NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075227

Metagenome / Metatranscriptome Family F075227

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075227
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 43 residues
Representative Sequence VADADLVTSLRQAGVNRGDLVGLVISPALGFGLATADRAWP
Number of Associated Samples 106
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 98.29 %
% of genes near scaffold ends (potentially truncated) 98.32 %
% of genes from short scaffolds (< 2000 bps) 90.76 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (51.261 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(30.252 % of family members)
Environment Ontology (ENVO) Unclassified
(31.092 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.697 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.14%    β-sheet: 20.29%    Coil/Unstructured: 69.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00579tRNA-synt_1b 26.05
PF00356LacI 9.24
PF00528BPD_transp_1 9.24
PF13377Peripla_BP_3 3.36
PF00496SBP_bac_5 1.68
PF00532Peripla_BP_1 1.68
PF00933Glyco_hydro_3 0.84
PF02627CMD 0.84
PF12697Abhydrolase_6 0.84
PF03795YCII 0.84
PF08530PepX_C 0.84
PF01547SBP_bac_1 0.84
PF03466LysR_substrate 0.84
PF13936HTH_38 0.84
PF12840HTH_20 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 26.05
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 26.05
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.84
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.84
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.84
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.84
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A51.26 %
All OrganismsrootAll Organisms48.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10110393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1310Open in IMG/M
3300003505|JGIcombinedJ51221_10284928Not Available672Open in IMG/M
3300003505|JGIcombinedJ51221_10358781All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300004091|Ga0062387_101163542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300004092|Ga0062389_103263874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia608Open in IMG/M
3300005439|Ga0070711_101853908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300005536|Ga0070697_102093100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300005577|Ga0068857_101711470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia615Open in IMG/M
3300006028|Ga0070717_11196948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia691Open in IMG/M
3300006173|Ga0070716_100792951All Organisms → cellular organisms → Bacteria → Terrabacteria group733Open in IMG/M
3300006174|Ga0075014_100829394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba548Open in IMG/M
3300006237|Ga0097621_102005737Not Available553Open in IMG/M
3300009137|Ga0066709_102836322All Organisms → cellular organisms → Bacteria → Terrabacteria group642Open in IMG/M
3300009520|Ga0116214_1086116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1151Open in IMG/M
3300009672|Ga0116215_1309062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300009683|Ga0116224_10461983All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300009700|Ga0116217_10965700Not Available522Open in IMG/M
3300010379|Ga0136449_100848230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1500Open in IMG/M
3300010869|Ga0126359_1436680All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300010877|Ga0126356_11070010Not Available966Open in IMG/M
3300012209|Ga0137379_11132315Not Available688Open in IMG/M
3300012356|Ga0137371_10366484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1119Open in IMG/M
3300012363|Ga0137390_10984517Not Available796Open in IMG/M
3300012685|Ga0137397_11135773Not Available567Open in IMG/M
