NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075205

Metagenome / Metatranscriptome Family F075205

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075205
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 105 residues
Representative Sequence TCSAADLLKKYDFTVSGSTIPMQDGEVAHVVSAKGTLDIAENGSFQVESDCSVQFEWTLPDQDGEVAEPSPMAMRGFLVNGGKEILAFQTDPGAMVAARFTSNGR
Number of Associated Samples 101
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 8.47 %
% of genes near scaffold ends (potentially truncated) 85.71 %
% of genes from short scaffolds (< 2000 bps) 86.55 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.76

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.319 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen
(14.286 % of family members)
Environment Ontology (ENVO) Unclassified
(34.454 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.059 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 7.52%    β-sheet: 41.35%    Coil/Unstructured: 51.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.76
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.61.4.1: Quinohemoprotein amine dehydrogenase A chain, domain 3d1jmxa51jmx0.7
b.61.4.1: Quinohemoprotein amine dehydrogenase A chain, domain 3d1jmxa51jmx0.7
b.61.4.1: Quinohemoprotein amine dehydrogenase A chain, domain 3d1pbya51pby0.67
b.61.4.1: Quinohemoprotein amine dehydrogenase A chain, domain 3d1pbya51pby0.67
f.4.1.1: OMPA-liked1p4ta_1p4t0.66
f.4.1.1: OMPA-liked1p4ta_1p4t0.66
f.4.1.3: OMPA-liked3hola13hol0.64
f.4.1.4: OMPA-liked5b5eo_5b5e0.64
f.4.1.3: OMPA-liked3hola13hol0.64
f.4.1.4: OMPA-liked5b5eo_5b5e0.64


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00561Abhydrolase_1 12.61
PF11604CusF_Ec 4.20
PF05235CHAD 3.36
PF12704MacB_PCD 3.36
PF03721UDPG_MGDP_dh_N 2.52
PF01678DAP_epimerase 2.52
PF02687FtsX 1.68
PF00210Ferritin 1.68
PF01551Peptidase_M23 1.68
PF01566Nramp 1.68
PF02954HTH_8 1.68
PF04972BON 1.68
PF01464SLT 0.84
PF01047MarR 0.84
PF00575S1 0.84
PF00483NTP_transferase 0.84
PF01988VIT1 0.84
PF13502AsmA_2 0.84
PF09363XFP_C 0.84
PF01872RibD_C 0.84
PF01914MarC 0.84
PF00437T2SSE 0.84
PF00480ROK 0.84
PF02915Rubrerythrin 0.84
PF14559TPR_19 0.84
PF04434SWIM 0.84
PF04226Transgly_assoc 0.84
PF11897DUF3417 0.84
PF09364XFP_N 0.84
PF11721Malectin 0.84
PF11752DUF3309 0.84
PF07635PSCyt1 0.84
PF00773RNB 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG5607CHAD domain, binds inorganic polyphosphatesFunction unknown [S] 3.36
COG3025Inorganic triphosphatase YgiF, contains CYTH and CHAD domainsInorganic ion transport and metabolism [P] 3.36
COG0253Diaminopimelate epimeraseAmino acid transport and metabolism [E] 2.52
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 2.52
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 2.52
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 2.52
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 2.52
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 2.52
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 1.68
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.68
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.84
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.84
COG0557Exoribonuclease RTranscription [K] 0.84
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.84
COG2095Small neutral amino acid transporter SnatA, MarC familyAmino acid transport and metabolism [E] 0.84
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.84
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.84
COG4279Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.84
COG4715Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.84
COG4776Exoribonuclease IITranscription [K] 0.84
COG5431Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domainGeneral function prediction only [R] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.32 %
UnclassifiedrootN/A1.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004114|Ga0062593_102287881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4607Open in IMG/M
3300005337|Ga0070682_101939523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4517Open in IMG/M
3300005355|Ga0070671_101924964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4526Open in IMG/M
3300005440|Ga0070705_101554086All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae556Open in IMG/M
3300005534|Ga0070735_10033835All Organisms → cellular organisms → Bacteria3520Open in IMG/M
