| Basic Information | |
|---|---|
| Family ID | F075227 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VADADLVTSLRQAGVNRGDLVGLVISPALGFGLATADRAWP |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 98.29 % |
| % of genes near scaffold ends (potentially truncated) | 98.32 % |
| % of genes from short scaffolds (< 2000 bps) | 90.76 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.261 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.252 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.092 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.697 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.14% β-sheet: 20.29% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00579 | tRNA-synt_1b | 26.05 |
| PF00356 | LacI | 9.24 |
| PF00528 | BPD_transp_1 | 9.24 |
| PF13377 | Peripla_BP_3 | 3.36 |
| PF00496 | SBP_bac_5 | 1.68 |
| PF00532 | Peripla_BP_1 | 1.68 |
| PF00933 | Glyco_hydro_3 | 0.84 |
| PF02627 | CMD | 0.84 |
| PF12697 | Abhydrolase_6 | 0.84 |
| PF03795 | YCII | 0.84 |
| PF08530 | PepX_C | 0.84 |
| PF01547 | SBP_bac_1 | 0.84 |
| PF03466 | LysR_substrate | 0.84 |
| PF13936 | HTH_38 | 0.84 |
| PF12840 | HTH_20 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 26.05 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 26.05 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.84 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.84 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.84 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.26 % |
| All Organisms | root | All Organisms | 48.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10110393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1310 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10284928 | Not Available | 672 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10358781 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300004091|Ga0062387_101163542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300004092|Ga0062389_103263874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300005439|Ga0070711_101853908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300005536|Ga0070697_102093100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300005577|Ga0068857_101711470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 615 | Open in IMG/M |
| 3300006028|Ga0070717_11196948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
| 3300006173|Ga0070716_100792951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 733 | Open in IMG/M |
| 3300006174|Ga0075014_100829394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 548 | Open in IMG/M |
| 3300006237|Ga0097621_102005737 | Not Available | 553 | Open in IMG/M |
| 3300009137|Ga0066709_102836322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
| 3300009520|Ga0116214_1086116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
| 3300009672|Ga0116215_1309062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300009683|Ga0116224_10461983 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300009700|Ga0116217_10965700 | Not Available | 522 | Open in IMG/M |
| 3300010379|Ga0136449_100848230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1500 | Open in IMG/M |
| 3300010869|Ga0126359_1436680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
| 3300010877|Ga0126356_11070010 | Not Available | 966 | Open in IMG/M |
| 3300012209|Ga0137379_11132315 | Not Available | 688 | Open in IMG/M |
