| Basic Information | |
|---|---|
| Family ID | F075197 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSILR |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.12 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.44 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.782 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.210 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.059 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.68% β-sheet: 0.00% Coil/Unstructured: 76.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF01047 | MarR | 21.01 |
| PF07690 | MFS_1 | 10.92 |
| PF12802 | MarR_2 | 7.56 |
| PF13463 | HTH_27 | 5.04 |
| PF00378 | ECH_1 | 4.20 |
| PF13417 | GST_N_3 | 2.52 |
| PF02900 | LigB | 1.68 |
| PF03060 | NMO | 0.84 |
| PF00043 | GST_C | 0.84 |
| PF04909 | Amidohydro_2 | 0.84 |
| PF00171 | Aldedh | 0.84 |
| PF02321 | OEP | 0.84 |
| PF06230 | LpxI_C | 0.84 |
| PF02798 | GST_N | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.84 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.84 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.84 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.84 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.84 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.84 |
| COG3494 | Uncharacterized conserved protein, DUF1009 family | Function unknown [S] | 0.84 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.78 % |
| Unclassified | root | N/A | 46.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0299588 | Not Available | 579 | Open in IMG/M |
| 3300000956|JGI10216J12902_116226972 | Not Available | 821 | Open in IMG/M |
| 3300001471|JGI12712J15308_10181995 | Not Available | 549 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101290504 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101569884 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300002917|JGI25616J43925_10339859 | Not Available | 556 | Open in IMG/M |
| 3300003319|soilL2_10045887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
| 3300004082|Ga0062384_101368891 | Not Available | 520 | Open in IMG/M |
| 3300004091|Ga0062387_101698743 | Not Available | 512 | Open in IMG/M |
| 3300004114|Ga0062593_100901329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 894 | Open in IMG/M |
| 3300005334|Ga0068869_101396653 | Not Available | 620 | Open in IMG/M |
| 3300005337|Ga0070682_100604818 | Not Available | 866 | Open in IMG/M |
| 3300005341|Ga0070691_10316954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 856 | Open in IMG/M |
| 3300005466|Ga0070685_10211049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1267 | Open in IMG/M |
| 3300005535|Ga0070684_101973434 | Not Available | 551 | Open in IMG/M |
| 3300005547|Ga0070693_101045180 | Not Available | 620 | Open in IMG/M |
| 3300005578|Ga0068854_101627918 | Not Available | 589 | Open in IMG/M |
| 3300005591|Ga0070761_10883811 | Not Available | 564 | Open in IMG/M |
| 3300005616|Ga0068852_102031872 | Not Available | 597 | Open in IMG/M |
| 3300005718|Ga0068866_10931322 | Not Available | 613 | Open in IMG/M |
| 3300005844|Ga0068862_102615795 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005994|Ga0066789_10496297 | Not Available | 510 | Open in IMG/M |
| 3300006174|Ga0075014_100439638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300006176|Ga0070765_102127854 | Not Available | 524 | Open in IMG/M |
| 3300006195|Ga0075366_10669523 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300006358|Ga0068871_100886746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 826 | Open in IMG/M |