3300012958|Ga0164299_10644437Not Available732Open in IMG/M
3300013102|Ga0157371_11413243All Organisms → cellular organisms → Bacteria → Proteobacteria541Open in IMG/M
3300014200|Ga0181526_10333681All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300014968|Ga0157379_10547194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1077Open in IMG/M
3300015264|Ga0137403_10165675All Organisms → cellular organisms → Bacteria → Proteobacteria2165Open in IMG/M
3300016357|Ga0182032_10145604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1745Open in IMG/M
3300016357|Ga0182032_10616037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia904Open in IMG/M
3300016387|Ga0182040_10160646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1612Open in IMG/M
3300016404|Ga0182037_11457620Not Available606Open in IMG/M
3300016422|Ga0182039_10152779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1790Open in IMG/M
3300017821|Ga0187812_1181600Not Available674Open in IMG/M
3300017924|Ga0187820_1194145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia631Open in IMG/M
3300017966|Ga0187776_11369890All Organisms → cellular organisms → Bacteria → Terrabacteria group538Open in IMG/M
3300017972|Ga0187781_10633102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia772Open in IMG/M
3300017973|Ga0187780_10835803Not Available667Open in IMG/M
3300017974|Ga0187777_11255469Not Available543Open in IMG/M
3300018007|Ga0187805_10098433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1322Open in IMG/M
3300018468|Ga0066662_11206287Not Available766Open in IMG/M
3300020583|Ga0210401_11525207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300021180|Ga0210396_11411791All Organisms → cellular organisms → Bacteria → Terrabacteria group575Open in IMG/M
3300021404|Ga0210389_10577880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia883Open in IMG/M
3300021405|Ga0210387_10235141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1599Open in IMG/M
3300021420|Ga0210394_10747594Not Available856Open in IMG/M
3300024227|Ga0228598_1124671All Organisms → cellular organisms → Bacteria → Terrabacteria group523Open in IMG/M
3300025905|Ga0207685_10368586Not Available729Open in IMG/M
3300025906|Ga0207699_11063643Not Available599Open in IMG/M
3300025906|Ga0207699_11420963Not Available513Open in IMG/M
3300025912|Ga0207707_10346667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1280Open in IMG/M
3300025928|Ga0207700_11391791Not Available624Open in IMG/M
3300025929|Ga0207664_11850896Not Available526Open in IMG/M
3300025981|Ga0207640_10396083Not Available1123Open in IMG/M
3300026078|Ga0207702_10155340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2085Open in IMG/M
3300027096|Ga0208099_1000292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5512Open in IMG/M
3300027096|Ga0208099_1036467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300027504|Ga0209114_1012686Not Available1311Open in IMG/M
3300027641|Ga0208827_1005335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5053Open in IMG/M
3300027648|Ga0209420_1031750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica1646Open in IMG/M
3300027662|Ga0208565_1241216Not Available506Open in IMG/M
3300027676|Ga0209333_1018294Not Available2007Open in IMG/M
3300027775|Ga0209177_10011151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2018Open in IMG/M
3300027812|Ga0209656_10016715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4537Open in IMG/M
3300027817|Ga0209112_10094163Not Available961Open in IMG/M
3300028775|Ga0302231_10063471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1547Open in IMG/M
3300028775|Ga0302231_10510196Not Available509Open in IMG/M
3300028781|Ga0302223_10083736All Organisms → cellular organisms → Bacteria → Terrabacteria group1061Open in IMG/M