| 3300012356|Ga0137371_10366484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1119 | Open in IMG/M |
| 3300012363|Ga0137390_10984517 | Not Available | 796 | Open in IMG/M |
| 3300012685|Ga0137397_11135773 | Not Available | 567 | Open in IMG/M |
| 3300012958|Ga0164299_10644437 | Not Available | 732 | Open in IMG/M |
| 3300013102|Ga0157371_11413243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300014200|Ga0181526_10333681 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300014968|Ga0157379_10547194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1077 | Open in IMG/M |
| 3300015264|Ga0137403_10165675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2165 | Open in IMG/M |
| 3300016357|Ga0182032_10145604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1745 | Open in IMG/M |
| 3300016357|Ga0182032_10616037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 904 | Open in IMG/M |
| 3300016387|Ga0182040_10160646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1612 | Open in IMG/M |
| 3300016404|Ga0182037_11457620 | Not Available | 606 | Open in IMG/M |
| 3300016422|Ga0182039_10152779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1790 | Open in IMG/M |
| 3300017821|Ga0187812_1181600 | Not Available | 674 | Open in IMG/M |
| 3300017924|Ga0187820_1194145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
| 3300017966|Ga0187776_11369890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 538 | Open in IMG/M |
| 3300017972|Ga0187781_10633102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 772 | Open in IMG/M |
| 3300017973|Ga0187780_10835803 | Not Available | 667 | Open in IMG/M |
| 3300017974|Ga0187777_11255469 | Not Available | 543 | Open in IMG/M |
| 3300018007|Ga0187805_10098433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1322 | Open in IMG/M |
| 3300018468|Ga0066662_11206287 | Not Available | 766 | Open in IMG/M |
| 3300020583|Ga0210401_11525207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300021180|Ga0210396_11411791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300021404|Ga0210389_10577880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 883 | Open in IMG/M |
| 3300021405|Ga0210387_10235141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1599 | Open in IMG/M |
| 3300021420|Ga0210394_10747594 | Not Available | 856 | Open in IMG/M |
| 3300024227|Ga0228598_1124671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
| 3300025905|Ga0207685_10368586 | Not Available | 729 | Open in IMG/M |
| 3300025906|Ga0207699_11063643 | Not Available | 599 | Open in IMG/M |
| 3300025906|Ga0207699_11420963 | Not Available | 513 | Open in IMG/M |
| 3300025912|Ga0207707_10346667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1280 | Open in IMG/M |
| 3300025928|Ga0207700_11391791 | Not Available | 624 | Open in IMG/M |
| 3300025929|Ga0207664_11850896 | Not Available | 526 | Open in IMG/M |
| 3300025981|Ga0207640_10396083 | Not Available | 1123 | Open in IMG/M |
| 3300026078|Ga0207702_10155340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2085 | Open in IMG/M |
| 3300027096|Ga0208099_1000292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5512 | Open in IMG/M |
| 3300027096|Ga0208099_1036467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
| 3300027504|Ga0209114_1012686 | Not Available | 1311 | Open in IMG/M |
| 3300027641|Ga0208827_1005335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5053 | Open in IMG/M |
| 3300027648|Ga0209420_1031750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica | 1646 | Open in IMG/M |
