | 0.84 |
| PF12697 | Abhydrolase_6 | 0.84 |
| PF13442 | Cytochrome_CBB3 | 0.84 |
| PF01987 | AIM24 | 0.84 |
| PF12779 | WXXGXW | 0.84 |
| PF05163 | DinB | 0.84 |
| PF01740 | STAS | 0.84 |
| PF02368 | Big_2 | 0.84 |
| PF04191 | PEMT | 0.84 |
| PF02371 | Transposase_20 | 0.84 |
| PF07859 | Abhydrolase_3 | 0.84 |
| PF00078 | RVT_1 | 0.84 |
| PF00583 | Acetyltransf_1 | 0.84 |
| PF16757 | Fucosidase_C | 0.84 |
| PF01177 | Asp_Glu_race | 0.84 |
| PF13458 | Peripla_BP_6 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.52 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 2.52 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 2.52 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.68 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.84 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.84 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.84 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
| COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 0.84 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.84 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.84 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.84 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.47 % |
| Unclassified | root | N/A | 23.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001545|JGI12630J15595_10116041 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300001593|JGI12635J15846_10038982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3720 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100162460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2111 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100165404 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101810374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300002568|C688J35102_120979262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4592 | Open in IMG/M |
| 3300004080|Ga0062385_11243484 | Not Available | 511 | Open in IMG/M |
| 3300004092|Ga0062389_100098945 | Not Available | 2574 | Open in IMG/M |
| 3300004152|Ga0062386_101437339 | Not Available | 574 | Open in IMG/M |
| 3300004153|Ga0063455_100637679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 702 | Open in IMG/M |
| 3300005093|Ga0062594_100458566 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300005175|Ga0066673_10213442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
| 3300005434|Ga0070709_10520482 | Not Available | 906 | Open in IMG/M |
| 3300005434|Ga0070709_11219412 | Not Available | 605 | Open in IMG/M |
| 3300005436|Ga0070713_100014182 | All Organisms → cellular organisms → Bacteria | 5905 | Open in IMG/M |
| 3300005454|Ga0066687_10142905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
| 3300005561|Ga0066699_11251282 | Not Available | 509 | Open in IMG/M |
| 3300005563|Ga0068855_100194752 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
| 3300005569|Ga0066705_10593971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300005602|Ga0070762_10527433 | Not Available | 777 | Open in IMG/M |
| 3300005712|Ga0070764_10913556 | Not Available | 550 | Open in IMG/M |
| 3300005921|Ga0070766_10374789 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300005944|Ga0066788_10017167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1581 | Open in IMG/M |
| 3300005952|Ga0080026_10009373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2291 | Open in IMG/M |
| 3300005994|Ga0066789_10013788 | All Organisms → cellular organisms → Bacteria | 3578 | Open in IMG/M |
