Basic Information | |
---|---|
Family ID | F075236 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 45 residues |
Representative Sequence | EQVLGMSSFAFGMLLIAAGVVAYLLNHAVKPEGWTPAPQEKPEAVA |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.84 % |
% of genes near scaffold ends (potentially truncated) | 96.64 % |
% of genes from short scaffolds (< 2000 bps) | 93.28 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.420 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.445 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.008 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.261 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.84% β-sheet: 0.00% Coil/Unstructured: 62.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF13411 | MerR_1 | 67.23 |
PF00850 | Hist_deacetyl | 7.56 |
PF06170 | DUF983 | 1.68 |
PF09537 | DUF2383 | 1.68 |
PF00376 | MerR | 1.68 |
PF09957 | VapB_antitoxin | 0.84 |
PF13194 | DUF4010 | 0.84 |
PF12158 | DUF3592 | 0.84 |
PF00365 | PFK | 0.84 |
PF00005 | ABC_tran | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 15.13 |
COG5349 | Uncharacterized conserved protein, DUF983 family | Function unknown [S] | 1.68 |
COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 50.42 % |
All Organisms | root | All Organisms | 49.58 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459015|G14TP7Y01DB0NO | Not Available | 660 | Open in IMG/M |
3300000567|JGI12270J11330_10049598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2260 | Open in IMG/M |
3300001593|JGI12635J15846_10467824 | Not Available | 749 | Open in IMG/M |
3300004082|Ga0062384_100099772 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
3300004092|Ga0062389_100435653 | Not Available | 1441 | Open in IMG/M |
3300004480|Ga0062592_101144980 | Not Available | 723 | Open in IMG/M |
3300004635|Ga0062388_101827871 | Not Available | 624 | Open in IMG/M |
3300005332|Ga0066388_103203187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 836 | Open in IMG/M |
3300005335|Ga0070666_11181007 | Not Available | 570 | Open in IMG/M |
3300005344|Ga0070661_100453431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1021 | Open in IMG/M |
3300005471|Ga0070698_100989589 | Not Available | 788 | Open in IMG/M |
3300005529|Ga0070741_11431764 | Not Available | 573 | Open in IMG/M |
3300005534|Ga0070735_10640311 | Not Available | 629 | Open in IMG/M |
3300005538|Ga0070731_10369566 | Not Available | 953 | Open in IMG/M |
3300005541|Ga0070733_10053486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2529 | Open in IMG/M |
3300005542|Ga0070732_10650564 | Not Available | 641 | Open in IMG/M |
3300005542|Ga0070732_11035523 | Not Available | 502 | Open in IMG/M |
3300005545|Ga0070695_100881817 | Not Available | 721 | Open in IMG/M |
3300005563|Ga0068855_100217846 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
3300005575|Ga0066702_10702379 | Not Available | 603 | Open in IMG/M |
3300005712|Ga0070764_10108305 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1492 | Open in IMG/M |