3300028781|Ga0302223_10097754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia974Open in IMG/M
3300028789|Ga0302232_10384082Not Available691Open in IMG/M
3300030056|Ga0302181_10336524Not Available662Open in IMG/M
3300030580|Ga0311355_11336578Not Available626Open in IMG/M
3300030706|Ga0310039_10125209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1056Open in IMG/M
3300031236|Ga0302324_100410446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2015Open in IMG/M
3300031549|Ga0318571_10016332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1871Open in IMG/M
3300031549|Ga0318571_10019963All Organisms → cellular organisms → Bacteria1741Open in IMG/M
3300031549|Ga0318571_10437770Not Available516Open in IMG/M
3300031680|Ga0318574_10024297All Organisms → cellular organisms → Bacteria2995Open in IMG/M
3300031682|Ga0318560_10381295Not Available762Open in IMG/M
3300031708|Ga0310686_106791000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1598Open in IMG/M
3300031713|Ga0318496_10128425Not Available1375Open in IMG/M
3300031723|Ga0318493_10054695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1900Open in IMG/M
3300031748|Ga0318492_10680576Not Available551Open in IMG/M
3300031751|Ga0318494_10820914Not Available545Open in IMG/M
3300031768|Ga0318509_10067519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1868Open in IMG/M
3300031768|Ga0318509_10168336Not Available1213Open in IMG/M
3300031768|Ga0318509_10814775Not Available516Open in IMG/M
3300031770|Ga0318521_10296780Not Available950Open in IMG/M
3300031777|Ga0318543_10055970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1621Open in IMG/M
3300031782|Ga0318552_10659903Not Available533Open in IMG/M
3300031798|Ga0318523_10492078Not Available607Open in IMG/M
3300031805|Ga0318497_10202858Not Available1095Open in IMG/M
3300031831|Ga0318564_10524157Not Available513Open in IMG/M
3300031893|Ga0318536_10632587Not Available534Open in IMG/M
3300031896|Ga0318551_10498262Not Available698Open in IMG/M
3300031897|Ga0318520_10360535Not Available883Open in IMG/M
3300031910|Ga0306923_10410369Not Available1540Open in IMG/M
3300031947|Ga0310909_11119556Not Available639Open in IMG/M
3300032044|Ga0318558_10216212Not Available938Open in IMG/M
3300032060|Ga0318505_10186451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae969Open in IMG/M
3300032064|Ga0318510_10084474Not Available1185Open in IMG/M
3300032064|Ga0318510_10547125Not Available505Open in IMG/M
3300032067|Ga0318524_10173175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1097Open in IMG/M
3300032067|Ga0318524_10794146Not Available501Open in IMG/M
3300032089|Ga0318525_10372068Not Available733Open in IMG/M
3300032090|Ga0318518_10649109Not Available537Open in IMG/M
3300032160|Ga0311301_11003466Not Available1103Open in IMG/M
3300032205|Ga0307472_100899595Not Available819Open in IMG/M
3300032770|Ga0335085_10584209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1260Open in IMG/M
3300032805|Ga0335078_12221365Not Available578Open in IMG/M
3300032805|Ga0335078_12471356Not Available537Open in IMG/M
3300032828|Ga0335080_12197437Not Available530Open in IMG/M
3300033134|Ga0335073_11838654Not Available563Open in IMG/M
3300033158|Ga0335077_11334700Not Available695Open in IMG/M
3300033289|Ga0310914_10962775Not Available753Open in IMG/M