| 3300006638|Ga0075522_10021252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4082 | Open in IMG/M |
| 3300006641|Ga0075471_10480975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
| 3300006804|Ga0079221_11407258 | Not Available | 555 | Open in IMG/M |
| 3300006853|Ga0075420_101822877 | Not Available | 520 | Open in IMG/M |
| 3300007004|Ga0079218_12099692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300007004|Ga0079218_13801826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 513 | Open in IMG/M |
| 3300009147|Ga0114129_12302318 | Not Available | 647 | Open in IMG/M |
| 3300009551|Ga0105238_12276252 | Not Available | 577 | Open in IMG/M |
| 3300009624|Ga0116105_1215785 | Not Available | 535 | Open in IMG/M |
| 3300009661|Ga0105858_1219248 | Not Available | 567 | Open in IMG/M |
| 3300009701|Ga0116228_10610704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300011269|Ga0137392_10869694 | Not Available | 743 | Open in IMG/M |
| 3300012357|Ga0137384_10138708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2035 | Open in IMG/M |
| 3300012683|Ga0137398_10563218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 786 | Open in IMG/M |
| 3300012924|Ga0137413_10704405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300012929|Ga0137404_10739128 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| 3300012958|Ga0164299_11472876 | Not Available | 530 | Open in IMG/M |
| 3300013297|Ga0157378_12993638 | Not Available | 524 | Open in IMG/M |
| 3300014155|Ga0181524_10320276 | Not Available | 699 | Open in IMG/M |
| 3300014326|Ga0157380_10733853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
| 3300014498|Ga0182019_10978766 | Not Available | 613 | Open in IMG/M |
| 3300015373|Ga0132257_101033870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1035 | Open in IMG/M |
| 3300016387|Ga0182040_11128468 | Not Available | 657 | Open in IMG/M |
| 3300017972|Ga0187781_10132356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1744 | Open in IMG/M |
| 3300017975|Ga0187782_11673831 | Not Available | 503 | Open in IMG/M |
| 3300018060|Ga0187765_11178761 | Not Available | 536 | Open in IMG/M |
| 3300018062|Ga0187784_11575873 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300018476|Ga0190274_11379700 | Not Available | 793 | Open in IMG/M |
| 3300019890|Ga0193728_1157292 | Not Available | 994 | Open in IMG/M |
| 3300020580|Ga0210403_10982182 | Not Available | 662 | Open in IMG/M |
| 3300020582|Ga0210395_11448713 | Not Available | 500 | Open in IMG/M |
| 3300021168|Ga0210406_11375352 | Not Available | 505 | Open in IMG/M |
| 3300021171|Ga0210405_10579853 | Not Available | 875 | Open in IMG/M |
| 3300021181|Ga0210388_10179373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1848 | Open in IMG/M |
| 3300021402|Ga0210385_10623549 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300021403|Ga0210397_10628860 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
| 3300021403|Ga0210397_11609570 | Not Available | 504 | Open in IMG/M |
| 3300021406|Ga0210386_11122811 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300021420|Ga0210394_10059347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3330 | Open in IMG/M |
| 3300021474|Ga0210390_10919864 | Not Available | 718 | Open in IMG/M |
| 3300022915|Ga0247790_10169445 | Not Available | 569 | Open in IMG/M |
| 3300024251|Ga0247679_1017274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1230 | Open in IMG/M |
| 3300025906|Ga0207699_10256460 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300025926|Ga0207659_11737246 | Not Available | 531 | Open in IMG/M |