3300005537|Ga0070730_10348152All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300005538|Ga0070731_10359569All Organisms → cellular organisms → Bacteria → Proteobacteria967Open in IMG/M
3300005544|Ga0070686_101185087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4634Open in IMG/M
3300005842|Ga0068858_100465554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1219Open in IMG/M
3300005938|Ga0066795_10125867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4764Open in IMG/M
3300006173|Ga0070716_101641162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4529Open in IMG/M
3300006237|Ga0097621_102006757All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4553Open in IMG/M
3300006804|Ga0079221_10908159All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4648Open in IMG/M
3300007265|Ga0099794_10316323All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300009038|Ga0099829_11223107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4622Open in IMG/M
3300009093|Ga0105240_11364438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium746Open in IMG/M
3300009100|Ga0075418_12126083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4612Open in IMG/M
3300009168|Ga0105104_10603155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4625Open in IMG/M
3300009174|Ga0105241_10236501All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41542Open in IMG/M
3300009518|Ga0116128_1199983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4561Open in IMG/M
3300009520|Ga0116214_1206497All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4740Open in IMG/M
3300009521|Ga0116222_1439989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4568Open in IMG/M
3300009522|Ga0116218_1448337All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4575Open in IMG/M
3300009523|Ga0116221_1141713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41049Open in IMG/M
3300009525|Ga0116220_10127212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41088Open in IMG/M
3300009525|Ga0116220_10199027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4868Open in IMG/M
3300009552|Ga0116138_1080076All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300009615|Ga0116103_1009930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3254Open in IMG/M
3300009629|Ga0116119_1196775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4501Open in IMG/M
3300009683|Ga0116224_10339107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4715Open in IMG/M
3300009700|Ga0116217_10227893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1216Open in IMG/M
3300009764|Ga0116134_1286492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4567Open in IMG/M
3300009824|Ga0116219_10038128All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42875Open in IMG/M
3300010379|Ga0136449_100111191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00685560Open in IMG/M
3300010379|Ga0136449_102276983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4787Open in IMG/M
3300011119|Ga0105246_11636441All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4610Open in IMG/M
3300011120|Ga0150983_14412412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41014Open in IMG/M
3300012096|Ga0137389_10713305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4862Open in IMG/M
3300012930|Ga0137407_11094183All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4756Open in IMG/M
3300013306|Ga0163162_11113908All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4895Open in IMG/M
3300014161|Ga0181529_10505612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4639Open in IMG/M
3300014164|Ga0181532_10463944All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4697Open in IMG/M
3300014165|Ga0181523_10200104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41157Open in IMG/M
3300014490|Ga0182010_10676223All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4580Open in IMG/M
3300014490|Ga0182010_10806360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4532Open in IMG/M
3300014490|Ga0182010_10869511All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4513Open in IMG/M
3300014491|Ga0182014_10138118All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300014491|Ga0182014_10316680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4796Open in IMG/M