| 3300027662|Ga0208565_1241216 | Not Available | 506 | Open in IMG/M |
| 3300027676|Ga0209333_1018294 | Not Available | 2007 | Open in IMG/M |
| 3300027775|Ga0209177_10011151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2018 | Open in IMG/M |
| 3300027812|Ga0209656_10016715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4537 | Open in IMG/M |
| 3300027817|Ga0209112_10094163 | Not Available | 961 | Open in IMG/M |
| 3300028775|Ga0302231_10063471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1547 | Open in IMG/M |
| 3300028775|Ga0302231_10510196 | Not Available | 509 | Open in IMG/M |
| 3300028781|Ga0302223_10083736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1061 | Open in IMG/M |
| 3300028781|Ga0302223_10097754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 974 | Open in IMG/M |
| 3300028789|Ga0302232_10384082 | Not Available | 691 | Open in IMG/M |
| 3300030056|Ga0302181_10336524 | Not Available | 662 | Open in IMG/M |
| 3300030580|Ga0311355_11336578 | Not Available | 626 | Open in IMG/M |
| 3300030706|Ga0310039_10125209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1056 | Open in IMG/M |
| 3300031236|Ga0302324_100410446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2015 | Open in IMG/M |
| 3300031549|Ga0318571_10016332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1871 | Open in IMG/M |
| 3300031549|Ga0318571_10019963 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300031549|Ga0318571_10437770 | Not Available | 516 | Open in IMG/M |
| 3300031680|Ga0318574_10024297 | All Organisms → cellular organisms → Bacteria | 2995 | Open in IMG/M |
| 3300031682|Ga0318560_10381295 | Not Available | 762 | Open in IMG/M |
| 3300031708|Ga0310686_106791000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1598 | Open in IMG/M |
| 3300031713|Ga0318496_10128425 | Not Available | 1375 | Open in IMG/M |
| 3300031723|Ga0318493_10054695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1900 | Open in IMG/M |
| 3300031748|Ga0318492_10680576 | Not Available | 551 | Open in IMG/M |
| 3300031751|Ga0318494_10820914 | Not Available | 545 | Open in IMG/M |
| 3300031768|Ga0318509_10067519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1868 | Open in IMG/M |
| 3300031768|Ga0318509_10168336 | Not Available | 1213 | Open in IMG/M |
| 3300031768|Ga0318509_10814775 | Not Available | 516 | Open in IMG/M |
| 3300031770|Ga0318521_10296780 | Not Available | 950 | Open in IMG/M |
| 3300031777|Ga0318543_10055970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1621 | Open in IMG/M |
| 3300031782|Ga0318552_10659903 | Not Available | 533 | Open in IMG/M |
| 3300031798|Ga0318523_10492078 | Not Available | 607 | Open in IMG/M |
| 3300031805|Ga0318497_10202858 | Not Available | 1095 | Open in IMG/M |
| 3300031831|Ga0318564_10524157 | Not Available | 513 | Open in IMG/M |
| 3300031893|Ga0318536_10632587 | Not Available | 534 | Open in IMG/M |
| 3300031896|Ga0318551_10498262 | Not Available | 698 | Open in IMG/M |
| 3300031897|Ga0318520_10360535 | Not Available | 883 | Open in IMG/M |
| 3300031910|Ga0306923_10410369 | Not Available | 1540 | Open in IMG/M |
| 3300031947|Ga0310909_11119556 | Not Available | 639 | Open in IMG/M |
| 3300032044|Ga0318558_10216212 | Not Available | 938 | Open in IMG/M |
| 3300032060|Ga0318505_10186451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 969 | Open in IMG/M |