| 3300006173|Ga0070716_100299628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1118 | Open in IMG/M |
| 3300006173|Ga0070716_100863041 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300006176|Ga0070765_100303668 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300006176|Ga0070765_100399903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1282 | Open in IMG/M |
| 3300006176|Ga0070765_102108419 | Not Available | 527 | Open in IMG/M |
| 3300006237|Ga0097621_100838887 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300006893|Ga0073928_10003577 | All Organisms → cellular organisms → Bacteria | 24346 | Open in IMG/M |
| 3300006893|Ga0073928_10086042 | All Organisms → cellular organisms → Bacteria | 2678 | Open in IMG/M |
| 3300006893|Ga0073928_10366881 | Not Available | 1062 | Open in IMG/M |
| 3300006914|Ga0075436_100254578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
| 3300009137|Ga0066709_103154540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300009545|Ga0105237_11174832 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300010859|Ga0126352_1082727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1523 | Open in IMG/M |
| 3300010866|Ga0126344_1002836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1467 | Open in IMG/M |
| 3300010866|Ga0126344_1378548 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300011120|Ga0150983_10953403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300011120|Ga0150983_13398266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300011120|Ga0150983_16412028 | Not Available | 626 | Open in IMG/M |
| 3300011270|Ga0137391_10624559 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300012189|Ga0137388_10072404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2876 | Open in IMG/M |
| 3300012202|Ga0137363_10411106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
| 3300012361|Ga0137360_10668689 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300012361|Ga0137360_11131538 | Not Available | 676 | Open in IMG/M |
| 3300012469|Ga0150984_100962453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300012582|Ga0137358_10094011 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
| 3300012924|Ga0137413_10019803 | All Organisms → cellular organisms → Bacteria | 3517 | Open in IMG/M |
| 3300012929|Ga0137404_10668558 | Not Available | 938 | Open in IMG/M |
| 3300012930|Ga0137407_10018104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5218 | Open in IMG/M |
| 3300012957|Ga0164303_10031016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2193 | Open in IMG/M |
| 3300012986|Ga0164304_10764072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300013296|Ga0157374_11147138 | Not Available | 798 | Open in IMG/M |
| 3300014169|Ga0181531_10204885 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300014489|Ga0182018_10005120 | All Organisms → cellular organisms → Bacteria | 10680 | Open in IMG/M |
| 3300014495|Ga0182015_10020336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5443 | Open in IMG/M |
| 3300014501|Ga0182024_10013273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16122 | Open in IMG/M |
| 3300014501|Ga0182024_10188122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2842 | Open in IMG/M |
| 3300014501|Ga0182024_12838171 | Not Available | 515 | Open in IMG/M |
| 3300020004|Ga0193755_1223490 | Not Available | 522 | Open in IMG/M |