3300014494|Ga0182017_10688434All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4620Open in IMG/M
3300014494|Ga0182017_10718740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4604Open in IMG/M
3300014494|Ga0182017_10896976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300014496|Ga0182011_10541319All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4746Open in IMG/M
3300014496|Ga0182011_10542821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4744Open in IMG/M
3300014498|Ga0182019_10872925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4647Open in IMG/M
3300014502|Ga0182021_12365370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4639Open in IMG/M
3300014502|Ga0182021_12819972All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4584Open in IMG/M
3300014839|Ga0182027_10123622All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA43080Open in IMG/M
3300014839|Ga0182027_10415158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41491Open in IMG/M
3300014839|Ga0182027_10977291All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4869Open in IMG/M
3300014839|Ga0182027_11206936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4760Open in IMG/M
3300014839|Ga0182027_11990368All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4557Open in IMG/M
3300014969|Ga0157376_10466326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41235Open in IMG/M
3300015371|Ga0132258_11021925All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42089Open in IMG/M
3300015373|Ga0132257_104209910All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4523Open in IMG/M
3300015374|Ga0132255_102116144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4857Open in IMG/M
3300016730|Ga0181515_1424502Not Available2187Open in IMG/M
3300017823|Ga0187818_10559697All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4516Open in IMG/M
3300017931|Ga0187877_1110381All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41138Open in IMG/M
3300017940|Ga0187853_10505938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4527Open in IMG/M
3300017943|Ga0187819_10864002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4507Open in IMG/M
3300017996|Ga0187891_1161078All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4790Open in IMG/M
3300018009|Ga0187884_10031299All Organisms → cellular organisms → Bacteria2652Open in IMG/M
3300018033|Ga0187867_10041089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2823Open in IMG/M
3300018073|Ga0184624_10436747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4576Open in IMG/M
3300018083|Ga0184628_10063729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae1868Open in IMG/M
3300019788|Ga0182028_1398006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41713Open in IMG/M
3300021420|Ga0210394_10691009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4895Open in IMG/M
3300021474|Ga0210390_10745217All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4814Open in IMG/M
3300023091|Ga0224559_1280960All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4556Open in IMG/M
3300024233|Ga0224521_1136881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4519Open in IMG/M
3300025441|Ga0208456_1017434All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300025579|Ga0207927_1043091All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300025857|Ga0209014_10025917All Organisms → cellular organisms → Bacteria2764Open in IMG/M
3300025878|Ga0209584_10169870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4826Open in IMG/M
3300025899|Ga0207642_10256926All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4994Open in IMG/M
3300025905|Ga0207685_10210337All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4919Open in IMG/M
3300025911|Ga0207654_10282489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41123Open in IMG/M
3300025934|Ga0207686_11217591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4617Open in IMG/M
3300026271|Ga0209880_1046335All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4963Open in IMG/M
3300027641|Ga0208827_1114559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4784Open in IMG/M
3300027696|Ga0208696_1171752All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4695Open in IMG/M
3300027842|Ga0209580_10055936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1848Open in IMG/M