| 3300025931|Ga0207644_11774983 | Not Available | 516 | Open in IMG/M |
| 3300025934|Ga0207686_10697773 | Not Available | 806 | Open in IMG/M |
| 3300025940|Ga0207691_11273762 | Not Available | 608 | Open in IMG/M |
| 3300025942|Ga0207689_10578081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 944 | Open in IMG/M |
| 3300025961|Ga0207712_11384864 | Not Available | 629 | Open in IMG/M |
| 3300026095|Ga0207676_10201991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1757 | Open in IMG/M |
| 3300026095|Ga0207676_10509630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1144 | Open in IMG/M |
| 3300026291|Ga0209890_10079912 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300026320|Ga0209131_1043904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2553 | Open in IMG/M |
| 3300027523|Ga0208890_1000595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3365 | Open in IMG/M |
| 3300027528|Ga0208985_1085873 | Not Available | 606 | Open in IMG/M |
| 3300027729|Ga0209248_10016292 | All Organisms → cellular organisms → Bacteria | 2329 | Open in IMG/M |
| 3300027867|Ga0209167_10351792 | Not Available | 801 | Open in IMG/M |
| 3300027867|Ga0209167_10395748 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300027895|Ga0209624_10953733 | Not Available | 558 | Open in IMG/M |
| 3300028138|Ga0247684_1092635 | Not Available | 505 | Open in IMG/M |
| 3300028380|Ga0268265_12244021 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300028536|Ga0137415_10215145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1737 | Open in IMG/M |
| 3300028773|Ga0302234_10388653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300028794|Ga0307515_10443963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 914 | Open in IMG/M |
| 3300028808|Ga0302228_10480356 | Not Available | 548 | Open in IMG/M |
| 3300028906|Ga0308309_10447676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1112 | Open in IMG/M |
| 3300029882|Ga0311368_10388968 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300029951|Ga0311371_11355323 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300029987|Ga0311334_10802923 | Not Available | 774 | Open in IMG/M |
| 3300030007|Ga0311338_11927812 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300030058|Ga0302179_10031609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2467 | Open in IMG/M |
| 3300030490|Ga0302184_10245495 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300030524|Ga0311357_10257522 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300030618|Ga0311354_10189833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2206 | Open in IMG/M |
| 3300030618|Ga0311354_10601329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1068 | Open in IMG/M |
| 3300031027|Ga0302308_10372697 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300031028|Ga0302180_10370498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300031128|Ga0170823_16143942 | Not Available | 755 | Open in IMG/M |
| 3300031231|Ga0170824_102939935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300031233|Ga0302307_10320059 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300031234|Ga0302325_10233724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3096 | Open in IMG/M |
| 3300031547|Ga0310887_10464645 | Not Available | 756 | Open in IMG/M |
| 3300031708|Ga0310686_104007512 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031726|Ga0302321_100511696 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300031820|Ga0307473_10168836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1266 | Open in IMG/M |