3300005842|Ga0068858_101774297 | Not Available | 610 | Open in IMG/M |
3300006028|Ga0070717_10506908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1091 | Open in IMG/M |
3300006041|Ga0075023_100562312 | Not Available | 524 | Open in IMG/M |
3300006162|Ga0075030_100074674 | All Organisms → cellular organisms → Bacteria | 2789 | Open in IMG/M |
3300006173|Ga0070716_100525436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 878 | Open in IMG/M |
3300006174|Ga0075014_100286137 | Not Available | 864 | Open in IMG/M |
3300006854|Ga0075425_100866807 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300006854|Ga0075425_102201836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300006860|Ga0063829_1286526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 604 | Open in IMG/M |
3300006914|Ga0075436_100108588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1936 | Open in IMG/M |
3300009098|Ga0105245_10872436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 941 | Open in IMG/M |
3300009177|Ga0105248_11139869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300009698|Ga0116216_10762823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300009700|Ga0116217_10717544 | Not Available | 618 | Open in IMG/M |
3300011110|Ga0138578_1132603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300012096|Ga0137389_11835289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300012930|Ga0137407_10266110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1558 | Open in IMG/M |
3300012944|Ga0137410_10514484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
3300012984|Ga0164309_10064535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2181 | Open in IMG/M |
3300012989|Ga0164305_12026074 | Not Available | 526 | Open in IMG/M |
3300013307|Ga0157372_11458243 | Not Available | 789 | Open in IMG/M |
3300014325|Ga0163163_11138716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
3300014745|Ga0157377_11506157 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300015261|Ga0182006_1260670 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300016319|Ga0182033_10901480 | Not Available | 783 | Open in IMG/M |
3300016319|Ga0182033_11193028 | Not Available | 682 | Open in IMG/M |
3300016404|Ga0182037_11302314 | Not Available | 640 | Open in IMG/M |
3300017955|Ga0187817_10116105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1692 | Open in IMG/M |
3300017955|Ga0187817_10325851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
3300017961|Ga0187778_10981522 | Not Available | 584 | Open in IMG/M |
3300017961|Ga0187778_11266852 | Not Available | 518 | Open in IMG/M |
3300017995|Ga0187816_10270466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300017995|Ga0187816_10546501 | Not Available | 522 | Open in IMG/M |
3300018001|Ga0187815_10113441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
3300018006|Ga0187804_10257157 | Not Available | 755 | Open in IMG/M |