3300027869|Ga0209579_10143502All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41271Open in IMG/M
3300027869|Ga0209579_10403144All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300027986|Ga0209168_10099906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1497Open in IMG/M
3300027986|Ga0209168_10163329All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1125Open in IMG/M
3300029984|Ga0311332_11554018All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4537Open in IMG/M
3300030494|Ga0310037_10036271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42368Open in IMG/M
3300031232|Ga0302323_102724157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4565Open in IMG/M
3300031232|Ga0302323_103265241All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4517Open in IMG/M
3300031344|Ga0265316_10177545All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41586Open in IMG/M
3300031716|Ga0310813_11735088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4585Open in IMG/M
3300031718|Ga0307474_10823742All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4734Open in IMG/M
3300031962|Ga0307479_10274010All Organisms → cellular organisms → Bacteria1668Open in IMG/M
3300032160|Ga0311301_12318417All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4610Open in IMG/M
3300032160|Ga0311301_12658938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4553Open in IMG/M
3300032783|Ga0335079_11378590All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4701Open in IMG/M
3300032828|Ga0335080_10085765All Organisms → cellular organisms → Bacteria3494Open in IMG/M
3300032954|Ga0335083_11555955All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4500Open in IMG/M
3300033158|Ga0335077_10087809All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3676Open in IMG/M
3300033402|Ga0326728_10017838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus14119Open in IMG/M
3300033402|Ga0326728_10176738All Organisms → cellular organisms → Bacteria2222Open in IMG/M
3300033405|Ga0326727_10368585All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300033412|Ga0310810_10301983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41719Open in IMG/M
3300033755|Ga0371489_0366542All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4672Open in IMG/M
3300033819|Ga0334816_021982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41254Open in IMG/M
3300033983|Ga0371488_0229615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4919Open in IMG/M
3300034091|Ga0326724_0163130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41366Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen14.29%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil13.45%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil6.72%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.04%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.04%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil5.04%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.36%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.36%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.52%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.52%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.52%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.68%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.68%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300024233Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0EnvironmentalOpen in IMG/M
3300025441Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025579Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025857Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026271Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033819Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-MEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062593_10228788113300004114SoilDGTRAQFRQTDPGGAQRGIMQKISDSCSAADLQKKYTFTVSGNTTPVQPGEVPHTISAEGTLDVAENGTFQVDSDCSIHFVLMLPPGPSPTTISPMTMRGFLVNGGKEILAFQTDPGAMVAARFRPTQSN*
Ga0070682_10193952323300005337Corn RhizosphereACSAADLQKNYSYTVSGSTTPMQPDELSHIVSGKGALDTARNGSFQVDSDCCVRFVLVLPAQDGKVAEPSPVMNMRGFLVDGGKEILAFQTDPGAMVSARFTSDSR*
Ga0070671_10192496413300005355Switchgrass RhizosphereLQKNYSYTVSGSTTPMQPDELSHIVSGKGALDTARNGSFQVDSDCSVRFVLVLPAQDGKVAEPSPVMNMRGFLVDGGKEILAFQTDPGTMVSARFASDSR*
Ga0070705_10155408613300005440Corn, Switchgrass And Miscanthus RhizosphereTPMQPGEVSHTVSAEGTLDVAENGSFQVDSDCSVNFVLTVPPGPSPMNMRGFLVNGGKEILAFQTDPGAMVAARFRSVENDR*