| 3300031852|Ga0307410_10603295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 916 | Open in IMG/M |
| 3300031995|Ga0307409_100303098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1487 | Open in IMG/M |
| 3300032012|Ga0310902_11339066 | Not Available | 508 | Open in IMG/M |
| 3300032144|Ga0315910_10199667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1500 | Open in IMG/M |
| 3300032261|Ga0306920_101235978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPLOWO2_02_FULL_56_15 | 1077 | Open in IMG/M |
| 3300032892|Ga0335081_12198135 | Not Available | 581 | Open in IMG/M |
| 3300034163|Ga0370515_0067990 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300034965|Ga0370497_0182876 | Not Available | 537 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.20% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.20% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.36% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.68% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.68% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.84% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.84% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.84% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.84% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.84% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.84% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.84% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.84% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Host-Associated | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_02995882 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MATVESFSTFGLDPRRKLSYWNDRATETFSPLVSDP |
| JGI10216J12902_1162269722 | 3300000956 | Soil | MASVESFSTFGLDPRRKLTYWNDRATETFSPLVSDPADIRTFNGSIARATIGDLT |
| JGI12712J15308_101819951 | 3300001471 | Forest Soil | MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVF |
| JGIcombinedJ26739_1012905042 | 3300002245 | Forest Soil | MAPIVSFSTAGLDPRRKLAFWNDQACESFSPLVSDPVDIRTFHGSIARTTI |
| JGIcombinedJ26739_1015698841 | 3300002245 | Forest Soil | MRTIGGSNMARIVSFSTAGLDARRKLVHWNERASESFSPLVSDPVDIHTFNGSI |
| JGI25616J43925_103398591 | 3300002917 | Grasslands Soil | MAHIESFSTIGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGSIGD |
| soilL2_100458871 | 3300003319 | Sugarcane Root And Bulk Soil | MATVESFSTAGLDPRRKLAYWNERACESFSPLVSDPADIRTFNGSIARA |
| Ga0062384_1013688912 | 3300004082 | Bog Forest Soil | MAHIESFSTAGLDPRHKLTFWNDRASESFSPLVSEPQDIRAFNGSIARGTLGELS |
| Ga0062387_1016987431 | 3300004091 | Bog Forest Soil | MMLESFSTVGMDPRRKLTFWNDRASESFSPLVSEPDDIQMFNGSIVRGSI |
| Ga0062593_1009013291 | 3300004114 | Soil | MASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIARASIGDLTLA |
| Ga0068869_1013966531 | 3300005334 | Miscanthus Rhizosphere | MATIESFSTFGLDPRRKLTYWNERACESFSPLVSDPVDIR |
| Ga0070682_1006048182 | 3300005337 | Corn Rhizosphere | MATVESFSTTGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFNGSI |
| Ga0070691_103169542 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MASVESFSTYGLDPRRKLTYWNDRACETFSPLVSDPADIRSFNGSIARAAIGDLTL |
| Ga0070685_102110492 | 3300005466 | Switchgrass Rhizosphere | MAQIVSFTTAGLDPRRKLAYWNDRACESFSPLVSDPADIRSFNGSIARTA |
| Ga0070684_1019734342 | 3300005535 | Corn Rhizosphere | MASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIARASI |
| Ga0070693_1010451801 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVESFSTNGLDPRRKLNYWNDRASEAFSPLVSDPVDIRTFNGSI |
| Ga0068854_1016279182 | 3300005578 | Corn Rhizosphere | MASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIARASIGDLTL |
| Ga0070761_108838111 | 3300005591 | Soil | MAAIVSFSTAGLDPRRKLACWNDQASETFSPLVSD |
| Ga0068852_1020318721 | 3300005616 | Corn Rhizosphere | MATVESFSTTGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFN |
| Ga0068866_109313222 | 3300005718 | Miscanthus Rhizosphere | MATVESFSTFGLDPRRKLSYWNDRATETFSPLVSD |
| Ga0068862_1026157951 | 3300005844 | Switchgrass Rhizosphere | MAQIVSFTTAGLDPRRKLAYWNDRACESFSPLVSDP |
| Ga0066789_104962971 | 3300005994 | Soil | LVPIQSFSTAGMDPRRKLAFWNDRVSESLTPLVSEPVDVRDFNGSISQVSIDDMS |
| Ga0075014_1004396381 | 3300006174 | Watersheds | MAPIVSFSTAGLDPRRKLAFWNDQACESFSPLVSDPVDIRSFHGSIARTTIGELT |
| Ga0070765_1021278541 | 3300006176 | Soil | MAHIESFSTIGLDPRRKLAFWNDLASESFSPLVSEPQDIRVFNGSIVRGSIGDMT |
| Ga0075366_106695231 | 3300006195 | Populus Endosphere | MASVESFSTYGLDPRRKLTYWNDRACETFSPLVSDPADI |
| Ga0068871_1008867461 | 3300006358 | Miscanthus Rhizosphere | MATVESFSTAGLDPRRKLTYWNERACESFSPLVSDPADIRTFNGSIARASIGDLTLA |
| Ga0075522_100212526 | 3300006638 | Arctic Peat Soil | MTQIVSFSTAGVDPRRKAAYWNEHACESFSPLVSDPVDIRTFDGSIA |
| Ga0075471_104809752 | 3300006641 | Aqueous | MAQLQSYSTAGLDPRAKLQFWNDMASDCFSPLVSDP |
| Ga0079221_114072582 | 3300006804 | Agricultural Soil | MATVESFSTNGLDPRRKLNYWNDRASEAFSPLVSDPVDIR |
| Ga0075420_1018228772 | 3300006853 | Populus Rhizosphere | MATVESFSTAGLDPRRKLTYWNERACESFSPLVSDPADIRTFNGSIA |
| Ga0079218_120996922 | 3300007004 | Agricultural Soil | MATVESFSTAGLDPRRKLTYWNERACESFSPLVSDPADIR |
| Ga0079218_138018261 | 3300007004 | Agricultural Soil | MATVESFSTIGLDPRRKLNYWNERASESFSPLVSDPVDIRT |
| Ga0114129_123023181 | 3300009147 | Populus Rhizosphere | MAIVESFSTAGLDLRRKLTHWNERVSESAAPLFCDPADRTFNGS |
| Ga0105238_122762522 | 3300009551 | Corn Rhizosphere | MATVESFSTTGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFNGSIARATIGDLTLA |
| Ga0116105_12157852 | 3300009624 | Peatland | MAHIESFSTIGLDPRRKLAFWNDRASESFSPLVSEPQ |
| Ga0105858_12192482 | 3300009661 | Permafrost Soil | MAQIESFSTYGLDPRRKLAFWNDRANETFSPLVSEPEDIRLFNG |
| Ga0116228_106107042 | 3300009701 | Host-Associated | MAHIESFSTIGLDPRVKLAFWNDKASESFSPLVSQPDDIRFFNG |
| Ga0137392_108696942 | 3300011269 | Vadose Zone Soil | MAHIESFSTIGLDPRRKLAFWNDRANETFSPLVSEPEDIRVFNGSIV |
| Ga0137384_101387081 | 3300012357 | Vadose Zone Soil | MAHIESFSTAGLEPRRKLAFWNDRASESFSPMVSEPEDIRVFNGCIV |
| Ga0137398_105632182 | 3300012683 | Vadose Zone Soil | LAHIESFSTAGLDPRRKLAFWNDRVSESLTPLVSEPVDVRDFNGSISRV |
| Ga0137413_107044052 | 3300012924 | Vadose Zone Soil | MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSE |
| Ga0137404_107391282 | 3300012929 | Vadose Zone Soil | MAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSE |
| Ga0164299_114728761 | 3300012958 | Soil | MAQIVSFTTAGLDPRRKLAYGNDRACESFSPLVSDPADIRSFN |
| Ga0157378_129936381 | 3300013297 | Miscanthus Rhizosphere | MATVESFSTFGLDPRRKLNYWNDRASEAFSPLVSDPVDIRTFNGSIARATIGDLTL |
| Ga0181524_103202762 | 3300014155 | Bog | MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSILR |
| Ga0157380_107338531 | 3300014326 | Switchgrass Rhizosphere | MASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIA |
| Ga0182019_109787662 | 3300014498 | Fen | MDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGSIGDMTLSEVYSD |
| Ga0132257_1010338703 | 3300015373 | Arabidopsis Rhizosphere | MATVESFSTFGLDPRRKLSYWNDRATETFSPLVSDPVDIRTFNGSI |
| Ga0182040_111284681 | 3300016387 | Soil | MAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRVFNGSIVRGSIGDMSL |
| Ga0187781_101323563 | 3300017972 | Tropical Peatland | MTQIVSFSTVGLEPHRKLNCWNERASESFSPLVSDPVDLRSFNGSIART |