3300034124|Ga0370483_0345571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil30.25%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.40%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.72%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.04%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.04%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.20%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.36%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.52%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.68%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.68%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.84%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.84%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.84%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.84%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027504Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1011039333300001356Peatlands SoilVTSLRQAGVNRGDLVGLVISPALGLGLATADRAWFTAAGEGQAAQVGRA
JGIcombinedJ51221_1028492813300003505Forest SoilVADEDLVTSLRQAGVSRGDLVGLVISPALDLSLATADRSWPVA
JGIcombinedJ51221_1035878123300003505Forest SoilVDLVTSLRQAGVGRGDLVGLVISPALGLGVATADRAWPVPADATPG
Ga0062387_10116354213300004091Bog Forest SoilVDLVTSLRQAGVARGDLVGLVISPGLGLGVATAQRAWLVAPGPGAQPTAA
Ga0062389_10326387423300004092Bog Forest SoilVAGADLVTSLGQAGVNRGDLVALVISPALGLGLATADRAW
Ga0070711_10185390823300005439Corn, Switchgrass And Miscanthus RhizosphereVADADLVAALRQAGVNRGDLVALAVSPASGFGLAAADRSWTVPGD
Ga0070697_10209310023300005536Corn, Switchgrass And Miscanthus RhizosphereVAGADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSWTVP
Ga0068857_10171147013300005577Corn RhizosphereVADADLVAVLRQAGVNRGDLVALAVSPASGFGLAAADRSWTVPGDVAEVGR
Ga0070717_1119694813300006028Corn, Switchgrass And Miscanthus RhizosphereVASADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSWTV
Ga0070716_10079295123300006173Corn, Switchgrass And Miscanthus RhizosphereVADADLVAALRQAGVNRGDLVALAVSPASGFGLAA
Ga0075014_10082939413300006174WatershedsVDLVTSLRQAGAARGDLVGLVISPALGLGVATAERAW
Ga0097621_10200573713300006237Miscanthus RhizosphereVADADLVTALRQAGVNRGDLVALAVSPASGFGLAA
Ga0066709_10283632213300009137Grasslands SoilVASADLVTSLRQAGVSRGDLVGLVISPALGLGLAAGARS
Ga0116214_108611613300009520Peatlands SoilVADEDLATSLRRAGVNRGDLVGLVISPTLGLGLATADHSWPVAAGAGLADEVGQ
Ga0116215_130906213300009672Peatlands SoilVANEDLATSLRRAGVNRGDLVGLVISPTLGLGLATADHSWPV
Ga0116224_1046198313300009683Peatlands SoilVADADLVTSLRQAGVNRGDLVGLVISPALGFGLATADRAWP
Ga0116217_1096570013300009700Peatlands SoilVGSVADADLVTSLRQAGVNRGDLVGLVISPALGLGLATADRAWPVA
Ga0126379_1201390113300010366Tropical Forest SoilVDLVTSLRQAGVDRGDLVGLVISPAVGLGVATAERAWPAAPGLAGDVGAGLVAAPGAGLAAEV
Ga0136449_10084823023300010379Peatlands SoilVDLVTSLRQAGVARGDLVGLVISPGLGLGVATAERAWPVAA
Ga0126359_143668023300010869Boreal Forest SoilVADADLVASLRGAGVNRGDLVAVVVTPALGYGLAAA
Ga0126356_1107001023300010877Boreal Forest SoilVADADLVASLREAGVNRGDLVALVVTPALGYGLAAAGR
Ga0137379_1113231513300012209Vadose Zone SoilVTDADLVTSLRAAGVNRGDLVGLVIASAPGLGLATA
Ga0137371_1036648413300012356Vadose Zone SoilVTSLRQAGVSRGHFVALVISPALELGLAAGASSWTVPGVA
Ga0137390_1098451713300012363Vadose Zone SoilVTSLHQAGVNRGDPVGLVISPALELGLATADRSWPVVATAGLADQVGQADDV
Ga0137397_1113577323300012685Vadose Zone SoilVTSLRQAGVSRGDLVALVISPALDLGLAAGDSSWAVKGVAVKGVAVKGVA
Ga0164299_1064443713300012958SoilVAGADLVTSLRQAGVRRGDLVALVISRALELGLAT
Ga0157371_1141324323300013102Corn RhizosphereVTSLRQAGVSRGDLVALVISPALGLGLAAGASSWTVPGVAAEIGRAD
Ga0181526_1033368123300014200BogVADEDLVTSLRQAGVNRGDLVGLVISPALDLGLATADRSWPVAASAR
Ga0182015_1004811233300014495PalsaVLVEARGEDVVVELRRAGVARGDLVGLAVAEGVGLGLAAA
Ga0157379_1054719413300014968Switchgrass RhizosphereVAGADLVTSLRQAGVSRGDLVALVIAPALGLGLAAGASSWTVPCVAAEIG
Ga0137403_1016567513300015264Vadose Zone SoilVTSLRRAGVNRGDLVALVVSPALGFGLATADRSWT
Ga0182032_1014560433300016357SoilVAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSWAVAGVAA
Ga0182032_1061603723300016357SoilVDLVMSLRQAGVDRGDLVGLVISPAAGFGVATAERAWPAAPASGLAAEVG
Ga0182040_1016064633300016387SoilVAGADLVTSLRQAGVNRGDLVALVISPALEFGLAAGD