Ga0070735_1003383513300005534Surface SoilMQQTSDTCSAADLQKKYKFTVSGSTTPMQPGEVSRTISADGTLDVAENGTFQVDSDCSIHFVLTLPPGPSPMTMRGFLVNGGKEILAFQTDPGAMVAARFRSDSK*
Ga0070730_1034815213300005537Surface SoilGIMQKTPDQCSTADLQKKYKFTVSGSTTPMQPGEGSHTVSAEGMLDVAENGSFQVDGDCSVNFVLTVPPGPSPMNMRGFLVNGGKEILAFQTDPGAMVAARLRTAGND*
Ga0070731_1035956933300005538Surface SoilAADLLKKYDYAVSGSTTPMQPGEVSHTVSAKGTLDIAENGSFQVESDCSVRFALTLPAQDGRVGGPSPMTMRGFLVNGGKEIFAFQTDPGAMVAARFTSVGR*
Ga0070686_10118508723300005544Switchgrass RhizosphereSAADLLRDYSYTVSGNTTPMQPGEVSHLVSGKGTLDTAGNGSFQVESDCSVRFVLILPAQDGQVAEPSPIMNMRGFLVDGGKEILAFQTDPGAMVSARLTSDSR*
Ga0068858_10046555413300005842Switchgrass RhizosphereVSGSTTPMQPDELSHIVSGKGALDTARNGSFQVDSDCSVRFVLILPAQDGKVAEPSPVMNMRGFLVDGGKEILAFQTDPGTMVSARFASDSR*
Ga0066795_1012586723300005938SoilTSDSCSAADLQKKYKFTVSGSITPMQPGEVPHTVSAEGTLDVAENGSFQVDSDCSVHFVWTLPHGPSPMTMRGFLVNGGNEILAFQTDPGAMVAARFRSDSKRLKTAARRKQF*
Ga0070716_10164116213300006173Corn, Switchgrass And Miscanthus RhizosphereGGVQHGIMQKTSDTCSAADLQTKYKFTISGSTTPVQPGEAPHTVSVEGTVDVIQNGSFQVDTDCSVHFVLTLSLGSSTMTMRGFLVNGGKEILAFQTDPGAMVAARFRSDSK*
Ga0097621_10200675713300006237Miscanthus RhizosphereTYTYTVSGRTTPMQSDEVSHIVSGKGILDTARNDSFQVDSDCSVRFVLVLPAQDGEVAEPSPVMNMRGFLVDGGKEILAFQTDPGAMVSARFTSDSR*
Ga0079221_1090815923300006804Agricultural SoilVSGSTTPMQPGEGSHTVSAEGMLDIAENGSFQVDGDCSVSFVLTVPPGPSPMNMRGFLVNGGKEILAFQTDPGAMVAARLRTAGNDR*
Ga0099794_1031632323300007265Vadose Zone SoilSTTPMQPGEVAHSISTAGTLDVAENGSFQVDSDCSVHFVLTPPPGPSRMTMPPMTMRGFLVNGGKEILAFQTDPGSMVAARFKSDSK*
Ga0099829_1122310723300009038Vadose Zone SoilMQKMRDKCSAADLMRKYSFTVSGSTTPMQAGEVGRTVSGKGTLEIAENGSFQVESDCSVNFKLTLPDGLPMTMRGFLVNGGMEILAFQTDPGAMVSARLSAL*
Ga0105240_1136443813300009093Corn RhizospherePMQPGEVSHTVSAEGTLDVAENGSFQLDGDCSVNFVLTVPPGPSPMNMRGFLVNGGKEILAFQTDPGAMLAARLRTAGNDR*
Ga0075418_1212608323300009100Populus RhizospherePGGAQRGIMQKMPDRCSAADLQKKYEFVVSGSTTPMQPGQVGRAVSAKGTVDTAENGSFQVESDCSVLFQLTLPGGLPMKMRGFLVDGGKEILGFLTDPGAMVAVRLSSGEKVADAN*
Ga0105104_1060315523300009168Freshwater SedimentSGSTTPMQPGDVPHMVSASGILDIAENGSFRVESDCSVRFGLTLAAQDGRAELPTMNMRGFLITGGREILTFQTDPGAMVAGRLIFDGK*
Ga0105241_1023650123300009174Corn RhizosphereLQKKYYFTVSGSTTPMQPGDASRVVSARGTLDVAENGSFRVESDCAVRFRLTLPAQDGKAAELSTMAMRGFLVSGGREILAFQTDPGAMVAARFTSDGR*
Ga0116128_119998313300009518PeatlandKYDFTVSGSIMPMQAGEVAHTLSAKGTLDIAENGSFEVDSDCSVRFEWILPAEDEQDAEPSLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSGGK*
Ga0116214_120649713300009520Peatlands SoilPGGAQRGIMQKTSDTCSAADLLKKYSFTVSGSTTPMQPGEVPHTVSAKGTLDIAENGSFQVESDCSVRFGWTIPAQEGLAAGPLPMTMRGFLVNAGKEILAFQTDPGAMVAARFTSNIK*
Ga0116222_143998913300009521Peatlands SoilAQRGIMQKTSDTCSAADLLKKYSFTVSGSTTPMQPGEVPHTVSAKGTLDIAENGSFQVESDCSVRFGWTIPAQEGLAAGPLPMTMRGFLVNAGKEILAFQTDPGAMVAARFTSNIK*
Ga0116218_144833723300009522Peatlands SoilSGSTTPMQPGEVPHTVSAKGTLDIAENGSFQVESDCSVRFGWTIPAQEGLAAGPLPMTMRGFLVNAGKEILAFQTDPGAMVAARFTSNIK*
Ga0116221_114171323300009523Peatlands SoilFTVSGSTTPMQPGEVPHTVSAKGTLDIAENGSFQVESDCSVRFGWTIPAQEGLAAGPLPMTMRGFLVNAGKEILAFQTDPGAMVAARFTSNIK*
Ga0116220_1012721223300009525Peatlands SoilFSGKLSTDGTEVQFRQTDPGVGPRGVMMKTPDTCSAEDLRKEYGFTISGSTTPMQAGDVARTVSGKGTLDVAENGSFQVDSDCSVRFDLKVPDQDGEPSLITMRGFLVSGGKEILAFQIDPGAMVAARLSSDAK*
Ga0116220_1019902723300009525Peatlands SoilGIMRKTPDTCSAADLLKKYSFTVSGSTTPMQPGDVPHTVSAAGTVDIAENGTFQVSSDCSVQFELTLTPQDGRAAGPSPMAMRGFLVNGGKEILAFQTDPGAMVAARFLPDTNK*
Ga0116138_108007613300009552PeatlandLLKKYDFTVSGSIMPMQAGEVAHTLSAKGTLDIAENGSFEVDSDCSVRFEWILPAEDEQDAEPLLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSNGR*
Ga0116103_100993043300009615PeatlandMQKTSDTCSAADLLKKYDFTVSGSTIPMQDGEVAHVVSAKGTLDIAENGSFQVESDCSVQFEWTLPDQDGEVAEPSPMAMRGFLVNGGKEILAFQTDPGAMVAARFTSNGR*
Ga0116119_119677513300009629PeatlandFTVSGSIMPMQAGEVAHTLSAKGTLDIAENGSFEVDSDCSVRFEWILPAEDEQDAEPSLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSGGK*
Ga0116224_1033910723300009683Peatlands SoilKTPDTCSAEDLRKEYGFTISGSTTPMQAGDVARTVSGKGTLDVAENGSFQVDSDCSVRFDLKVPDQDGEPSLITMRGFLVSGGKEILAFQIDPGAMVAARLSSDAK*
Ga0116217_1022789323300009700Peatlands SoilTPMQPGQVAHTVSATGTLDIAENGSFQVESDCSVEFEFTVPVHSGQAVEPFPMAMRGFLVNGGQEILAFQTDPGAMVAARFTSIER*
Ga0116134_128649223300009764PeatlandMMQNTSDTCSAADLLKKYDFTVSGSIMPMQAGEVAHTLSAKGTLDIAENGSFEVDSDCSVRFEWILPAEDEQDAEPSLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSGGK*