3300018033|Ga0187867_10649194 | Not Available | 576 | Open in IMG/M |
3300018062|Ga0187784_10350121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1197 | Open in IMG/M |
3300018085|Ga0187772_10144626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
3300018090|Ga0187770_11329518 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinales incertae sedis → ANME-2 cluster → unclassified ANME-2 cluster → ANME-2 cluster archaeon | 583 | Open in IMG/M |
3300018090|Ga0187770_11731226 | Not Available | 511 | Open in IMG/M |
3300018468|Ga0066662_11809274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300020022|Ga0193733_1142593 | Not Available | 652 | Open in IMG/M |
3300020579|Ga0210407_10774927 | Not Available | 741 | Open in IMG/M |
3300020581|Ga0210399_10637914 | Not Available | 879 | Open in IMG/M |
3300020581|Ga0210399_10658145 | Not Available | 863 | Open in IMG/M |
3300020582|Ga0210395_11078274 | Not Available | 593 | Open in IMG/M |
3300020583|Ga0210401_10004002 | All Organisms → cellular organisms → Bacteria | 15506 | Open in IMG/M |
3300021088|Ga0210404_10534444 | Not Available | 664 | Open in IMG/M |
3300021168|Ga0210406_11388421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300021170|Ga0210400_10126405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2044 | Open in IMG/M |
3300021420|Ga0210394_11064881 | Not Available | 698 | Open in IMG/M |
3300021433|Ga0210391_10524165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
3300021474|Ga0210390_10249837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1502 | Open in IMG/M |
3300021479|Ga0210410_11232205 | Not Available | 640 | Open in IMG/M |
3300021559|Ga0210409_10479311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1106 | Open in IMG/M |
3300021559|Ga0210409_11187765 | Not Available | 638 | Open in IMG/M |
3300024330|Ga0137417_1056427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1189 | Open in IMG/M |
3300025711|Ga0207696_1198420 | Not Available | 527 | Open in IMG/M |
3300025899|Ga0207642_10089739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1515 | Open in IMG/M |
3300025903|Ga0207680_11327022 | Not Available | 511 | Open in IMG/M |
3300025913|Ga0207695_10464191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1149 | Open in IMG/M |
3300025916|Ga0207663_11733155 | Not Available | 502 | Open in IMG/M |
3300025939|Ga0207665_10222658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1383 | Open in IMG/M |
3300025941|Ga0207711_12102701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300025945|Ga0207679_11278977 | Not Available | 673 | Open in IMG/M |
3300025949|Ga0207667_10425252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1351 | Open in IMG/M |
3300026318|Ga0209471_1243424 | Not Available | 626 | Open in IMG/M |
3300027076|Ga0208860_1023810 | Not Available | 628 | Open in IMG/M |
3300027432|Ga0209421_1027849 | Not Available | 1100 | Open in IMG/M |
3300027535|Ga0209734_1105566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