| 3300032064|Ga0318510_10084474 | Not Available | 1185 | Open in IMG/M |
| 3300032064|Ga0318510_10547125 | Not Available | 505 | Open in IMG/M |
| 3300032067|Ga0318524_10173175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1097 | Open in IMG/M |
| 3300032067|Ga0318524_10794146 | Not Available | 501 | Open in IMG/M |
| 3300032089|Ga0318525_10372068 | Not Available | 733 | Open in IMG/M |
| 3300032090|Ga0318518_10649109 | Not Available | 537 | Open in IMG/M |
| 3300032160|Ga0311301_11003466 | Not Available | 1103 | Open in IMG/M |
| 3300032205|Ga0307472_100899595 | Not Available | 819 | Open in IMG/M |
| 3300032770|Ga0335085_10584209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1260 | Open in IMG/M |
| 3300032805|Ga0335078_12221365 | Not Available | 578 | Open in IMG/M |
| 3300032805|Ga0335078_12471356 | Not Available | 537 | Open in IMG/M |
| 3300032828|Ga0335080_12197437 | Not Available | 530 | Open in IMG/M |
| 3300033134|Ga0335073_11838654 | Not Available | 563 | Open in IMG/M |
| 3300033158|Ga0335077_11334700 | Not Available | 695 | Open in IMG/M |
| 3300033289|Ga0310914_10962775 | Not Available | 753 | Open in IMG/M |
| 3300034124|Ga0370483_0345571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.25% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.72% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.20% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.36% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.68% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.84% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.84% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.84% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.84% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_101103933 | 3300001356 | Peatlands Soil | VTSLRQAGVNRGDLVGLVISPALGLGLATADRAWFTAAGEGQAAQVGRA |
| JGIcombinedJ51221_102849281 | 3300003505 | Forest Soil | VADEDLVTSLRQAGVSRGDLVGLVISPALDLSLATADRSWPVA |
| JGIcombinedJ51221_103587812 | 3300003505 | Forest Soil | VDLVTSLRQAGVGRGDLVGLVISPALGLGVATADRAWPVPADATPG |
| Ga0062387_1011635421 | 3300004091 | Bog Forest Soil | VDLVTSLRQAGVARGDLVGLVISPGLGLGVATAQRAWLVAPGPGAQPTAA |
| Ga0062389_1032638742 | 3300004092 | Bog Forest Soil | VAGADLVTSLGQAGVNRGDLVALVISPALGLGLATADRAW |
| Ga0070711_1018539082 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VADADLVAALRQAGVNRGDLVALAVSPASGFGLAAADRSWTVPGD |
| Ga0070697_1020931002 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSWTVP |
| Ga0068857_1017114701 | 3300005577 | Corn Rhizosphere | VADADLVAVLRQAGVNRGDLVALAVSPASGFGLAAADRSWTVPGDVAEVGR |
| Ga0070717_111969481 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VASADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSWTV |
| Ga0070716_1007929512 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VADADLVAALRQAGVNRGDLVALAVSPASGFGLAA |
| Ga0075014_1008293941 | 3300006174 | Watersheds | VDLVTSLRQAGAARGDLVGLVISPALGLGVATAERAW |
| Ga0097621_1020057371 | 3300006237 | Miscanthus Rhizosphere | VADADLVTALRQAGVNRGDLVALAVSPASGFGLAA |
| Ga0066709_1028363221 | 3300009137 | Grasslands Soil | VASADLVTSLRQAGVSRGDLVGLVISPALGLGLAAGARS |
| Ga0116214_10861161 | 3300009520 | Peatlands Soil | VADEDLATSLRRAGVNRGDLVGLVISPTLGLGLATADHSWPVAAGAGLADEVGQ |
| Ga0116215_13090621 | 3300009672 | Peatlands Soil | VANEDLATSLRRAGVNRGDLVGLVISPTLGLGLATADHSWPV |
| Ga0116224_104619831 | 3300009683 | Peatlands Soil | VADADLVTSLRQAGVNRGDLVGLVISPALGFGLATADRAWP |
| Ga0116217_109657001 | 3300009700 | Peatlands Soil | VGSVADADLVTSLRQAGVNRGDLVGLVISPALGLGLATADRAWPVA |