Ga0182037_1145762013300016404SoilVDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERAWPATPGAGLAAE
Ga0182039_1015277913300016422SoilVDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGR
Ga0187812_118160013300017821Freshwater SedimentVDLVTSLRQAGVARGDLVGLAVSPGCGLGVATAERAW
Ga0187820_119414513300017924Freshwater SedimentVDLVMSLRQAGVDRGDLVGLVISPAAGLGVATAERAWPAAPGS
Ga0187776_1136989023300017966Tropical PeatlandVAGADLVTSLRQAGVNRGDLVALVVSPALEFGLAAGDNSWAVPRVAGEVGR
Ga0187781_1063310213300017972Tropical PeatlandVDLVTSLRQAGVTRGDLVGLVVSPHCGLGAATADRAWP
Ga0187780_1083580313300017973Tropical PeatlandVDLVTSLRQAGVARGDLVGLAVAPAAGLGVATAGGTWPVAPGPGLIAEVGR
Ga0187777_1125546913300017974Tropical PeatlandVADPDLVTTLRRAGVNRGDLVGLVTSPALGLGLATAD
Ga0187805_1009843313300018007Freshwater SedimentVDLVTSLRQAGVARGDLVGLAVSPGCGLGVATAERAWPVAPGAEVAAPGAG
Ga0066662_1120628713300018468Grasslands SoilVADADLVAALRQAGVNRGDLVALAISPALGFGVAAADRSWTMPGDAAEVG
Ga0210401_1152520713300020583SoilMSVDLVTSLRQAGAARGDLVGLVVSPGLGLGVATAERAWPVAT
Ga0210396_1141179123300021180SoilVAGAELVTSLRQAGVNRGDLVGLVTSRDGLGLATADRAWPVAAGGGLAAE
Ga0210389_1057788023300021404SoilVDLVTSLRQAGAARGDLVGLVISPVLGLGVATAERAWLVTTGTDAGLAAEVAQAD
Ga0210387_1023514113300021405SoilVAGADLVTSLGRAGVNRGDLVALVISPALGLGLATAD
Ga0210394_1074759423300021420SoilVADADLVTSLRQAGVSRGDLVALVISPALDLGLAAG
Ga0228598_112467123300024227RhizosphereVAGAELVTSLRQAGVNRGDLVGLVISRDGLGLATADRAWPVAAGGGL
Ga0207685_1036858623300025905Corn, Switchgrass And Miscanthus RhizosphereVAGADLVTSLRQAGVSRGDLVALVISPALDLGLAAG
Ga0207699_1106364313300025906Corn, Switchgrass And Miscanthus RhizosphereVADADLVASLRQAGVSRGDLVALVVSPALGLGLAAADRSWTVPYVADEV
Ga0207699_1142096313300025906Corn, Switchgrass And Miscanthus RhizosphereVADADLVAALRQAGVNRGDLVALAVSPASGFGLAAADRSWAVPGDAAEVGR
Ga0207707_1034666713300025912Corn RhizosphereVAGADLVTSLRQAGARRDDLVALVISRALELGLAAGT
Ga0207700_1139179113300025928Corn, Switchgrass And Miscanthus RhizosphereVASADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSW
Ga0207664_1185089613300025929Agricultural SoilVTGADLVTSLRQAGVSRGDLVALVISPALDLGLAAGDSSWA
Ga0207640_1039608313300025981Corn RhizosphereVAGADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSWTVPG
Ga0207702_1015534033300026078Corn RhizosphereVASADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSWT
Ga0208099_100029213300027096Forest SoilVDLVTSLRQAGAARGDLVGLVISPVLGLGVATAKRAWLVATGTDAAL
Ga0208099_103646713300027096Forest SoilVDLVTSLRHAGAARGDLVGLVVAPALGLGVATATR
Ga0209114_101268623300027504Forest SoilVADADLVTALRRAGVSRGDLVALVISPTAGYGLAAGDSSW
Ga0208827_100533553300027641Peatlands SoilVTSLRQAGVNRGDLVGLVISPALGIGLATADRAWPVAA
Ga0209420_103175023300027648Forest SoilVDLVTSLGQAGVARGDLVGLVISPSLGIGLATADHGWSVPPDAG
Ga0208565_124121613300027662Peatlands SoilVADGDLVTSLRQARVNRGDLVGLVISPALDLGLATADRSWSVAAGAGLADGVGQAD
Ga0209333_101829413300027676Forest SoilVDLVTSLRQAGVGRGDLVGLVISPALGLGVATADRAWPEPADAGTV
Ga0209177_1001115113300027775Agricultural SoilVAGADLVTSLRQAGVSRGDLVALVISPALRLGLAAGASSWTVPCVAA
Ga0209656_1001671543300027812Bog Forest SoilVDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGHAWSAAPGTRPIAEVG
Ga0209112_1009416323300027817Forest SoilVAGADLVTSLRQAGVRRGDLVALVISRALELGLAAGA
Ga0302231_1006347133300028775PalsaMGPGADLVTSLRQAGVARGDLVGLVVSPAPGIGLATAEGAWAVAA
Ga0302231_1051019623300028775PalsaVTESGTDLVTSLREAGVSRGDLVGLVVSPALGVGLATAD
Ga0302223_1008373623300028781PalsaMTGPGADLVTSLRQAGVARGDLVGLVISPALGIGLATAKGSWAAAAGTSTA
Ga0302223_1009775423300028781PalsaVDLVTSLRQAGVARGDLVGLVISPGLGLGVATAQRAWLV
Ga0302232_1038408223300028789PalsaVTGSGADLVTSLRQAGVSRGDLVGLVVSPALGVGLATVDGA
Ga0302181_1033652423300030056PalsaVTGSGADLVTSLRQAGVSRGDLVGLVVSPALGVGLAT
Ga0311355_1133657823300030580PalsaVTGSGADLVTSLRQAGVSRGDLVGLVVSPALGVGLATVD
Ga0310039_1012520923300030706Peatlands SoilVDLVTSLRQAGVARGDLVGLVVSPRNGLGVATAERA