3300027660|Ga0209736_1111132 | Not Available | 741 | Open in IMG/M |
3300027842|Ga0209580_10290799 | Not Available | 813 | Open in IMG/M |
3300027875|Ga0209283_10716101 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300027882|Ga0209590_10244566 | Not Available | 1143 | Open in IMG/M |
3300027895|Ga0209624_10915136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300027895|Ga0209624_10995945 | Not Available | 543 | Open in IMG/M |
3300027905|Ga0209415_10666873 | Not Available | 753 | Open in IMG/M |
3300027911|Ga0209698_10349822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 1162 | Open in IMG/M |
3300028450|Ga0189898_1026461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 603 | Open in IMG/M |
3300028560|Ga0302144_10213078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300028673|Ga0257175_1069650 | Not Available | 665 | Open in IMG/M |
3300028828|Ga0307312_11110926 | Not Available | 523 | Open in IMG/M |
3300028906|Ga0308309_10701559 | Not Available | 879 | Open in IMG/M |
3300030862|Ga0265753_1030506 | Not Available | 868 | Open in IMG/M |
3300031708|Ga0310686_113968134 | Not Available | 503 | Open in IMG/M |
3300031718|Ga0307474_10067183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2658 | Open in IMG/M |
3300031718|Ga0307474_10426312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
3300031726|Ga0302321_101809385 | Not Available | 707 | Open in IMG/M |
3300031754|Ga0307475_10987619 | Not Available | 662 | Open in IMG/M |
3300031823|Ga0307478_10490846 | Not Available | 1023 | Open in IMG/M |
3300032174|Ga0307470_10281038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1118 | Open in IMG/M |
3300032174|Ga0307470_10660075 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300032180|Ga0307471_100246190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1836 | Open in IMG/M |
3300032892|Ga0335081_10489334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1551 | Open in IMG/M |
3300032893|Ga0335069_11110535 | Not Available | 871 | Open in IMG/M |
3300033289|Ga0310914_10765692 | Not Available | 863 | Open in IMG/M |
3300033433|Ga0326726_10495743 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300033433|Ga0326726_12279733 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.45% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.88% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.04% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.04% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.04% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.04% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.36% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.52% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.68% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.68% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.84% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028450 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4PV_01932870 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | EQVLGISAFAFGMLLIAAGAVAYFLNVTLKPSGWSTAPDKPEPVA |