Ga0116219_1003812823300009824Peatlands SoilRFRRLSEFQREAFDRRNRVQFRQTDPGVGPRGVMMKTPDTCSAEDLRKEYGFTISGSTTPMQAGDVARTVSGKGTLDVAENGSFQVDSDCSVRFDLKVPDQDGEPSLITMRGFLVSGGKEILAFQIDPGAMVAARLSSDAK*
Ga0136449_10011119123300010379Peatlands SoilLHDDVETAGRFHGFQNFSGKLSTDGTEVQFRQTDPGVGPRGVMMKTPDTCSAEDLRKEYGFTISGSTTPMQAGDVARTVSGKGTLDVAENGSFQVDSDCSVRFDLKVPDQDGEPSLITMRGFLVSGGKEILAFQIDPGAMVAARLSSDAK*
Ga0136449_10227698333300010379Peatlands SoilVQRGIMQKTSDNCLAADLRKKYNFTVSGSTTPMVPGEVPRTVSSKGTINIAENGSFEVGSDCSIHFVLTLPPEPSPMTMRGFLVDGGTEILAFQTDPGAMVAARFNADTK*
Ga0105246_1163644113300011119Miscanthus RhizosphereLLKRYSYTVSGSTTPMRRGDVAHTVDAKGTVDIAENGSFQVDSDCSVRFALTLPDPDGTLTMRGFLVNGGLEILAFQTDPGAMVSARFSPSPK*
Ga0150983_1441241223300011120Forest SoilCSAADLKQKYKFAVSGSTTPMQADQVSRTVSAEGTVDTAENGSFQVDSNCAVHFVLTLPPEPSPMTMRGFLVNGGKEILAFQTDPGAMVAARFKSDAK*
Ga0137389_1071330523300012096Vadose Zone SoilDLQKKYKFTVFGSTTPMQPGEVPQTVSVEGTVDVAENGSFQVDTDCSVQFVLTLPPEPSPMNMRGFLVNGGKEILAFQTDPGAMVAARFKSDTK*
Ga0137407_1109418323300012930Vadose Zone SoilDPGGAQRGIMQKTSDTCSAADLQQKYTFTVSGTTIPMQPGEVRHKVSAEGTLDVAGNGTFEVDSDCSVRFVLTLPPGPSPTNLPPMTMRGFLVNGGKEILAFQTDPGAMVAARFKSDSK*
Ga0163162_1111390833300013306Switchgrass RhizosphereCSAADLQKNYSYTVSGSTTPMQPDELSHIVSGKGALDTARNGSFQVDSDCSVRFVLVLPAQDGKVAEPSPVMNMRGFLVDGGKEILAFQTDPGTMVSARFASDSR*
Ga0181521_1023500413300014158BogGETSHTVSAKGTVDVAENGSFQVESDCSVRFGLTLPDRDGRPAEPSPMNMRGFLVEGGKEILAFQTDPGAMVAARLSPVTK*
Ga0181529_1050561213300014161BogQRGIMQKTSDTCSATDLLKKYDFTVSGSTIPMQAGEVAQAVSAKGTLDIAANGSFQVDSDCSVRFGWVLPAEDGQDTEPSLMAMRGFLVNGGKEILAFQIDPGAMVAARFTSNGK*
Ga0181532_1046394413300014164BogTDPGGAQQGIMQKTSDTCSAADLQKKYDFTVSGSTIPMQDNEVAHTVSAKGTLDVAENGSFQVESDCSVQFEWILPAEDEQDAEPLLMAMRGFLVNGGKEVLAFQTDPGAMVAARFTAGGK*
Ga0181523_1020010413300014165BogPGGAQRGMMQNTSDTCSAADLLKKYDFTVSGSIMPMQAGEVAHTLSAKGTLDIAENGSFEVDSDCSVRFEWILPAEDEQDAEPSLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSGGK*
Ga0182010_1067622313300014490FenTIPMQDGEVGHAVAAKGTLDIAENGSFEVEADCSVRFGWTLPARAGQVEEPPLVAMRGFLVDGGKEILAFQTDPGAMVAARFTSNGK*
Ga0182010_1080636023300014490FenDPGGAQRGMMQKTSDTCSAADLLKKYNFTVSGSTVPMLEGEVAHTVAAKGTLDIAENGSFEVGSDCSVRFEWMLPAEDEQDAEPLLMAMRGFLVDGGKEILAFQTDPGAMVAARFTSNGK
Ga0182010_1086951123300014490FenGQVPHTVSAKGTLDIAGNASFRVESDCSVTFGLTLPPKDGQVDQPPPMNMRGFLVNGGKEILAFQTDPGAMVSARLTSDGR*
Ga0182014_1013811843300014491BogDGTRVQFTQTVSGGAQRGMMQKTSDTCSAADLLKKYDFTVSGNTVPMEAGEVGHAVSAKGTLDIAENGSFQVETDCSVRFGWTLPARDGQVDEPPLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSGGK*
Ga0182014_1031668013300014491BogTVSGSTIPMQAGEVGHAVSAKGTLDIAENGSFQVESDCSVRFGWTLPARDGQVAEPSLMAMRGFLVDGGKEILAFQTDPGAMVAARFTSGGK*
Ga0182017_1068843413300014494FenDLPKKYDFTVSGSTIPMQDGEVAHAVSAKGTLDIAENGSFEVGSDCSVRFEWMLPAEDEQDAEPLLMAMRGFLVDGGKEILAFQTDPGAMVAARFTSNGK*
Ga0182017_1071874023300014494FenDFTVSGSTIPMQDGEVGHTVAAKGTLDIAENGSFEVESDCSVRFGWTLPDQDGQATEPSLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSNGK*
Ga0182017_1089697613300014494FenVLGGGSPAEVSLHGLGSVTPMLPGEVPRTVSANGTLDIAENGSFQVESDCSVRFELTLPARDGQAGEPPAMTMRGFLVDGGKEILAFQTDPGAMVAARFSSGAK*
Ga0182011_1054131913300014496FenSDACSAADLLKKYDFTVSGSTIPMQDGEVGRAVSAKGTLDIAENGSFQVGSDCSVRFEWILPAEDEQDAEPLLMAMRGFLVDGGKEILAFQTDPGAMVAARFTSGAK*
Ga0182011_1054282113300014496FenSFTVSGSATPMLPGEASRTVSAKGTLDVAANGSFQVDSDCSVRFGLTLPAPDGQVDAPLPMNMRGFLVDGGREIIAFQTDAGAMVAARFSSDKN*
Ga0182019_1087292513300014498FenAAQHGIMKKIPGACSVADLGQKYSYTVSGSTTPMLPGQVPHTVSAKGTLDIAGNASFRVESDCSVTFGLTLPPKDGQVDQPPPMNMRGFLVNGGKEILAFQTDPGAMVSARFTSDGR*
Ga0182021_1236537013300014502FenSAADLLKKYDFTVSGSIIAMQEGEVAYAVSAKGTLDIAENGSFQVESDCSVRFGWALPNGDGQIAPPSPMAMRGFLVDGGKEILAFQTDPGAMVAARFTSNGK*
Ga0182021_1281997213300014502FenDTCSAADLLKKYNFTVSGNTVPMQEGEVAHAVAAKGTLDIAENGSFQVASDCSVRFEWILPAEDEQDAEPLLMAMRGFLVDGGKEILAFQTDPGAMVAARFTSNGK*
Ga0182027_1012362243300014839FenMQPGEISRTVSAKGTLDIAENGTFQVDSDCSVRFGLTLPAEGGQVPEPPAMAMRGFLVDGGKAILAFQTDAGAMVTAQLTSDAQKVREQPPRAAGRP*
Ga0182027_1041515813300014839FenGAQRGIMQKTSDACSAADLLKKYDFTVSGSTIPMQDGEVGRAVSAKGTLDIAENGSFQVGSDCSVRFEWILPAEDEQDAEPLLMAMRGFLVDGGKEILAFQTDPGAMVAARFTSGAK*
Ga0182027_1097729113300014839FenGTVSTNGTLVQFTQTDPGGAQRGIMRKTSDACSAADLLKEYDFTVSGSTIPMQDGEVGHAVAAKGTLDIAENGSFEVDADCSVRFGWTLPARAGQVDEPPLMAMRGFLVDGGKEILAFQTDPGAMVAARFTSNGK*
Ga0182027_1120693613300014839FenGIMQRTSDTCSAADLLKKYDFTVSGNTIPMEAGEVPRAVSAKGTLDIAENGSFQVETDCSVRFEWILSAKDEQDAEPLLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSNGK*