| Ga0187782_116738311 | 3300017975 | Tropical Peatland | MAEIESFSTIGLDPRRKLAFWNDWASESFSPLVSEPEDIHIFNG |
| Ga0187765_111787612 | 3300018060 | Tropical Peatland | MAVIESFSTAGLDPRRKLAYWNDLGSESFSPLVSDPVDIRTFNGSIS |
| Ga0187784_115758732 | 3300018062 | Tropical Peatland | MAHIESFSTVGLDQRFKLAHWNDYATDSFNPLVSDPADV |
| Ga0190274_113797001 | 3300018476 | Soil | MATVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIS |
| Ga0193728_11572921 | 3300019890 | Soil | MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGSIGDMTLSE |
| Ga0210403_109821822 | 3300020580 | Soil | MAQIESFSTFGLDPRRKLAFWNDTASESFSPLVSEPE |
| Ga0210395_114487131 | 3300020582 | Soil | MARIESFSTAGLDPRHKLAFWNDRASESFSPLVSEPEDI |
| Ga0210406_113753522 | 3300021168 | Soil | MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGTIGDMTL |
| Ga0210405_105798532 | 3300021171 | Soil | MARIESFSTAGLDPRHKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGSLGD |
| Ga0210388_101793734 | 3300021181 | Soil | MAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRAFNGSIV |
| Ga0210385_106235491 | 3300021402 | Soil | MAPIVSFSTAGLDPRRKLAFWNDQACESFSPLVSDPVDIRT |
| Ga0210397_106288601 | 3300021403 | Soil | MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPD |
| Ga0210397_116095701 | 3300021403 | Soil | MAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRA |
| Ga0210386_111228112 | 3300021406 | Soil | MAHIESFSTIGLDPRRKLAFWNDLASESFSPLVSEPQDIRVFNGSIV |
| Ga0210394_100593475 | 3300021420 | Soil | MAHIESFSTVGLDPRRKLAFWNDRASESFSPLVSEPEDI |
| Ga0210390_109198641 | 3300021474 | Soil | MARIESFSTAGLDPRHKLAFWNDRASESFSPLVSEP |
| Ga0247790_101694452 | 3300022915 | Soil | MASVESFSTIGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFNGSIARASIGDLTLA |
| Ga0247679_10172743 | 3300024251 | Soil | MAHIESFSTIGLDPRRKLAFWNDCASESFSPLVSEPEDIRVFNGAITRGSIGNMT |
| Ga0207699_102564601 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVESFSTTGLDPRRKLTYWNDRACETFSPLVSDPVDIRT |
| Ga0207659_117372462 | 3300025926 | Miscanthus Rhizosphere | MATVESFSTFGLDPRRKLSYWNDRATETFSPLVSDPVDIR |
| Ga0207644_117749832 | 3300025931 | Switchgrass Rhizosphere | MASVESFSTYGLDPRRKLTYWNDRACETFSPLVSDPADIRSFNGSIARANIGDLTL |
| Ga0207686_106977732 | 3300025934 | Miscanthus Rhizosphere | MATVESFSTNGLDPRRKLNYWNDRASEAFSPLVSDPVDIRTFNGSIARATIGD |
| Ga0207691_112737621 | 3300025940 | Miscanthus Rhizosphere | MASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIARA |
| Ga0207689_105780811 | 3300025942 | Miscanthus Rhizosphere | MATIESFSTFGLDPRRKLTYWNERACESFSPLVSDPVDIRT |
| Ga0207712_113848642 | 3300025961 | Switchgrass Rhizosphere | MATVESFSTFGLDPRRKLSYWNDRATETFSPLVSDPVDIRTFNGSIARASIGDL |
| Ga0207676_102019913 | 3300026095 | Switchgrass Rhizosphere | MAQIVSFTTAGLDPRRKLAYWNDRACESFSPLVSD |
| Ga0207676_105096301 | 3300026095 | Switchgrass Rhizosphere | MASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIAR |
| Ga0209890_100799122 | 3300026291 | Soil | MANIESFSTAGLDPRRKLAFWNERASESFSPLVSEPEDIRVFNGSIVRG |
| Ga0209131_10439041 | 3300026320 | Grasslands Soil | MAQIESFSTVGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGSIG |
| Ga0208890_10005956 | 3300027523 | Soil | MQSFTTTGLDPHRRLAYWNERAGESFSPLVSDPAD |
| Ga0208985_10858732 | 3300027528 | Forest Soil | MAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRAFNGSIVRGSIGDMS |
| Ga0209248_100162925 | 3300027729 | Bog Forest Soil | MAHIESFSTAGLDPRHKLTFWNDRASESFSPLVSEPQDIRAFNGSIARGTLGELSV |
| Ga0209167_103517921 | 3300027867 | Surface Soil | MSHIESFSTAGLDPRHKLTFWNDRASESFSPLVSEPEDIREFNGSIVRGSLGN |
| Ga0209167_103957483 | 3300027867 | Surface Soil | MAAIVSFSTAGLDLRRKLACWNDQASETFSPLVSDPADLRTFNGSIAR |