JGI12270J11330_100495981 | 3300000567 | Peatlands Soil | FAFGMILIAAGVVAYLLNITLKPQGWAPTQKEHLATD* |
JGI12635J15846_104678242 | 3300001593 | Forest Soil | GMSSFAFGILLIAAGVVAYLLNHALRPEGWTPQEKPEAVA* |
Ga0062384_1000997723 | 3300004082 | Bog Forest Soil | SETEQVLGMSSFAFGMLLIVAGVVAYFLNHALKPEGWTPATVEKPEAVA* |
Ga0062389_1004356531 | 3300004092 | Bog Forest Soil | LGMSSFAFGMLLIVAGVVAYFLNHALKPEGWTPAVSEKPEVVA* |
Ga0062592_1011449801 | 3300004480 | Soil | SEYVLGISAFAFGMLLIAAGVVAYFLNVTLKPSGWSTAPDKPEPVA* |
Ga0062388_1018278712 | 3300004635 | Bog Forest Soil | QVMGMSSFAFGMILIAAGVVAYFVNHAVKPQGWTAPTPKKPEALA* |
Ga0066388_1032031872 | 3300005332 | Tropical Forest Soil | VLGMSSFALGMLLIAGGAVAYFLNHQLKPQGWAPARETPQATV* |
Ga0070666_111810071 | 3300005335 | Switchgrass Rhizosphere | SEHVLGISAFAFGMLLIAAGVVAYFVNVALKPAGWGATPEKPEPVA* |
Ga0070661_1004534311 | 3300005344 | Corn Rhizosphere | FSVVRNQSEHVLGISAFAFGMLLIAAGVVAYFLNVALKPAGWGATPEKPEPVA* |
Ga0070698_1009895891 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | EQVLGMSSFAFGMLLIGAGVLAYVLNLALKPAGWAPVAEKP* |
Ga0070741_114317642 | 3300005529 | Surface Soil | FSVIRSQHEQVFGMSSFAFGVILIAAGIVAYLVNTALKPTGWAQVADKPEPVA* |
Ga0070735_106403111 | 3300005534 | Surface Soil | IRSETEQVLGMSSFAFGMLLIAAGVVAYLLNHALKPEGWAPAPQEKPEAAA* |
Ga0070731_103695664 | 3300005538 | Surface Soil | ESAQVLGISALAFGLLLMAAGGVAYFVNVTLKPGGWSSASEKPEPVA* |
Ga0070733_100534863 | 3300005541 | Surface Soil | VIHSETEQVLGMSSFAFGMLLIAAGVVAYLVNHALKPEGWAPAPQEKPEAVA* |
Ga0070732_106505641 | 3300005542 | Surface Soil | SETEQVLGMSSFAFGMLLIAVGVLAYILNHALKPAGWAPPAGEKPEVA* |
Ga0070732_110355231 | 3300005542 | Surface Soil | VFRSEHESVFGMSSFAFGLLLIGAGVLAYLVNHAVKPEGWTARAEKAQTA* |
Ga0070695_1008818172 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LRSQSEQVLGISAFAFGMLLIAAGAVAYFLNVTLKPSGWSTAPDKPEPVA* |
Ga0068855_1002178464 | 3300005563 | Corn Rhizosphere | VLRSQSEQVLGISAFAFGMLLIAAGAVAYFLNVTLKPSGWSTAPDKPEPVA* |
Ga0066702_107023792 | 3300005575 | Soil | RSQTEQVLGMSSFAFGMILIGAGVVTYALNVALKPTGWAPEKPGTAS* |
Ga0070764_101083051 | 3300005712 | Soil | FGMILIAAGVVAYFLNHALKPQGWAAAPKKPEAIA* |
Ga0068858_1017742971 | 3300005842 | Switchgrass Rhizosphere | EHVLGISAFAFGMLLIAAGVVAYFVNVALKPAGWGATPEKPEPVA* |
Ga0070717_105069081 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RSQHEQVLGMSSFAFGMLLIGAGVLAYVLNLALKPAGWAPVAEKP* |
Ga0075023_1005623121 | 3300006041 | Watersheds | GFSIVRSQHEQVLGISSFAFGMLLIAAGVLAYVVNLTLKPTGWAPVAEKP* |
Ga0075030_1000746745 | 3300006162 | Watersheds | RSQHEQVLGISSFAFGMLLIAAGVVAYVLNLTLKPAGWAPVTEEP* |
Ga0070716_1005254363 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HEQVLGMSSFAFGMLLIAAGVLAYVLNLALKPTGWAPVAERP* |
Ga0075014_1002861373 | 3300006174 | Watersheds | AFGMLLMGAGIVAYALMHAVKPEGWAPSAEKPQEA* |
Ga0075425_1008668071 | 3300006854 | Populus Rhizosphere | SQHEQVLGISSFAFGMLLIAAGVLAYFLNLTLKPTGWAPVVEKS* |