| 3300020170|Ga0179594_10145940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300020199|Ga0179592_10461247 | Not Available | 548 | Open in IMG/M |
| 3300020579|Ga0210407_10074051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2559 | Open in IMG/M |
| 3300020580|Ga0210403_10000555 | All Organisms → cellular organisms → Bacteria | 38463 | Open in IMG/M |
| 3300020580|Ga0210403_10148404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1917 | Open in IMG/M |
| 3300020581|Ga0210399_11435258 | Not Available | 538 | Open in IMG/M |
| 3300020583|Ga0210401_10009177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9752 | Open in IMG/M |
| 3300020583|Ga0210401_10020226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6400 | Open in IMG/M |
| 3300020583|Ga0210401_10697756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300020583|Ga0210401_11546998 | Not Available | 520 | Open in IMG/M |
| 3300021168|Ga0210406_10151832 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
| 3300021168|Ga0210406_10666376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
| 3300021170|Ga0210400_10125333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2053 | Open in IMG/M |
| 3300021178|Ga0210408_10583287 | Not Available | 886 | Open in IMG/M |
| 3300021180|Ga0210396_10267833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1516 | Open in IMG/M |
| 3300021401|Ga0210393_10027067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4474 | Open in IMG/M |
| 3300021401|Ga0210393_10053352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3180 | Open in IMG/M |
| 3300021407|Ga0210383_11089337 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300021420|Ga0210394_11562007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300021432|Ga0210384_10597364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300021433|Ga0210391_11427878 | Not Available | 532 | Open in IMG/M |
| 3300021474|Ga0210390_11143951 | Not Available | 630 | Open in IMG/M |
| 3300021477|Ga0210398_10142891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1946 | Open in IMG/M |
| 3300021478|Ga0210402_10809580 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300021478|Ga0210402_11852069 | Not Available | 529 | Open in IMG/M |
| 3300022504|Ga0242642_1054620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300022529|Ga0242668_1037948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300022533|Ga0242662_10159761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300022557|Ga0212123_10001402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 67131 | Open in IMG/M |
| 3300022557|Ga0212123_10004998 | All Organisms → cellular organisms → Bacteria | 24120 | Open in IMG/M |
| 3300022557|Ga0212123_10720957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300022709|Ga0222756_1081683 | Not Available | 529 | Open in IMG/M |
| 3300022717|Ga0242661_1097190 | Not Available | 612 | Open in IMG/M |
| 3300025906|Ga0207699_11353342 | Not Available | 527 | Open in IMG/M |
| 3300025941|Ga0207711_10026800 | All Organisms → cellular organisms → Bacteria | 4837 | Open in IMG/M |
| 3300026281|Ga0209863_10039652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1410 | Open in IMG/M |
| 3300027528|Ga0208985_1004967 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
| 3300027648|Ga0209420_1004618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5664 | Open in IMG/M |
| 3300027889|Ga0209380_10042935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2563 | Open in IMG/M |