Ga0302324_10041044613300031236PalsaVDLVTSLRQAGVARGDLVGLVISPGLGLGVATAQRAWLVAPGPGAQPAA
Ga0318571_1001633213300031549SoilVDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERAWPAPPGAG
Ga0318571_1001996333300031549SoilVAGADLVTSLRRTGVNRGDLVALVISPALEFGLAAGGSSWAVPGVAAEV
Ga0318571_1043777013300031549SoilVDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGRAWSAAPGTR
Ga0318574_1002429713300031680SoilVAGADLVTSLRRTGVNRGDLVALVISPALEFGLAAGGSSWAVPGVAAEVG
Ga0318560_1038129513300031682SoilVDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGRAWSAAPGTRPITEVGRADQE
Ga0310686_10679100013300031708SoilVNLVTSLRQAGAARGDLVGLVVSPGLGLGVATAERAWPVATS
Ga0318496_1012842513300031713SoilVDLVTSLRQAGVARGDLVGLVVSPAAGLGVAIAGRAWSAAP
Ga0318493_1005469523300031723SoilMSLRQAGVDRGDLVGLVISPAAGFGVATAERAWPAAPASG
Ga0318492_1068057613300031748SoilVDLVMSLRQAGVDRGDLVGLVISPAAGFGVATAERAWPAAPA
Ga0318494_1082091423300031751SoilVDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGRAWSAAP
Ga0318509_1006751913300031768SoilVAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSW
Ga0318509_1016833623300031768SoilVAGADLVTSLRQAGVNRGDLVALVVSPTLEFGLAAGDSSWAVPGDA
Ga0318509_1081477513300031768SoilVDLVMSLRQAGVDRGDLVGLVISPAAGFGVATAERAWPAAPASGLAEE
Ga0318521_1029678023300031770SoilVAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSWAVAGGQA
Ga0318543_1005597033300031777SoilVAGADLVTSLRRTGVNRGDLVALVISPALEFGLAAGGS
Ga0318552_1065990323300031782SoilVDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERA
Ga0318523_1049207823300031798SoilVAGADLVTSLRQAGVNRGDLVALVISPALEFGLAAGDSSWAAVPGVAAEV
Ga0318497_1020285823300031805SoilVDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERTWPAAPGARLAAEVGRADEA
Ga0318564_1052415713300031831SoilMDRVRGKVGSVAGADLVTSLRQAGVNRGDLVALVISPALEFGLAAGDSSWAAVPGVA
Ga0318536_1063258713300031893SoilVDLVTSLRQAGVDRGHLVGLVFSPAAGLGVATAAR
Ga0318551_1049826213300031896SoilVDLVTSLRQAGVARGDLVGLVVSPAAGLGVATAGRAWSAAPGTRPIAEVGRAD
Ga0318520_1036053523300031897SoilVAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSWAVAGVAAE
Ga0306923_1041036923300031910SoilVAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSWAVAGVAAEVGQA
Ga0310909_1111955613300031947SoilVAGADLVTSLRQAGVNRGDLVALVISPALEFGLAAGDSSWA
Ga0318558_1021621213300032044SoilVDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERAWP
Ga0318505_1018645133300032060SoilMISVPGTDLVRSLRQAGVARGDLVGLVVSPDRGFGL
Ga0318510_1008447423300032064SoilVAGADLVTSLRQAGVNRGDLVALVVSPTLEFGLAAGDSSWAV
Ga0318510_1054712523300032064SoilVAGADLVTSLRQAGVNRGDLVALVVSPALEFGLAAGDSSW
Ga0318524_1017317513300032067SoilVDLVTSLRQAGVDRGDLLGLVVSPAAGLGVATAERAWPTAPGAGLAAE
Ga0318524_1079414623300032067SoilVDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERTWPAAPGAGLAAE
Ga0318525_1037206823300032089SoilVDLVTSLRQAGVDRGDLVGLVVSPAAGLGVATAERAWPAAP
Ga0318518_1064910913300032090SoilVAGADLVTSLRQAGVNRGDLVALVVSPAFELGLAAGDGSWAVAG
Ga0311301_1100346623300032160Peatlands SoilVADGDLVTSLRQARVNRGDLVGLVISPALDLGLATADRSWSVAA
Ga0307472_10089959523300032205Hardwood Forest SoilVAGADLVTSLRQAGVRRGDLVALVISRALELGLAAGASSWTVPGV
Ga0335085_1058420933300032770SoilVAGADLVTSLRRAGVNRGDLVALVVSPALEFGLAAG
Ga0335078_1222136513300032805SoilVAGADLVTSLRRAGVNRGDLVALVVSPALEFGLAAGDSSRAVVPGV
Ga0335078_1247135613300032805SoilVADTDLVASLRQAGVNRGDLVALVVSPALGFGLAAAD
Ga0335080_1219743713300032828SoilVAGADLVTSLRRAGVNRGDLVALVVSPALEFGLAAGDSSRAVVPGVPA
Ga0335073_1183865413300033134SoilVAGADLVTSLRQAGVNRGDLVALVVSPALEFGLAAGDSSWAAVPGVAAE
Ga0335077_1133470023300033158SoilVASADLVTSLRQAGVNRGDLVALVISPALEFGLATADGSWAAG
Ga0310914_1096277513300033289SoilVDLVTSLRQAGVDRGDLVGLVISPAAGLGVATAERAWPAPPGAGLAAEVRR
Ga0370483_0345571_3_1343300034124Untreated Peat SoilMTGPGADLVTSLRQAGVARGDLVGLVVSPALGIGLATAEGAWAV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.