| Ga0126379_120139011 | 3300010366 | Tropical Forest Soil | VDLVTSLRQAGVDRGDLVGLVISPAVGLGVATAERAWPAAPGLAGDVGAGLVAAPGAGLAAEV |
| Ga0136449_1008482302 | 3300010379 | Peatlands Soil | VDLVTSLRQAGVARGDLVGLVISPGLGLGVATAERAWPVAA |
| Ga0126359_14366802 | 3300010869 | Boreal Forest Soil | VADADLVASLRGAGVNRGDLVAVVVTPALGYGLAAA |
| Ga0126356_110700102 | 3300010877 | Boreal Forest Soil | VADADLVASLREAGVNRGDLVALVVTPALGYGLAAAGR |
| Ga0137379_111323151 | 3300012209 | Vadose Zone Soil | VTDADLVTSLRAAGVNRGDLVGLVIASAPGLGLATA |
| Ga0137371_103664841 | 3300012356 | Vadose Zone Soil | VTSLRQAGVSRGHFVALVISPALELGLAAGASSWTVPGVA |
| Ga0137390_109845171 | 3300012363 | Vadose Zone Soil | VTSLHQAGVNRGDPVGLVISPALELGLATADRSWPVVATAGLADQVGQADDV |
| Ga0137397_111357732 | 3300012685 | Vadose Zone Soil | VTSLRQAGVSRGDLVALVISPALDLGLAAGDSSWAVKGVAVKGVAVKGVA |
| Ga0164299_106444371 | 3300012958 | Soil | VAGADLVTSLRQAGVRRGDLVALVISRALELGLAT |
| Ga0157371_114132432 | 3300013102 | Corn Rhizosphere | VTSLRQAGVSRGDLVALVISPALGLGLAAGASSWTVPGVAAEIGRAD |
| Ga0181526_103336812 | 3300014200 | Bog | VADEDLVTSLRQAGVNRGDLVGLVISPALDLGLATADRSWPVAASAR |
| Ga0182015_100481123 | 3300014495 | Palsa | VLVEARGEDVVVELRRAGVARGDLVGLAVAEGVGLGLAAA |
| Ga0157379_105471941 | 3300014968 | Switchgrass Rhizosphere | VAGADLVTSLRQAGVSRGDLVALVIAPALGLGLAAGASSWTVPCVAAEIG |
| Ga0137403_101656751 | 3300015264 | Vadose Zone Soil | VTSLRRAGVNRGDLVALVVSPALGFGLATADRSWT |
| Ga0182032_101456043 | 3300016357 | Soil | VAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSWAVAGVAA |
| Ga0182032_106160372 | 3300016357 | Soil | VDLVMSLRQAGVDRGDLVGLVISPAAGFGVATAERAWPAAPASGLAAEVG |
| Ga0182040_101606463 | 3300016387 | Soil | VAGADLVTSLRQAGVNRGDLVALVISPALEFGLAAGD |
| Ga0182037_114576201 | 3300016404 | Soil | VDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERAWPATPGAGLAAE |
| Ga0182039_101527791 | 3300016422 | Soil | VDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGR |
| Ga0187812_11816001 | 3300017821 | Freshwater Sediment | VDLVTSLRQAGVARGDLVGLAVSPGCGLGVATAERAW |
| Ga0187820_11941451 | 3300017924 | Freshwater Sediment | VDLVMSLRQAGVDRGDLVGLVISPAAGLGVATAERAWPAAPGS |
| Ga0187776_113698902 | 3300017966 | Tropical Peatland | VAGADLVTSLRQAGVNRGDLVALVVSPALEFGLAAGDNSWAVPRVAGEVGR |
| Ga0187781_106331021 | 3300017972 | Tropical Peatland | VDLVTSLRQAGVTRGDLVGLVVSPHCGLGAATADRAWP |
| Ga0187780_108358031 | 3300017973 | Tropical Peatland | VDLVTSLRQAGVARGDLVGLAVAPAAGLGVATAGGTWPVAPGPGLIAEVGR |
| Ga0187777_112554691 | 3300017974 | Tropical Peatland | VADPDLVTTLRRAGVNRGDLVGLVTSPALGLGLATAD |
| Ga0187805_100984331 | 3300018007 | Freshwater Sediment | VDLVTSLRQAGVARGDLVGLAVSPGCGLGVATAERAWPVAPGAEVAAPGAG |
| Ga0066662_112062871 | 3300018468 | Grasslands Soil | VADADLVAALRQAGVNRGDLVALAISPALGFGVAAADRSWTMPGDAAEVG |
| Ga0210401_115252071 | 3300020583 | Soil | MSVDLVTSLRQAGAARGDLVGLVVSPGLGLGVATAERAWPVAT |
| Ga0210396_114117912 | 3300021180 | Soil | VAGAELVTSLRQAGVNRGDLVGLVTSRDGLGLATADRAWPVAAGGGLAAE |
| Ga0210389_105778802 | 3300021404 | Soil | VDLVTSLRQAGAARGDLVGLVISPVLGLGVATAERAWLVTTGTDAGLAAEVAQAD |
| Ga0210387_102351411 | 3300021405 | Soil | VAGADLVTSLGRAGVNRGDLVALVISPALGLGLATAD |
| Ga0210394_107475942 | 3300021420 | Soil | VADADLVTSLRQAGVSRGDLVALVISPALDLGLAAG |
| Ga0228598_11246712 | 3300024227 | Rhizosphere | VAGAELVTSLRQAGVNRGDLVGLVISRDGLGLATADRAWPVAAGGGL |
| Ga0207685_103685862 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGADLVTSLRQAGVSRGDLVALVISPALDLGLAAG |