| 3300027908|Ga0209006_10433429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300028047|Ga0209526_10531285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300028906|Ga0308309_10276985 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300029636|Ga0222749_10215207 | Not Available | 966 | Open in IMG/M |
| 3300031057|Ga0170834_105923915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2227 | Open in IMG/M |
| 3300031231|Ga0170824_103994802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300031231|Ga0170824_117846834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2694 | Open in IMG/M |
| 3300031231|Ga0170824_128592032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300031474|Ga0170818_105959115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
| 3300031715|Ga0307476_10273597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1236 | Open in IMG/M |
| 3300031718|Ga0307474_10003680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11049 | Open in IMG/M |
| 3300031720|Ga0307469_10023479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3415 | Open in IMG/M |
| 3300031754|Ga0307475_10076511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2570 | Open in IMG/M |
| 3300031823|Ga0307478_10442614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 1080 | Open in IMG/M |
| 3300032174|Ga0307470_10055238 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300032180|Ga0307471_100280168 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300032421|Ga0310812_10308764 | Not Available | 704 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.08% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.88% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 5.04% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.36% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.52% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.52% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.68% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.68% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.84% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.84% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12630J15595_101160411 | 3300001545 | Forest Soil | MTMKXVIAPLTLVSLAVLLVYTEPHIPCVVMVLAKFAGHVSL* |
| JGI12635J15846_100389823 | 3300001593 | Forest Soil | MTMKMVIAPLTLVSLAVLLVYAEPHLPCVVMILAKFAGHVSL* |
| JGIcombinedJ26739_1001624602 | 3300002245 | Forest Soil | MAMKMVIAPLTLVSLAVLLVYTEPHISCVVMVLAKLAGHVSL* |
| JGIcombinedJ26739_1001654041 | 3300002245 | Forest Soil | MTMKLVIAPLTLVSLAVLLVYTEPHIPCVVMVLAKFAGHV |
| JGIcombinedJ26739_1018103742 | 3300002245 | Forest Soil | MTVKMVIVPLTFVSFTALLVYTQPHISCVVMVLARLATHVSL* |
| C688J35102_1209792622 | 3300002568 | Soil | MAMKLVIAPLAFVSLVAVFVYTQPHISCVMMVLAKFVGYVSL* |
| Ga0062385_112434841 | 3300004080 | Bog Forest Soil | MAMKMVIAPMTFVSLAVLLVYTQPHIPCVVMALAKLAGHVSL* |
| Ga0062389_1000989452 | 3300004092 | Bog Forest Soil | MTMKMVIAPMTFVSLALLLAYTQPHIPCVVMALAKLAGHVSL* |
| Ga0062386_1014373392 | 3300004152 | Bog Forest Soil | MTMKMVIAPMTFVSLAVLLVYTQPHISCVVMALAKLAGHVSL* |
| Ga0063455_1006376792 | 3300004153 | Soil | MAMKLVIAPLAFVSLVAVFVYTQPHISCVMMVLAKFVGYV |
| Ga0062594_1004585662 | 3300005093 | Soil | MNMKTVIAPLSFVSLAGLLVYAQPHIPCVVMALAKFAGHVSL* |
| Ga0066673_102134421 | 3300005175 | Soil | MIMKLVIAKLTFVSLAVLIVYTESHIPCAIMGLAKFAGRLLL* |
| Ga0070709_105204822 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLKTVIAPLTFAGLVALVVCMQPHIPCVVMVVAKFAGHVTL* |