Ga0182027_1199036813300014839FenGAQRGIMQKTSDACSAADLLKKYDFTVSGSTIPMQDGEVGHTVAAKGTLDIAENGSFEVESDCSVRFGWTLPARDGQVTEPSLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSSGK*
Ga0157376_1046632633300014969Miscanthus RhizosphereADLLKNYSYTVSGSTTPMQPGEVSHLVSGKGILDTARNDSFQVDSDCSVRFVLVLPAQDGEVAEPSPVMNMRGFLVDGGKEILAFQTDPGAMVSARFTSDSR*
Ga0132258_1102192523300015371Arabidopsis RhizosphereMFDGSSRCRPPRGDGSQKKYYVTVSGSTTPMQPGEAPRVVSARGTLDVAENGSFQVEGDCSVRFGLTLLAQDGKADELSTMAMRGFLVSGGREILAFQTHPSAMLAARFTSGGR*
Ga0132257_10420991023300015373Arabidopsis RhizosphereRGDGSQKKYYVTVSGSTTPMQPGEAPRVVSARGTLDVAENGSFQVEGDCSVRFGLTLLAQDGKADELSTMAMRGFLVSGGREILAFQTHPSAMLAARFTSGGR*
Ga0132255_10211614413300015374Arabidopsis RhizosphereMFDGSSRCRPPRGDGSQKKYYVTVSGSTTPMQPGEAPRVVSARGTLDVAENGSFQVEGDCSVRFGLTLLAQDGKADELSTMAMRGFLVSGGREILAFQIDPGAMVAVRFTSRQVKP*
Ga0181515_142450213300016730PeatlandTQTDPGGAQRGMMQNTSDTCSAADLLKKYDFTVSGSIMPMQAGEVAHTLSAKGTLDIAENGSFEVDSDCSVRFEWILPAEDEQDAEPSLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSGGK
Ga0187818_1055969713300017823Freshwater SedimentFKQTDPGGAQRGIMQKTPNACSAADLLKEYYFTVSGSTTPMLPGEVPHTVSAKGTLDIAENGSFQVESDCSIRFELTLLAQDGRGAEPSPMTMRGFLVNGGKEILAFQTDPGAMVAARFSADTK
Ga0187877_111038123300017931PeatlandFTVSGSTIPMQNGEVAQAVSAKGTLDVAENGSFQVESDCSVRFEWILPAEDEQDAEPLLMAMRGFLVNGGKEILAFQTDPGAMVAARFISNGK
Ga0187853_1050593823300017940PeatlandGIMQRTSDTCSAADLLKKYDFTVSGSTIPMQNGEVAQAVSAKGTLDVAENGSFQVESDCSVRFEWILPAEDEQDAEPLLMAMRGFLVNGGKEILAFQTDPGAMVAARFISNGK
Ga0187819_1086400213300017943Freshwater SedimentQRGIMQKTSDNCSAADLRKKYHFTVSGSTTPMLPGEVSRTVSAKGTLDIVENGSFQVESDCSVRFEVTLPAQDGRVAPPMTMRGLLVNGGKEILAFQTDPGAMVAARFSADTK
Ga0187891_116107813300017996PeatlandKKYDFTVSGRTIPRQDGEVAQEVSAKGTLDIAENGSFEVDSDCSVRFEWILPAEDEQDAEPSLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSGGK
Ga0187884_1003129913300018009PeatlandTDPGGAQRGMMQNTSDTCSAADLLKKYDFTVSGSIMPMQAGEVAHTLSAKGTLDIAENGSFEVESDCSVRFEWILPAEDEQDAEPSLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSGG
Ga0187867_1004108933300018033PeatlandPGETSHTVSAKGTVDVAENGSFQVESDCSVRFGLTLPDRDGRPAEPSPMNMRGFLVEGGKEILAFQTDPGAMVAARLSPVTK
Ga0184624_1043674713300018073Groundwater SedimentTFTVSGRTTPMQPDEVSHFVSGKGTLDTGNGSFQVDSDCSVRFVLMLQAQDGQVAEPSPIMSMRGFLVNGGKEILAFQTDPGAMVAARFTSDGR
Ga0184628_1006372913300018083Groundwater SedimentVRFKQTDPGGAPHGIMKKTSDACSAADLMKNYSYTVSGRTTPIQTDETSHMVSGKGTLDTARNGSFQVDSDCSVRFVLILLAQDGQVAEPSPIMNMRGFLVDSGREILAFQTDPGAMVSARFTSDSR
Ga0182028_139800613300019788FenMRKTSDACSSADLLKEYDFTVSGSTIPMQDGEVGHAVAAKGTLDIAENGSFEVEADCSVRFGWTLPARAGQVDEPPLMAMRGFLVDGGKEILAFQTDPGAMVAARFTSNGK
Ga0210394_1069100913300021420SoilPDSCTPADLQKQYKFSVFGSTTPMQSSEVPRKVSAEGTLDVTENGSFQVDGDCSVHFVLALPPVPSPMTMRGFLVNGGKEILAFQTDPGAMVAARFISDTK
Ga0210390_1074521723300021474SoilSTSDLRKKYYFTVSGSTTPMLPGDVARTVSAKRTLDTAENGSFQVDSDCTVRFQWTLPSQDGQIAEPVPVTMRGFLVNGGKEILAFQTDPGAMVAARFSADTK
Ga0224559_128096013300023091SoilPGGAQRGIMKKTSDACSAADLQPKYHFTVSGSVIPMLPGEISRTVSASGTLDIGENGSFEVDSDCAVRFALTLPAQNAQGGEPPPMTMRGFLVEGGKEILAFQTDPGAMVAARLSSDSK
Ga0224521_113688113300024233SoilAQRGIMQKTSDACSAADLLKKYDFTVSGSTIPMQEGEVAQAVAAQGTLDVAENGSFQVESDCSVRFEWILPAEDEQDAEPLLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSHGK
Ga0208456_101743413300025441PeatlandTCSAADLLKKYDFTVSGSTIPMQDGEVAHVVSAKGTLDIAENGSFQVESDCSVQFEWTLPDQDGEVAEPSPMAMRGFLVNGGKEILAFQTDPGAMVAARFTSNGR
Ga0207927_104309123300025579Arctic Peat SoilMQLEAFVAAQHGIMKKIPGACSTADLPQKYSYTVSGSTTPMVPGQVPHTVSAKGTLDIARNGSFQVESDCSVTFGLTLPPQDGQVDQPPPMNMRGFMVNGGKEILAFQTDPGTMVSARLTSDGR
Ga0209014_1002591713300025857Arctic Peat SoilCSTADLPQKYSYTVSGSTTPMVPGQVPHTVSAKGTLDIARNGSFQVESDCSVTFGLTLPPQDGQVDQPPPMNMRGFMVNGGKEILAFQTDPGTMVSARFTSDAR
Ga0209584_1016987013300025878Arctic Peat SoilPAACAAADLGQKYSFTVSGATTPMLPGQVPHAVSGKGTLDIARNGSFQVASDCSVTFGLTLPPQDGQVDQPPPMNMRGFLVGGGKEILAFQTDPGSMVAAHFMAGAK
Ga0207642_1025692633300025899Miscanthus RhizosphereTTPMQPDEVSHIVSGQGTLDTARNDSFQVDSDCSVRFVLILPAQDGQVAEPSPIMNMRGFLVDGGKEILAFQTDPGAMVSARLTSDSR
Ga0207685_1021033723300025905Corn, Switchgrass And Miscanthus RhizosphereMQKISDSCSAADLQQKYTFKVSGSTTPVQPGEVAHTIATEGTVDVAENGTFQVESDCSLHFVLTLPPGLSPIVIPPMTMRGFLVNGGKEILAFQTDPGAMVAARFKAMESN
Ga0207654_1028248923300025911Corn RhizosphereGAQRGIMQKTPDQCSTADLQKKYKFTVSGSTTPMQPGEGSHTVSAEGTLDVAENGSFQVDSDCSVNFVLTVPPGPSPMNMRGFLVNGGKEILAFQTDPGAMVAARLRTAGNDR
Ga0207686_1121759113300025934Miscanthus RhizosphereYDYTISGSTTPMRVGDVARTITAKGTFDVAENGSFQVESDCLVRFALTIAVQDGTSPVTMTMRGFLVNGGLEILAFQTDPGAMVSARFSPSSK