| Ga0207699_110636431 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VADADLVASLRQAGVSRGDLVALVVSPALGLGLAAADRSWTVPYVADEV |
| Ga0207699_114209631 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VADADLVAALRQAGVNRGDLVALAVSPASGFGLAAADRSWAVPGDAAEVGR |
| Ga0207707_103466671 | 3300025912 | Corn Rhizosphere | VAGADLVTSLRQAGARRDDLVALVISRALELGLAAGT |
| Ga0207700_113917911 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VASADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSW |
| Ga0207664_118508961 | 3300025929 | Agricultural Soil | VTGADLVTSLRQAGVSRGDLVALVISPALDLGLAAGDSSWA |
| Ga0207640_103960831 | 3300025981 | Corn Rhizosphere | VAGADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSWTVPG |
| Ga0207702_101553403 | 3300026078 | Corn Rhizosphere | VASADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSWT |
| Ga0208099_10002921 | 3300027096 | Forest Soil | VDLVTSLRQAGAARGDLVGLVISPVLGLGVATAKRAWLVATGTDAAL |
| Ga0208099_10364671 | 3300027096 | Forest Soil | VDLVTSLRHAGAARGDLVGLVVAPALGLGVATATR |
| Ga0209114_10126862 | 3300027504 | Forest Soil | VADADLVTALRRAGVSRGDLVALVISPTAGYGLAAGDSSW |
| Ga0208827_10053355 | 3300027641 | Peatlands Soil | VTSLRQAGVNRGDLVGLVISPALGIGLATADRAWPVAA |
| Ga0209420_10317502 | 3300027648 | Forest Soil | VDLVTSLGQAGVARGDLVGLVISPSLGIGLATADHGWSVPPDAG |
| Ga0208565_12412161 | 3300027662 | Peatlands Soil | VADGDLVTSLRQARVNRGDLVGLVISPALDLGLATADRSWSVAAGAGLADGVGQAD |
| Ga0209333_10182941 | 3300027676 | Forest Soil | VDLVTSLRQAGVGRGDLVGLVISPALGLGVATADRAWPEPADAGTV |
| Ga0209177_100111511 | 3300027775 | Agricultural Soil | VAGADLVTSLRQAGVSRGDLVALVISPALRLGLAAGASSWTVPCVAA |
| Ga0209656_100167154 | 3300027812 | Bog Forest Soil | VDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGHAWSAAPGTRPIAEVG |
| Ga0209112_100941632 | 3300027817 | Forest Soil | VAGADLVTSLRQAGVRRGDLVALVISRALELGLAAGA |
| Ga0302231_100634713 | 3300028775 | Palsa | MGPGADLVTSLRQAGVARGDLVGLVVSPAPGIGLATAEGAWAVAA |
| Ga0302231_105101962 | 3300028775 | Palsa | VTESGTDLVTSLREAGVSRGDLVGLVVSPALGVGLATAD |
| Ga0302223_100837362 | 3300028781 | Palsa | MTGPGADLVTSLRQAGVARGDLVGLVISPALGIGLATAKGSWAAAAGTSTA |
| Ga0302223_100977542 | 3300028781 | Palsa | VDLVTSLRQAGVARGDLVGLVISPGLGLGVATAQRAWLV |
| Ga0302232_103840822 | 3300028789 | Palsa | VTGSGADLVTSLRQAGVSRGDLVGLVVSPALGVGLATVDGA |
| Ga0302181_103365242 | 3300030056 | Palsa | VTGSGADLVTSLRQAGVSRGDLVGLVVSPALGVGLAT |
| Ga0311355_113365782 | 3300030580 | Palsa | VTGSGADLVTSLRQAGVSRGDLVGLVVSPALGVGLATVD |
| Ga0310039_101252092 | 3300030706 | Peatlands Soil | VDLVTSLRQAGVARGDLVGLVVSPRNGLGVATAERA |
| Ga0302324_1004104461 | 3300031236 | Palsa | VDLVTSLRQAGVARGDLVGLVISPGLGLGVATAQRAWLVAPGPGAQPAA |
| Ga0318571_100163321 | 3300031549 | Soil | VDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERAWPAPPGAG |
| Ga0318571_100199633 | 3300031549 | Soil | VAGADLVTSLRRTGVNRGDLVALVISPALEFGLAAGGSSWAVPGVAAEV |
| Ga0318571_104377701 | 3300031549 | Soil | VDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGRAWSAAPGTR |
| Ga0318574_100242971 | 3300031680 | Soil | VAGADLVTSLRRTGVNRGDLVALVISPALEFGLAAGGSSWAVPGVAAEVG |
| Ga0318560_103812951 | 3300031682 | Soil | VDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGRAWSAAPGTRPITEVGRADQE |
| Ga0310686_1067910001 | 3300031708 | Soil | VNLVTSLRQAGAARGDLVGLVVSPGLGLGVATAERAWPVATS |
| Ga0318496_101284251 | 3300031713 | Soil | VDLVTSLRQAGVARGDLVGLVVSPAAGLGVAIAGRAWSAAP |
| Ga0318493_100546952 | 3300031723 | Soil | MSLRQAGVDRGDLVGLVISPAAGFGVATAERAWPAAPASG |