| Ga0070709_112194122 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNMKLVIAPLAFVSLAALLVSTQPHISCVLMVLAKFAGHVSL* |
| Ga0070713_1000141825 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MFERESAMTLKTVIAPLTFAGLVALVVCMQPHIPCVVMVVAKFAGHVTL* |
| Ga0066687_101429053 | 3300005454 | Soil | MIMKLVIAKLTFVSLAVLLVYTESHIPCVIMGLAKFAGHLLL* |
| Ga0066699_112512822 | 3300005561 | Soil | VFGRVFFMIMKLVIAKLTFVSLAVLLVYAEPHIPCVIMGLAKFAGHLLL* |
| Ga0068855_1001947523 | 3300005563 | Corn Rhizosphere | MNMKTVIAPLSFVSLAGLLVYAQPHIPCVVMALAKLAGHVSL* |
| Ga0066705_105939711 | 3300005569 | Soil | MTMELVIAKLTFVSLAVLLVYAEPHIPCVIMGLAKFAGHLLL* |
| Ga0070762_105274331 | 3300005602 | Soil | MKMVIAPLAFVSLAVLLVYTEPHISCVVMVLAKFAGHVSL* |
| Ga0070764_109135562 | 3300005712 | Soil | MIMKMVIAPLTLVSLAVLLVYTEPHIPCVVMVLAKLAGHVSL* |
| Ga0070766_103747892 | 3300005921 | Soil | MKMKMVIVPLTFVSFAVFLGYTEPHTFCVVMVLAKLAGHMSL* |
| Ga0066788_100171672 | 3300005944 | Soil | MTMKMLLAPLTFVSLAVLFVYTQPHIPCVLMLLAKFAGHVSL* |
| Ga0080026_100093733 | 3300005952 | Permafrost Soil | MTMKMLLAPLTFVSLAVLFVYTQPHIPCVLMLLAKFAGRVSL* |
| Ga0066789_100137882 | 3300005994 | Soil | VFGREFLMTMKMLLAPLTFVSLAVLFVYTQPHIPCVLMLLAKFAGHVSL* |
| Ga0070716_1002996282 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GREFGVTMKLLIVPLTLVSLTALLVSTQPHISCVLMVLAKFAGHVSL* |
| Ga0070716_1008630411 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLKMVIAPLTFVSLAVLLVYTEPHIPCVLMVLAKLA |
| Ga0070765_1003036681 | 3300006176 | Soil | VFGTEFLMTMKMVIAPLAFVSLAVLLVYTEPHISCVVMVLAKFVGHVLL* |
| Ga0070765_1003999032 | 3300006176 | Soil | MTMKMLIAPLTFISLAALLVYTEPHISCVVIVLAKFAGHVSL* |
| Ga0070765_1021084191 | 3300006176 | Soil | MTMKMVIAPLTLVSLAVFLVYTEPHIPCVVMVLAKLAGHVSL* |
| Ga0097621_1008388872 | 3300006237 | Miscanthus Rhizosphere | MNMKTVIAPLSFVSLAGLLVYAQPHIPCVVMALAKFAGHVS |
| Ga0073928_1000357721 | 3300006893 | Iron-Sulfur Acid Spring | MTMRMLIAPLAFVSVGMLLVYTQPHIPCIVMALAKLAA* |
| Ga0073928_100860423 | 3300006893 | Iron-Sulfur Acid Spring | MTMKMVIAPLTFVSLAVLLVYTEPHIPCVVMLLAKFAGHVSL* |
| Ga0073928_103668812 | 3300006893 | Iron-Sulfur Acid Spring | MTMKMVIAPLTFASLAVLLVYTEPHISCLVMVLAKFAGHVSL* |
| Ga0075436_1002545782 | 3300006914 | Populus Rhizosphere | MKLLIVPLTLVSLTALLVSTQPHISCVLMVLAKFAGHVSL* |
| Ga0066709_1031545402 | 3300009137 | Grasslands Soil | MTMKMVIVPLSLLSLAALLVSSQPQMSCVLMVLAKFAEHVSL* |
| Ga0105237_111748321 | 3300009545 | Corn Rhizosphere | MNMKTVIAPLSFVSLAGLLVYAQPHIPCVVMALAKF |
| Ga0126352_10827271 | 3300010859 | Boreal Forest Soil | MKTKIVIAPLTFVSLAVFLVYTEPHIGCVVIVLAKLAGHMSF* |
| Ga0126344_10028363 | 3300010866 | Boreal Forest Soil | VFGREFLMKTKIVIAPLTFVSLAVFLVYTEPHIGCVVIVLAKLAGHMSF* |
| Ga0126344_13785481 | 3300010866 | Boreal Forest Soil | MTMKMVIAPLTFVSLAVLLVYTEPHISCVVMLLAKFAGHVSL* |
| Ga0150983_109534032 | 3300011120 | Forest Soil | GREFLMTMKMVIAPLTFLSLAALLVYTEPHISCVVMVLAKFVGHVLL* |
| Ga0150983_133982661 | 3300011120 | Forest Soil | EREPVVTMKLAIASLIFVSLAALLVYAQPHIPCVVIVLAKFAGEVSL* |
| Ga0150983_164120282 | 3300011120 | Forest Soil | VFGREFLMKTKIVIAPLTFVSLAVFLVYTEPHISCVVIVLAKLAGHMSL* |
| Ga0137391_106245592 | 3300011270 | Vadose Zone Soil | MTMKMVIAPLTFVSLAVLLVYTQPHISCVMMVLAKFAGHASL* |
| Ga0137388_100724044 | 3300012189 | Vadose Zone Soil | MKMVIAPLTFVSLAVLLAYTESHIPCVVMVLAKFAAHVSL* |
| Ga0137363_104111062 | 3300012202 | Vadose Zone Soil | MSMRMVIAPLTAISLAVLLAYRQPHISCVVMVLAKFVGHVSL* |
| Ga0137360_106686892 | 3300012361 | Vadose Zone Soil | MVIAPLTVISLAVLLAYTQPHISCVVMVLAKFVGHVSL* |