Ga0075425_1022018361 | 3300006854 | Populus Rhizosphere | FAIVRSQHEQVLGMSSFAFGMILMATGVAAYYLNTTLKPHGWTIPAEKTEPAVS* |
Ga0063829_12865261 | 3300006860 | Peatlands Soil | FAFGMLLIAAGVVAYLLNHAVKPEGWTPAPQEKPEAVA* |
Ga0075436_1001085881 | 3300006914 | Populus Rhizosphere | EQVLGISAFAFWMLLIAAGAVAYFLNVTLKPSGWSTEPDKPEPVA* |
Ga0105245_108724361 | 3300009098 | Miscanthus Rhizosphere | RSQSEHALGISAFAFGMLLLAAGVVAYFVNVALKPSGWDAATDNPEPVA* |
Ga0105248_111398691 | 3300009177 | Switchgrass Rhizosphere | AIVRSQHEQVLGMSSFAFGMILMATGVAAYYLNTTLKPHGWTIPAEKTEPAVS* |
Ga0116216_107628231 | 3300009698 | Peatlands Soil | TEQVLGMSSFAFGMLLIAAGVVAYFLNYAIKPEGWAPSPQEKPEAVA* |
Ga0116217_107175441 | 3300009700 | Peatlands Soil | SETEQVWGMSSFAFGMILIGAGVVAYLLNHAVKPEGWTASTKKPEPVA* |
Ga0138578_11326031 | 3300011110 | Peatlands Soil | EQVLGMSSFAFGMLLIAAGVVAYLLNHAVKPEGWTPAPQEKPEAVA* |
Ga0137389_118352892 | 3300012096 | Vadose Zone Soil | VLGISSFAFGMLLIGAGVLAYFLNLTLKPAGWAQVAEKP* |
Ga0137407_102661101 | 3300012930 | Vadose Zone Soil | GFSIVRSQHEQVLGMSSFAFGMLLIGAGVLAYFLNLALKPAGWAPAAEKP* |
Ga0137410_105144841 | 3300012944 | Vadose Zone Soil | SSFAFGMLLIGAGVLAYVLNLALKPAGWAPVAEKP* |
Ga0164309_100645351 | 3300012984 | Soil | DKESLRQHETVFGMSSFAFGMVLMAAGVMAYGVNHLLKPGGWSSATAEKPQIVA* |
Ga0164305_120260741 | 3300012989 | Soil | EQVLGMSSFSFGMILIAAGVIAYALNFAFKPSGWGPAEKAEPVA* |
Ga0157372_114582432 | 3300013307 | Corn Rhizosphere | EEVFGMSSFAFGMILIGAGVLAYGLNHLLKPSGWARTDEKPPAIA* |
Ga0163163_111387163 | 3300014325 | Switchgrass Rhizosphere | AFGMLLIAAGVVAYFVNVALKPSGWDAATDKPEPVA* |
Ga0157377_115061572 | 3300014745 | Miscanthus Rhizosphere | RSQSEQVLGISAFAFGMLLIAAGAVAYFLNVTLKPSGWSTAPDKPEPVA* |
Ga0182006_12606702 | 3300015261 | Rhizosphere | SFAFGMILIAAGAVAYYLNKALKPEGWAATPLEKPEAAA* |
Ga0182033_109014801 | 3300016319 | Soil | QVLGMSSFELGMLLIAGGVVAYFLNHRLKPQGWAPVEQNPQATV |
Ga0182033_111930281 | 3300016319 | Soil | MILITAGVVAYLVNHTLKPEGWAPASQEKPEAAAYD |
Ga0182037_113023141 | 3300016404 | Soil | VFGMSSFAFGLLLIGAGVLAYLLNHVVKPEGWTASTEKAQTA |
Ga0187817_101161053 | 3300017955 | Freshwater Sediment | GMSSFAFGMLLIGAGVVAYFLNHVVKPQGWAPATKPEPAA |
Ga0187817_103258512 | 3300017955 | Freshwater Sediment | GMLLIVAGVVAYLLNHALKPEGWTPAPQEKPEAAT |
Ga0187778_109815221 | 3300017961 | Tropical Peatland | MSSFAFGMLLIAAGVVAYLLNHALRPAGWAPAPHEKPVT |
Ga0187778_112668522 | 3300017961 | Tropical Peatland | RSEHESVLGMSSFVFGMLLIAAGFVAYFLNTAVKPQGWSSAEERPQPVG |
Ga0187816_102704662 | 3300017995 | Freshwater Sediment | VVRSETEQVLGMSSFAFGMLLIAAGVVAYLLNHAVKPEGWTPAPQEKPEAAT |
Ga0187816_105465011 | 3300017995 | Freshwater Sediment | SQTEQVLGMSSFAFGMLLIAGGVVAYFLNHALKPQGWAPAVPEKPRVTA |
Ga0187815_101134412 | 3300018001 | Freshwater Sediment | CMSSFAFGMLLIAAGVVAYLLNHAVKPEGWTPAPQEKPEAAT |
Ga0187804_102571572 | 3300018006 | Freshwater Sediment | GMLLIAAGVLAYLLNHALKPEGWTPAPQEKPEAVA |
Ga0187867_106491941 | 3300018033 | Peatland | SSFAFGMLLIAAGVFAYFLNHALKPQGWTPAAVEKPEAVA |
Ga0187784_103501213 | 3300018062 | Tropical Peatland | VLGMSSFALGMLLIAGGVVAYFLNHQLKPQGWAPARENPQATV |