Ga0209880_104633523300026271SoilVSVGWATSVQFKQTDPGGAERGIMKKTSGTCSAADLLKNYYFTVSGSTTPMQPGQVPHTVSAQGTLDIARNGGFQVASDCSVRFGLTLSARYGRVAEPSPMTMRGFLVNGGKEILAFQTDPGAMVSARFTSDAR
Ga0208827_111455923300027641Peatlands SoilLLKKYSFTVSGSTTPMQPGEVPHTVSAKGTLDIAENGSFQVESDCSVRFGWTIPAQEGLAAGPLPMTMRGFLVNAGKEILAFQTDPGAMVAARFTSNIK
Ga0208696_117175213300027696Peatlands SoilDPGGAQRGIMRKTPDTCSAADLLKKYSFTVSGSTTPMQPGDVPHTVSAAGTVDIAENGTFQVSSDCSVQFELTLTPQDGRAAGPSPMAMRGFLVNGGKEILAFQTDPGAMVAARFLPDTN
Ga0209580_1005593633300027842Surface SoilKYKFTVSGSSTPMQPGEVPQTISAKGTLDVAANGTFQVDSDCSVHFVLTLPQAVSPMNMRGFLVNAGKEILAFETDPGAMVAARFRSDSK
Ga0209579_1014350213300027869Surface SoilKSYRFALSGSTTPMQTGDVAHAVSAHGTLNVEENGSFQVDTDCTVHFTLTLPPEASQMTMRGFLVNGGKEILAFQTDPGAMVAARLQSDPK
Ga0209579_1040314413300027869Surface SoilSTTPMQPGEVSHTVSAKGTLDIAENGSFQVESDCSVRFALTLPAQDGRVGGPSPMTMRGFLVNGGKEIFAFQTDPGAMVAARFTSVGR
Ga0209168_1009990613300027986Surface SoilVSADRPGGAPQGIMQQTSDTCSAADLQKKYKFTVSGSTTPMQPGEVSRTISADGTLDVAENGTFQVDSDCSIHFVLTLPPGPSPMTMRGFLVNGGKEILAFQTDPGAMVAARFRSDSK
Ga0209168_1016332923300027986Surface SoilPGGAKRGIMQKTPDTCSVADLQQKYKFTVSGSTTPMQPGEVPHAVSAAGTLDVAQNGSFQVDGDCSVHFVLALSAETSPMSLRGFLVNGGREILAFQTDPGAMVTARLRSDSK
Ga0311332_1155401823300029984FenKYSYTISGSTTPMLPGQVPHTVSAKGTLDIARNGSLQVESDCSVTFGFTLPPQDGQVDQPPPMNMRGFLVNGGKEILAFQTDPGAVVSASLTSDGR
Ga0310037_1003627113300030494Peatlands SoilSGSTTPMQAGDVARTVSGKGTLDVAENGSFQVDSDCSVRFDLKVPDQDGEPSLITMRGFLVSGGKEILAFQIDPGAMVAARLSSDAK
Ga0302323_10272415723300031232FenAATLQKKYAYTVAGSTTPMRPGEVAHTVDDKGTLDVAQNGSFQVDSDCSVRFSLTIPDGTLTMRGFLVNGGLEILAFQTDPGAMVSARFSPSR
Ga0302323_10326524123300031232FenCSAADLLKKYEFTVSGSTIPMQDGEVGHAVAATGTLDTADNGSFQVETDCSVRFGWTLPARAGQVDKPPLMAMRGFLVDGGKEILAFQTDPGAMVAARFTSNGK
Ga0265316_1017754513300031344RhizosphereSGNTIPMEAGEVAHVVSAKGTLDIAENGSFQVGSDCSVRFEWILPAEDEQDAEPLLMAMRGFLVDGGKEILAFQTDPGAMVAARFTSGGR
Ga0310813_1173508823300031716SoilKYTFTVSGNTTPVQPGEVPHTISAEGTLDVAENGTFQVDSDCSIHFVLMLPPGPSPTTISPMTMRGFLVNGGKEILAFQTDPGAMVAARFRPTQSN
Ga0307474_1082374213300031718Hardwood Forest SoilSDLQKKYKFTVSGSTTPMQPGEVPHAVSADGILDVAENGTFQVDTDCSVHFVLTLPSASPPMAMRGFLVNGGMEILAFQTDPGAMVAARFSSASI
Ga0307479_1027401013300031962Hardwood Forest SoilVSGSTEAMQPADVPHSVSAKGTVDIGGNGSFQVESDCSVQFTLTIPAQDGRLAEPSVINMRGFLVDGGKEILAVETDPGAVVSARLTATEK
Ga0311301_1231841723300032160Peatlands SoilVQRGIMQKTSDNCLAADLRKKYNFTVSGSTTPMVPGEVPRTVSSKGTINIAENGSFEVGSDCSVHFVLTLPPEPSPMTMRGFLVDGGTEILAFQTDPGAMVAARFNADTK
Ga0311301_1265893813300032160Peatlands SoilGAQRGILKKTSDSCSAGDLLEKYNYTVSGSTTPMQSGEVAHAVSATGTLYIVENGTFQVDSDCSVRFGLTLPPQEGGVAASPPMTMRGFLVDGGKEILAFQTDPGAMVAARFSSDTK
Ga0335079_1137859023300032783SoilNLKKKYSYTIAGNTTPMKPGDVPHTVSAEGAIDIAQNGTFSVDSDCSVQFAWTLPARGAPAVWLPIHMRGFLVNEGKEILAFQTDPGAMVAAHLTWVP
Ga0335080_1008576553300032828SoilTDPGGAQNGIMQKISDRCSAADLQKKYKFTVSGSTTPMQSDEVPQTVSAEGTLVVDENGTFQVDSDCSVHFVWTLPHGPLPMTMRGFLVNGGKEILAFQTDPGAMVAARFTSDAK
Ga0335083_1155595513300032954SoilSAVDLHKKYRFTVSGSTTPMQSDEVPHTVSAEGTLDVAENGSFQVDSDCSVHFVWTLPDGPSPMTMRGFLVNGGKEILAFQTDPGAMVAARFISDTR
Ga0335077_1008780913300033158SoilKYKFTVSGSTTPMQSGEVPRAVSAEGTLDVAANGSFQVDSDCSVHFVWTLPHEPSPITMRGFLVNGGKEILAFQTDPGAMVAARFTSATK
Ga0326728_1001783893300033402Peat SoilMLDGEVAHTVSAKGTLDIAENGSFEVDSDCSVRFEWILPDQDGQDAEASPITMRGFLVDGGKQILAFQTDPGAMVAARFTSGGK
Ga0326728_1017673823300033402Peat SoilLGIGGQAADVCDPADLLKKYDFTVSGSTIPMQDGEVPHTVAAKGILDIAENGSFQVESDCSVRFGWTLPDQDGQVEEPPLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSNGR
Ga0326727_1036858533300033405Peat SoilLGIGGQAADVCDPADLLKKHDFTVSGSTIPMQDGEVPHTVAAKGILDIAENGSFQVESDCSVRFGWTLPDQDGQVEEPPLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSNGR
Ga0310810_1030198313300033412SoilTADLQKKYKFTVSGSTTPMQPGEGSHTVSAEGTLDVAENGSFQVDGDCSVNFVLTVPPGPSPMNMRGFLVNGGKEILAFQTDPGAMVAARLRTAGNDR
Ga0371489_0366542_376_6723300033755Peat SoilLKKYDFTVSGRTIPMQDGEVAQEVSAKGTLDIAENGSFEVESDCSVRFEWILPAEDEQDAEPLLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSSGK
Ga0334816_021982_23_2773300033819SoilMLEGEVAHTVAAKGTLDIAENGSFEVGSDCSVRFEWMLPAEDEQDAEPLLMAMRGFLVDGGKEILAFQTDPGAMVAARFTSNGK
Ga0371488_0229615_461_8293300033983Peat SoilLAVPPGFALGIGGQAADVCDPADLLKKHDFTVSGSTIPMQDGEVSHTVAAKGILDIAENGSFQVESDCSVRFGWTLPDQDGQVEEPPLMAMRGFLVNGGKEILAFQTDPGAMVAARFTSNGR
Ga0326724_0163130_1038_13643300034091Peat SoilLAVPPGFALGIGGQAADVCDPADLLKKHDFTVSGSTIPMQDGEVSHTVAAKGILDIAENGSFQVESDCSVRFGWTLPDQDGQVEEPPLMAMRGFLVNGGKEILAFQTDP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.