| Ga0137360_111315381 | 3300012361 | Vadose Zone Soil | MKLVIAPLTFAGLAALLAYTQPHITCVVMGLAKLAGQVSL* |
| Ga0150984_1009624532 | 3300012469 | Avena Fatua Rhizosphere | RKESPMAMKLVIAPLAFVSLVAVFVYTQPHISCVMMVLAKFVGYVSL* |
| Ga0137358_100940113 | 3300012582 | Vadose Zone Soil | MTMKMVIAPLTLVSLAVLLVYTGPHIPCVLMVLAKLASNVSL* |
| Ga0137413_100198033 | 3300012924 | Vadose Zone Soil | MSMRMVIAPLTVISLAVLLAYTEPHISCLVMVLAKFVGHVSL* |
| Ga0137404_106685581 | 3300012929 | Vadose Zone Soil | MTMKMVIAPLTIVSLAVLLAYTEPHIPCVVMVLAKFAGHVSL* |
| Ga0137407_100181045 | 3300012930 | Vadose Zone Soil | MVIAPLTAISLAVLLAYTQPHISCVVMVLAKFVGHVSL* |
| Ga0164303_100310163 | 3300012957 | Soil | MKLAIASLIFVSLAALLVYTQPHIPCVVIVLAKFAGEVSL* |
| Ga0164304_107640721 | 3300012986 | Soil | MKLVIAPLTFVSLAALLVYTQPHIPCVVIVLAKFAGQV |
| Ga0157374_111471381 | 3300013296 | Miscanthus Rhizosphere | ERESLMNMKTVIAPLSFVSLAGLLVYAQPHIPCVVMALAKFAGHVSL* |
| Ga0181531_102048852 | 3300014169 | Bog | MIMKMVIAPLTFVSLAVLLVYTAPHIPCVLMGLAKFAARGSV* |
| Ga0182018_100051208 | 3300014489 | Palsa | MKMVIAPLTLVSLAVLLVYAEPHIPCVVMILAKFAGHVSL* |
| Ga0182015_100203363 | 3300014495 | Palsa | MTMKMVIAPLTFVSLAVLLVYTEPHIPCVLMVLAKVAGHVSL* |
| Ga0182024_1001327310 | 3300014501 | Permafrost | MKMKMVIAPLTFVSLAVFFVYTEPHIPCVVIVLAKLAGHMSL* |
| Ga0182024_101881223 | 3300014501 | Permafrost | MTMKMLIAPLTFVSLAVLLVYTEPHISCVVMVLAKFAGHGAL* |
| Ga0182024_128381712 | 3300014501 | Permafrost | MVIAPLTFVSLAVLLVYTEPHISCVVMVLAKFVGHVSL* |
| Ga0193755_12234901 | 3300020004 | Soil | MTMKMVITPLTFVSLAVLLVYTEPYVSCVMMVLAKFAGYVSL |
| Ga0179594_101459401 | 3300020170 | Vadose Zone Soil | MVIAPLTAISLAVLLAYTQPHISCVVMVLAKFVGHVSL |
| Ga0179592_104612471 | 3300020199 | Vadose Zone Soil | MVIAPLTVISLAVLLAYTQPHISCVVMVLAKFVGHVSL |
| Ga0210407_100740514 | 3300020579 | Soil | MKMVMAPLTFVSLAVLLVYAEPHIPCVLMVLAKFAAHVPL |
| Ga0210403_100005554 | 3300020580 | Soil | MTMKMVMAPLTFVSLAVLLVYAEPHIPCVLMVLAKFAAHVPL |
| Ga0210403_101484045 | 3300020580 | Soil | MTMKMVIAPLTFVSLGVLFAYTQPHMPCVVMVLAKLAGHVSL |
| Ga0210399_114352581 | 3300020581 | Soil | MTMKMVIAPLTFLSLAALLVYTEPHISCVVIVLAKLAGHMSL |
| Ga0210401_100091772 | 3300020583 | Soil | MTMRILIAPLAFVSVGMLLVYTQPHIPCIVMALAKLAA |
| Ga0210401_100202264 | 3300020583 | Soil | MTMKMVIAPMTFVSLALLLAYTQPHIPCVVMALAKLAGHVSL |
| Ga0210401_106977561 | 3300020583 | Soil | TEFLMTTRMLIAPLAFVSVGMLLVYTQPHIPCIVMALAKLTA |
| Ga0210401_115469982 | 3300020583 | Soil | MTMKLVIAPLTFVSLAVLLVYTEPHIPCVVMVLAKFAGHVSL |
| Ga0210406_101518323 | 3300021168 | Soil | MTMKLVIAPLTFVSLAVLLVYTEPHIPCVVMVLAKLAGHVSL |
| Ga0210406_106663762 | 3300021168 | Soil | KIVIAPLTFISLAVFLVYTEPHISCVVIVLAKLAGHMSL |
| Ga0210400_101253332 | 3300021170 | Soil | MTMKMVIAPLTFLSLAALLVYTEPHISCVVMVLAKFVGHVLL |
| Ga0210408_105832872 | 3300021178 | Soil | MKMVMAPLTFVSLAVLLVYTEPHIPCVLMVLAKFAAHVPL |
| Ga0210396_102678333 | 3300021180 | Soil | FMMTMKMLIAPLTFVSVGVLLAYTQPHIPCVVMALAKLAGHVSL |
| Ga0210393_100270675 | 3300021401 | Soil | MKTKIVIAPLTFVSLAVFLVYTEPHISCVVIVLAKLAGHMSL |
| Ga0210393_100533523 | 3300021401 | Soil | MTMKMVIAPMTFVSLALLLVYTQPHIPCIVMALAKLAGHVSL |
| Ga0210383_110893372 | 3300021407 | Soil | MTVKIVIAPMTFVSLALLLAYTQPHIPCIVMALAKL |
| Ga0210394_115620072 | 3300021420 | Soil | VYGREFLMTMKMVIAPLTFGSLAALLVYTEPHISCVVMVLAKFVGHVLL |
| Ga0210384_105973642 | 3300021432 | Soil | MTTKMVIVPLTLAGLAVLLGYTEPHIPCVLMVLAKLAGLVSL |
| Ga0210391_114278781 | 3300021433 | Soil | VRVFGREFLMTMKMVIAPLTLVSLAVLLVYAEPHLPCVVMILAKFAGHVSL |