| Ga0209624_109537331 | 3300027895 | Forest Soil | MAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRAFNGSILRGSIGDM |
| Ga0247684_10926352 | 3300028138 | Soil | MAHIESFSTIGLDPRRKLAFWNDCASESFSPLVSEPEDIRVFNGAITRGSIGNMTLAE |
| Ga0268265_122440212 | 3300028380 | Switchgrass Rhizosphere | MAQIVSFTTAGLDPRRKLAYWNDRACESFSPLVSDPA |
| Ga0137415_102151453 | 3300028536 | Vadose Zone Soil | MAHIESFSTIGLDPRRKLAFWNDRANETFSPLVSEPEDIRVFNGSI |
| Ga0302234_103886532 | 3300028773 | Palsa | MTQIVSFSTAGLDPRRKLACWNEHACESFSPLVSDPADLR |
| Ga0307515_104439633 | 3300028794 | Ectomycorrhiza | MATVESFSTFGLDPRRKLTYWNERACESFSPLVSDPVDIRTFNGSISRA |
| Ga0302228_104803561 | 3300028808 | Palsa | MAHLESFSTIGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGS |
| Ga0308309_104476763 | 3300028906 | Soil | MAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRAFNGSIVRGSIGDMSLAE |
| Ga0311368_103889682 | 3300029882 | Palsa | MAHIDSFSTFGLDQRRKLAHWNDYATDSFNPLVSDPADVR |
| Ga0311371_113553231 | 3300029951 | Palsa | MMHIDSFSTIGLDQRRKLDHWNDYATVSFNPLVSD |
| Ga0311334_108029231 | 3300029987 | Fen | MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRMF |
| Ga0311338_119278122 | 3300030007 | Palsa | MAHIDSFSTFGLDQRRKLAHWNDYATDSFNPLVSDPADVRTFNGSISRTTIGDIT |
| Ga0302179_100316093 | 3300030058 | Palsa | MAAIVSFSTAGLDPRRKLACWNDQASETFSPLVSDPADLRSFNGSIARTTIGDLTLA |
| Ga0302184_102454951 | 3300030490 | Palsa | MMHIDSFSTIGLDQRRKLDHWNDYATDSFNPLVSDPADVRSFNGSIAR |
| Ga0311357_102575221 | 3300030524 | Palsa | MAHIDSFSTFGLDQRRKLAHWNDYATDSFNPLVSDPADVRTFNG |
| Ga0311354_101898333 | 3300030618 | Palsa | MAPIVSFSTAGLDPRRKLAFWNEHACESFSPLVSDPV |
| Ga0311354_106013292 | 3300030618 | Palsa | MTQIVSFSTAGLDPRRKLACWNEHACESFSPLVSD |
| Ga0302308_103726971 | 3300031027 | Palsa | MAHIDSFSTFGLDQRRKLAHWNDYATDSFNPLVSDPADVRTFN |
| Ga0302180_103704982 | 3300031028 | Palsa | MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIREF |
| Ga0170823_161439422 | 3300031128 | Forest Soil | MAHIESFSTIGLDPRRKLAFWNDCASESFSPLVSEPEDIRVFNGAITRGSIGDMT |
| Ga0170824_1029399352 | 3300031231 | Forest Soil | MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGTI |
| Ga0302307_103200592 | 3300031233 | Palsa | MAAIVSFSTAGLDPRRKLACWNDQASETFSPLVSDPADL |
| Ga0302325_102337244 | 3300031234 | Palsa | MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDLRGFNGS |
| Ga0310887_104646451 | 3300031547 | Soil | MASVESFSTYGLDPRRKLTYWNDRACETFSPLVSDPADIRSF |
| Ga0310686_1040075121 | 3300031708 | Soil | MMHIDSFSTIGLDQRRKLDHWNDYATDSFNPLVSD |
| Ga0302321_1005116961 | 3300031726 | Fen | MTQIVSYTTAGLDPRRKLSYWNDRACESFSPLVSDPVD |
| Ga0307473_101688361 | 3300031820 | Hardwood Forest Soil | MQSFSTAGLDPRRKLAYWNERAGESFSPLVSDPAD |
| Ga0307410_106032953 | 3300031852 | Rhizosphere | MAAVESFSTNGLDPRRKLTYWNDRACETFSPLVSD |
| Ga0307409_1003030983 | 3300031995 | Rhizosphere | MAAVESFSTNGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFNGSIAR |
| Ga0310902_113390661 | 3300032012 | Soil | MATVESFSTNGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFNGSISRA |
| Ga0315910_101996673 | 3300032144 | Soil | MATVESFSTFGLDPRRKLSYWNDRATETFSPLVSDPADIRTFNGSIAR |
| Ga0306920_1012359783 | 3300032261 | Soil | MAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPED |
| Ga0335081_121981352 | 3300032892 | Soil | MAHIESFSTAGLDPRRKLEFWNDRASASFSPLVSEPEDIRVFNGSIVR |
| Ga0370515_0067990_1399_1551 | 3300034163 | Untreated Peat Soil | MAHIESFSTVGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSILRGSI |
| Ga0370497_0182876_1_126 | 3300034965 | Untreated Peat Soil | MAQLESFSTVGIDPRRKLAFWNDRASESFSPLVSEPEDIRVF |
| ⦗Top⦘ |