Ga0187772_101446261 | 3300018085 | Tropical Peatland | TEQVLGMSSFAFGMLLIAAGVVAYFLNHAVKPEGWAPAPQEKPVS |
Ga0187770_113295182 | 3300018090 | Tropical Peatland | MSSFAFGMLLIAAGVVAYFVNHALKPHGWKVSAEERPQPAA |
Ga0187770_117312262 | 3300018090 | Tropical Peatland | RSETEHVLGMTSFDLGMLLIAGGVVAYFLNHRLKPQGWAPAAENPPATV |
Ga0066662_118092742 | 3300018468 | Grasslands Soil | FRSEHETVFGMSSFAFGMILIGAGVVAYLLNHAIKPEGWTAEKPQAVA |
Ga0193733_11425931 | 3300020022 | Soil | VLGMSSFAFGMLLIAAGVLAYVLNLALKPTGWAPVAEKP |
Ga0210407_107749272 | 3300020579 | Soil | SVVRSETEQVLGMSSFAFGMLLIAAGVLAYFLNHAVKPQGWAPAAPKKPEALA |
Ga0210399_106379142 | 3300020581 | Soil | TEQVLGMSSFAFGMLLIAAGVVAYFFNHALKPEGWAPAPQEKPEAVA |
Ga0210399_106581453 | 3300020581 | Soil | EHESVLGMSSFAFGMLLIGAGIVAYALMHAVKPEGWAPSAEKPQAA |
Ga0210395_110782741 | 3300020582 | Soil | IFRSEHESILGMSSFAFGLLLIGAGVVAYLLNHAVKPEGWAAQAEKAQTA |
Ga0210401_1000400213 | 3300020583 | Soil | VIHSETEQVLGMSSFAFGMLLIAAGVVAYLVNHALKPEGWAPAPQEKPEAVA |
Ga0210404_105344441 | 3300021088 | Soil | ESAQVLGMSALAFGLLLIAAGVVAYFVNVTLKPTGWGAASEKPEPVA |
Ga0210406_113884211 | 3300021168 | Soil | QTEQVLGMSSFAFGMLLIAAGVLAYFFNHALKPEGWAPAQQEKPEAVA |
Ga0210400_101264054 | 3300021170 | Soil | ETEQVLGMSSFAFGMLLIAAGVVAYLLNHALKPEGWAPSPQKKPEVVA |
Ga0210394_110648812 | 3300021420 | Soil | FSVIRSETEQVLGMSSFAFGMLLIAAGVLAYVLNHALKPEGWAPAAQEKPGVVA |
Ga0210391_105241653 | 3300021433 | Soil | TEQVLGMSSFAFGMLLIAAGVVAYFLNHAVKPQGWAAASPKKPEAIA |
Ga0210390_102498374 | 3300021474 | Soil | VLGMSSFAFGMLLIAAGVVAYFLNHALKPEGWTPAPQEKPAA |
Ga0210410_112322051 | 3300021479 | Soil | FAFGMLLIAAGVVAYLLNHAVRPEGWAPAPQEKPEALA |
Ga0210409_104793111 | 3300021559 | Soil | SALAFGLLLIAAGVVAYFVNVTLKPTGWGAASEKPEPVA |
Ga0210409_111877652 | 3300021559 | Soil | SVVRSETEQVLGMSSFAFGMLLIGAGVLAYLLNHALKPEGWTPAPQEKPEAVA |
Ga0137417_10564273 | 3300024330 | Vadose Zone Soil | QHEQVLGMSSFAFGMLLIGAGVLAYVLNLALKPAGWAPVAEKP |
Ga0207696_11984201 | 3300025711 | Switchgrass Rhizosphere | AFGMLLIAAGAVAYFLNVTLKPSGWSTAPDKPEPVA |
Ga0207642_100897393 | 3300025899 | Miscanthus Rhizosphere | SVLRSQSEHVLGISAFAFGMLLIAAGVVAYFLNITLKPSGWSTAPDKPEPVA |
Ga0207680_113270221 | 3300025903 | Switchgrass Rhizosphere | HVLGISAFAFGMLLIAAGVVAYFVNVALKPAGWGATPEKPEPVA |
Ga0207695_104641913 | 3300025913 | Corn Rhizosphere | ISAFAFGMLLIAAGVVAYFVNVALKPSGWDAATDKPEPVA |
Ga0207663_117331551 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QSEHVLGISALAFGMLLIAAGVVAYFVNVALKPAGWGTATDKPEPIA |
Ga0207665_102226581 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VRSQHEQVLGMSSFAFGMLLIAAGVLAYVLNLALKPTGWAPVAERP |
Ga0207711_121027012 | 3300025941 | Switchgrass Rhizosphere | MPVAFGMLLIAAGVVAYFVNVALKPSGWDAATDKPEPVA |
Ga0207679_112789771 | 3300025945 | Corn Rhizosphere | SVLRSQSEQVLGISAFAFGMLLIAAGAVAYFLNVTLKPSGWSTAPDKPEPVA |
Ga0207667_104252523 | 3300025949 | Corn Rhizosphere | SAFAFGMLLIAAGAVAYFLNVTLKPSGWSTAPDKPEPVA |
Ga0209471_12434242 | 3300026318 | Soil | FSVVRSQTEQVLGMSSFAFGMVLIGAGVAAYALNIAIKPSGWTPQEKTEPAA |