| Ga0210390_111439512 | 3300021474 | Soil | MMTMKMLIAPLTFVSVGVLLAYTQPHIPCVVMALAKLAGHVSL |
| Ga0210398_101428912 | 3300021477 | Soil | MKMKMVIVPLTLVSFAVFLGYTEPHTFCVVMVLAKLAGHMSL |
| Ga0210402_108095802 | 3300021478 | Soil | MTVKILIVPLTFVSLAGLLVYTQPHISCVVMVLTRLASHMSL |
| Ga0210402_118520692 | 3300021478 | Soil | MTLKMVIAPLTFAGLVALVVCMQPHIPCVVMVVAKFAGHVTL |
| Ga0242642_10546201 | 3300022504 | Soil | GREFLMIMKMVIAPLTFVSLAVLLVYTEPHIPCVVMVLAKFAGHVSL |
| Ga0242668_10379482 | 3300022529 | Soil | TEFMMTMKMLIAPLTFVSVGVLLAYTQPHIPCVVMALAKLAGHVSL |
| Ga0242662_101597612 | 3300022533 | Soil | TMKMLIAPLTFVSVGVLLAYTQPHIPCVVMALAKLAGHVSL |
| Ga0212123_1000140220 | 3300022557 | Iron-Sulfur Acid Spring | MTMKMVIAPLTFVSLAVLLVYTEPHIPCVVMLLAKFAGHVSL |
| Ga0212123_1000499820 | 3300022557 | Iron-Sulfur Acid Spring | MTMRMLIAPLAFVSVGMLLVYTQPHIPCIVMALAKLAA |
| Ga0212123_107209572 | 3300022557 | Iron-Sulfur Acid Spring | MKMVIAPLTFASLAVLLVYTEPHISCLVMVLAKFAGHVSL |
| Ga0222756_10816831 | 3300022709 | Soil | EFMMTMKMLIAPLTFVSVGVLLAYTQPHIPCVVMALAKLAGHVSL |
| Ga0242661_10971902 | 3300022717 | Soil | GTEFMMTMKMLIAPLTFVSVGVLLAYTQPHIPCVVMALAKLAGHVSL |
| Ga0207699_113533421 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNMKLVIAPLAFVSLAALLVSTQPHISCVLMVLAKF |
| Ga0207711_100268005 | 3300025941 | Switchgrass Rhizosphere | MNMKTVIAPLSFVSLAGLLVYAQPHIPCVVMALAKFAGHVSL |
| Ga0209863_100396523 | 3300026281 | Prmafrost Soil | LMTMKMLLAPLTFVSLAVLFVYTQPHIPCVLMLLAKFAGHVSL |
| Ga0208985_10049672 | 3300027528 | Forest Soil | MLEREFLMTMKMVIAPLTFVSLAALLVYTEPHISCLVMVLAKFAGHVSL |
| Ga0209420_10046182 | 3300027648 | Forest Soil | MTMKMVIAPLTLVSLAVLLVYAEPHLPCVVMILAKFAGHVSL |
| Ga0209380_100429352 | 3300027889 | Soil | MTMKMVIAPLAFVSLAVLLVYTEPHISCVVMVLAKFAGHVSL |
| Ga0209006_104334292 | 3300027908 | Forest Soil | VFGTEFIMIVKMLIAPLTFVSVGVLLVYTQPHIPCIVMALAKLAGHVSL |
| Ga0209526_105312851 | 3300028047 | Forest Soil | MAMKMVIAPLTLVSLAVLLVYTEPHISCVVMVLAKLAGHVLL |
| Ga0308309_102769852 | 3300028906 | Soil | MTMKMLIAPLTFISLAALLVYTEPHISCVVIVLAKFAGHVSL |
| Ga0222749_102152073 | 3300029636 | Soil | MIMKMVIAPLTFVSLAVLLVYTEPHIPCVVMVLAKLAGHVSL |
| Ga0170834_1059239152 | 3300031057 | Forest Soil | VFGTEFMMTMKMLIAPLTFVSVGVLLAYTQPHIPCVVMALAKLAGHVSL |
| Ga0170824_1039948023 | 3300031231 | Forest Soil | KTVVAPLTFAGLAALVVFMQPHISCVVMVVAKFAGHVTL |
| Ga0170824_1178468342 | 3300031231 | Forest Soil | MTMKMLIAPLTFVSVGVLLAYTQPHIPCVVMALAKLAGHVSL |
| Ga0170824_1285920322 | 3300031231 | Forest Soil | RVSGREFLMTMKMVIAPLTIVSLAVLLVYTEPHIPCVVIVLAKFAGHVSL |
| Ga0170818_1059591152 | 3300031474 | Forest Soil | RVSGREFLMTMKMVIAPLTIVSLAVLLVYTEPHIPCVVMVLAKFAGHVSL |
| Ga0307476_102735972 | 3300031715 | Hardwood Forest Soil | MRMKMAIAPLTLAGLAAFLVYTEPHIACVVIVLTKVAGHISL |
| Ga0307474_1000368010 | 3300031718 | Hardwood Forest Soil | MTMKMVIAPLAFVSLAGLLVYAQPHISCVVMVLAKLATHVSL |
| Ga0307469_100234791 | 3300031720 | Hardwood Forest Soil | MTMKMVIAPLTFVSLAVLLAYTEPHIPCVLMVLAKLAGHVSL |
| Ga0307475_100765113 | 3300031754 | Hardwood Forest Soil | MTMKMVIAPLTLVSLAVLLVYTGPHIPCVLMVLAKLASNVSL |
| Ga0307478_104426142 | 3300031823 | Hardwood Forest Soil | MKMAIAPLTLAGLAAFLVYTEPHIACVVIVLTKVAGHISL |
| Ga0307470_100552383 | 3300032174 | Hardwood Forest Soil | MKMVIAPLTFVSLAVLLFYTEPHIPCVLMVLAKLAGHVSL |
| Ga0307471_1002801682 | 3300032180 | Hardwood Forest Soil | VFGREFLMTMKMVIAPLTFVSLAVLLFYTEPHIPCVLMVLAKLAGHVSL |
| Ga0310812_103087641 | 3300032421 | Soil | MPMRMVITPLTFVSLAVLFVYTEPYIPCVMMVLAK |
| ⦗Top⦘ |