| Ga0318492_106805761 | 3300031748 | Soil | VDLVMSLRQAGVDRGDLVGLVISPAAGFGVATAERAWPAAPA |
| Ga0318494_108209142 | 3300031751 | Soil | VDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGRAWSAAP |
| Ga0318509_100675191 | 3300031768 | Soil | VAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSW |
| Ga0318509_101683362 | 3300031768 | Soil | VAGADLVTSLRQAGVNRGDLVALVVSPTLEFGLAAGDSSWAVPGDA |
| Ga0318509_108147751 | 3300031768 | Soil | VDLVMSLRQAGVDRGDLVGLVISPAAGFGVATAERAWPAAPASGLAEE |
| Ga0318521_102967802 | 3300031770 | Soil | VAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSWAVAGGQA |
| Ga0318543_100559703 | 3300031777 | Soil | VAGADLVTSLRRTGVNRGDLVALVISPALEFGLAAGGS |
| Ga0318552_106599032 | 3300031782 | Soil | VDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERA |
| Ga0318523_104920782 | 3300031798 | Soil | VAGADLVTSLRQAGVNRGDLVALVISPALEFGLAAGDSSWAAVPGVAAEV |
| Ga0318497_102028582 | 3300031805 | Soil | VDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERTWPAAPGARLAAEVGRADEA |
| Ga0318564_105241571 | 3300031831 | Soil | MDRVRGKVGSVAGADLVTSLRQAGVNRGDLVALVISPALEFGLAAGDSSWAAVPGVA |
| Ga0318536_106325871 | 3300031893 | Soil | VDLVTSLRQAGVDRGHLVGLVFSPAAGLGVATAAR |
| Ga0318551_104982621 | 3300031896 | Soil | VDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGRAWSAAPGTRPIAEVGRAD |
| Ga0318520_103605352 | 3300031897 | Soil | VAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSWAVAGVAAE |
| Ga0306923_104103692 | 3300031910 | Soil | VAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSWAVAGVAAEVGQA |
| Ga0310909_111195561 | 3300031947 | Soil | VAGADLVTSLRQAGVNRGDLVALVISPALEFGLAAGDSSWA |
| Ga0318558_102162121 | 3300032044 | Soil | VDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERAWP |
| Ga0318505_101864513 | 3300032060 | Soil | MISVPGTDLVRSLRQAGVARGDLVGLVVSPDRGFGL |
| Ga0318510_100844742 | 3300032064 | Soil | VAGADLVTSLRQAGVNRGDLVALVVSPTLEFGLAAGDSSWAV |
| Ga0318510_105471252 | 3300032064 | Soil | VAGADLVTSLRQAGVNRGDLVALVVSPALEFGLAAGDSSW |
| Ga0318524_101731751 | 3300032067 | Soil | VDLVTSLRQAGVDRGDLLGLVVSPAAGLGVATAERAWPTAPGAGLAAE |
| Ga0318524_107941462 | 3300032067 | Soil | VDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERTWPAAPGAGLAAE |
| Ga0318525_103720682 | 3300032089 | Soil | VDLVTSLRQAGVDRGDLVGLVVSPAAGLGVATAERAWPAAP |
| Ga0318518_106491091 | 3300032090 | Soil | VAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSWAVAG |
| Ga0311301_110034662 | 3300032160 | Peatlands Soil | VADGDLVTSLRQARVNRGDLVGLVISPALDLGLATADRSWSVAA |
| Ga0307472_1008995952 | 3300032205 | Hardwood Forest Soil | VAGADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSWTVPGV |
| Ga0335085_105842093 | 3300032770 | Soil | VAGADLVTSLRRAGVNRGDLVALVVSPALEFGLAAG |
| Ga0335078_122213651 | 3300032805 | Soil | VAGADLVTSLRRAGVNRGDLVALVVSPALEFGLAAGDSSRAVVPGV |
| Ga0335078_124713561 | 3300032805 | Soil | VADTDLVASLRQAGVNRGDLVALVVSPALGFGLAAAD |
| Ga0335080_121974371 | 3300032828 | Soil | VAGADLVTSLRRAGVNRGDLVALVVSPALEFGLAAGDSSRAVVPGVPA |
| Ga0335073_118386541 | 3300033134 | Soil | VAGADLVTSLRQAGVNRGDLVALVVSPALEFGLAAGDSSWAAVPGVAAE |
| Ga0335077_113347002 | 3300033158 | Soil | VASADLVTSLRQAGVNRGDLVALVISPALEFGLATADGSWAAG |
| Ga0310914_109627751 | 3300033289 | Soil | VDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERAWPAPPGAGLAAEVRR |
| Ga0370483_0345571_3_134 | 3300034124 | Untreated Peat Soil | MTGPGADLVTSLRQAGVARGDLVGLVVSPALGIGLATAEGAWAV |
| ⦗Top⦘ |