Ga0208860_10238102 | 3300027076 | Forest Soil | SFAFGMLLIAAGVLAYLLNHALKPEGWTPAPQEKPEAVA |
Ga0209421_10278491 | 3300027432 | Forest Soil | SETEQVLGMSSFAFGMLLIAAGVVAYFLNYAIKPEGWTPAAQEKPEAVA |
Ga0209734_11055662 | 3300027535 | Forest Soil | ALAFGLLLIAAGVVAYFVNVTLKPTGWGAASEKPEPVA |
Ga0209736_11111322 | 3300027660 | Forest Soil | GMSSFAFGILLIAAGVVAYLLNHALRPEGWTPQEKPEAVA |
Ga0209580_102907993 | 3300027842 | Surface Soil | SETEQVLGMSSFAFGMLLIAVGVLAYILNHALKPAGWAPPAGEKPEVA |
Ga0209283_107161012 | 3300027875 | Vadose Zone Soil | VRSQNEQVLGMSSFAFGMLLIAAGLVAYFLNHTLKPEGWTVRAKEKPQPAA |
Ga0209590_102445663 | 3300027882 | Vadose Zone Soil | SQNEQVLGMSSFAFGMLLIAAGLVAYFLNHTLKPEGWTVRAKERPQPAA |
Ga0209624_109151362 | 3300027895 | Forest Soil | FAFGMLLIAAGVVAYFLNHALKPEGWTPAPQEKPEAVA |
Ga0209624_109959452 | 3300027895 | Forest Soil | MSSFAFGMLLIAAGVVAYLLNHALKPEGWTPAPQEKPEPAA |
Ga0209415_106668732 | 3300027905 | Peatlands Soil | ETEKILGMSSFAFGMLLIAAGVLAYFLNLAVKPQGWAATPKKPEAIA |
Ga0209698_103498222 | 3300027911 | Watersheds | SSFAFGMILIGAGVVAHLLNHAVKPEGWTPAPQEKPGAVA |
Ga0189898_10264612 | 3300028450 | Peatlands Soil | FAFGMLLIAAGVVAYLLNHAVKPEGWTPAPQEKPEAVA |
Ga0302144_102130781 | 3300028560 | Bog | DVVLGMSSFAFAVLVIAAGVVAYLVNHALKPSGWAPAPSKPEMVA |
Ga0257175_10696501 | 3300028673 | Soil | QHEQVLGISSFAFGMMLIAAGVLAYVLNHAVKPAGWAPVAEKP |
Ga0307312_111109261 | 3300028828 | Soil | FSIVRSQHEEVFGMSSFAFGMILMGAGVVAYGLNHALKPSGWARTDEKPQAIA |
Ga0308309_107015591 | 3300028906 | Soil | GMSSFAFGMLLIAAGVVAYLLNHAVKPEGWAPAPQEKPEAIA |
Ga0265753_10305063 | 3300030862 | Soil | SVVRSETEQVLGISSFAFGMLLIAAGVVAYLLNHAVKPEGWTPAPQEKPEAVA |
Ga0310686_1139681342 | 3300031708 | Soil | SETEQVLGMSSFAFGMLLIAAGVVAYLLNHAVKPEGWAPAPQEKPEAIA |
Ga0307474_100671834 | 3300031718 | Hardwood Forest Soil | ETVAGMSSFAFGMILMAAGVVAYGLNHALKPGGWAPGTEKPQPAA |
Ga0307474_104263123 | 3300031718 | Hardwood Forest Soil | QVLGMSSFAFGMLLIAAGVFAYFLNHALKPQGWTPAAVEKPEAVA |
Ga0302321_1018093851 | 3300031726 | Fen | SQTEQVLGMSSFAFGMLLMAAGVVAYFVNYALKPQGWTPAEKPEPAS |
Ga0307475_109876192 | 3300031754 | Hardwood Forest Soil | TEQVLGMSSFAFGMLLIAAGVVAYLLNHALKPEGWTPAPHEKPEAAA |
Ga0307478_104908461 | 3300031823 | Hardwood Forest Soil | IVRSQHEEVLGMSSFAFGMLLIGAGIVAYGLMHAVKPEGWAPSAEKPQAA |
Ga0307470_102810381 | 3300032174 | Hardwood Forest Soil | ETVFGMSSFAFGMILVAAGVVAYGLNHLLKPDGWTPATAEKPRFTA |
Ga0307470_106600751 | 3300032174 | Hardwood Forest Soil | FGMLLVAAGVVAYFLNLAVKPQGWTATPKKPEAIA |
Ga0307471_1002461901 | 3300032180 | Hardwood Forest Soil | SAFAFGMLLIAAGVVAYFLNVTLKPSGWSAAPDKPEPVA |
Ga0335081_104893341 | 3300032892 | Soil | SEQVLGMSSFAFGMLLIAAGVVAYAISVALKPSGWSIPAKPKAGTAA |
Ga0335069_111105353 | 3300032893 | Soil | GESAHVLGISALAFGLLLIAAGVVAYFVNVTLKPEGWGVASEKPEPVA |
Ga0310914_107656923 | 3300033289 | Soil | MSSFALGMLLIAGGVVAYFLNHQLKPQGWAPARENPQATV |
Ga0326726_104957431 | 3300033433 | Peat Soil | SFAFGMWLIAAGVLAYFLNVALKPTGWAQPTEKHGTAT |
Ga0326726_122797332 | 3300033433 | Peat Soil | QVLGMSSFSFGMLLIAAGVVAYWLNLALKPEGWARSVEKTEPIA |
⦗Top⦘ |