NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F075197

Metagenome Family F075197

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075197
Family Type Metagenome
Number of Sequences 119
Average Sequence Length 46 residues
Representative Sequence MAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSILR
Number of Associated Samples 113
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.12 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.44 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (53.782 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(11.765 % of family members)
Environment Ontology (ENVO) Unclassified
(25.210 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.059 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.68%    β-sheet: 0.00%    Coil/Unstructured: 76.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF01047MarR 21.01
PF07690MFS_1 10.92
PF12802MarR_2 7.56
PF13463HTH_27 5.04
PF00378ECH_1 4.20
PF13417GST_N_3 2.52
PF02900LigB 1.68
PF03060NMO 0.84
PF00043GST_C 0.84
PF04909Amidohydro_2 0.84
PF00171Aldedh 0.84
PF02321OEP 0.84
PF06230LpxI_C 0.84
PF02798GST_N 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.68
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.84
COG0435Glutathionyl-hydroquinone reductaseEnergy production and conversion [C] 0.84
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.84
COG0625Glutathione S-transferasePosttranslational modification, protein turnover, chaperones [O] 0.84
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.84
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.84
COG3494Uncharacterized conserved protein, DUF1009 familyFunction unknown [S] 0.84
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.78 %
UnclassifiedrootN/A46.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0299588Not Available579Open in IMG/M
3300000956|JGI10216J12902_116226972Not Available821Open in IMG/M
3300001471|JGI12712J15308_10181995Not Available549Open in IMG/M
3300002245|JGIcombinedJ26739_101290504All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300002245|JGIcombinedJ26739_101569884All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300002917|JGI25616J43925_10339859Not Available556Open in IMG/M
3300003319|soilL2_10045887All Organisms → cellular organisms → Bacteria → Proteobacteria1182Open in IMG/M
3300004082|Ga0062384_101368891Not Available520Open in IMG/M
3300004091|Ga0062387_101698743Not Available512Open in IMG/M
3300004114|Ga0062593_100901329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria894Open in IMG/M
3300005334|Ga0068869_101396653Not Available620Open in IMG/M
3300005337|Ga0070682_100604818Not Available866Open in IMG/M
3300005341|Ga0070691_10316954All Organisms → cellular organisms → Bacteria → Proteobacteria856Open in IMG/M
3300005466|Ga0070685_10211049All Organisms → cellular organisms → Bacteria → Proteobacteria1267Open in IMG/M
3300005535|Ga0070684_101973434Not Available551Open in IMG/M
3300005547|Ga0070693_101045180Not Available620Open in IMG/M
3300005578|Ga0068854_101627918Not Available589Open in IMG/M
3300005591|Ga0070761_10883811Not Available564Open in IMG/M
3300005616|Ga0068852_102031872Not Available597Open in IMG/M
3300005718|Ga0068866_10931322Not Available613Open in IMG/M
3300005844|Ga0068862_102615795All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005994|Ga0066789_10496297Not Available510Open in IMG/M
3300006174|Ga0075014_100439638All Organisms → cellular organisms → Bacteria → Proteobacteria719Open in IMG/M
3300006176|Ga0070765_102127854Not Available524Open in IMG/M
3300006195|Ga0075366_10669523All Organisms → cellular organisms → Bacteria → Proteobacteria644Open in IMG/M
3300006358|Ga0068871_100886746All Organisms → cellular organisms → Bacteria → Proteobacteria826Open in IMG/M
3300006638|Ga0075522_10021252All Organisms → cellular organisms → Bacteria → Proteobacteria4082Open in IMG/M
3300006641|Ga0075471_10480975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria617Open in IMG/M
3300006804|Ga0079221_11407258Not Available555Open in IMG/M
3300006853|Ga0075420_101822877Not Available520Open in IMG/M
3300007004|Ga0079218_12099692All Organisms → cellular organisms → Bacteria → Proteobacteria651Open in IMG/M
3300007004|Ga0079218_13801826All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium513Open in IMG/M
3300009147|Ga0114129_12302318Not Available647Open in IMG/M
3300009551|Ga0105238_12276252Not Available577Open in IMG/M
3300009624|Ga0116105_1215785Not Available535Open in IMG/M
3300009661|Ga0105858_1219248Not Available567Open in IMG/M
3300009701|Ga0116228_10610704All Organisms → cellular organisms → Bacteria → Proteobacteria740Open in IMG/M
3300011269|Ga0137392_10869694Not Available743Open in IMG/M
3300012357|Ga0137384_10138708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2035Open in IMG/M
3300012683|Ga0137398_10563218All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli786Open in IMG/M
3300012924|Ga0137413_10704405All Organisms → cellular organisms → Bacteria → Proteobacteria766Open in IMG/M
3300012929|Ga0137404_10739128All Organisms → cellular organisms → Bacteria → Proteobacteria891Open in IMG/M
3300012958|Ga0164299_11472876Not Available530Open in IMG/M
3300013297|Ga0157378_12993638Not Available524Open in IMG/M
3300014155|Ga0181524_10320276Not Available699Open in IMG/M
3300014326|Ga0157380_10733853All Organisms → cellular organisms → Bacteria → Proteobacteria997Open in IMG/M
3300014498|Ga0182019_10978766Not Available613Open in IMG/M
3300015373|Ga0132257_101033870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1035Open in IMG/M
3300016387|Ga0182040_11128468Not Available657Open in IMG/M
3300017972|Ga0187781_10132356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1744Open in IMG/M
3300017975|Ga0187782_11673831Not Available503Open in IMG/M
3300018060|Ga0187765_11178761Not Available536Open in IMG/M
3300018062|Ga0187784_11575873All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300018476|Ga0190274_11379700Not Available793Open in IMG/M
3300019890|Ga0193728_1157292Not Available994Open in IMG/M
3300020580|Ga0210403_10982182Not Available662Open in IMG/M
3300020582|Ga0210395_11448713Not Available500Open in IMG/M
3300021168|Ga0210406_11375352Not Available505Open in IMG/M
3300021171|Ga0210405_10579853Not Available875Open in IMG/M
3300021181|Ga0210388_10179373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1848Open in IMG/M
3300021402|Ga0210385_10623549All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300021403|Ga0210397_10628860All Organisms → cellular organisms → Bacteria → Proteobacteria822Open in IMG/M
3300021403|Ga0210397_11609570Not Available504Open in IMG/M
3300021406|Ga0210386_11122811All Organisms → cellular organisms → Bacteria → Proteobacteria667Open in IMG/M
3300021420|Ga0210394_10059347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3330Open in IMG/M
3300021474|Ga0210390_10919864Not Available718Open in IMG/M
3300022915|Ga0247790_10169445Not Available569Open in IMG/M
3300024251|Ga0247679_1017274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1230Open in IMG/M
3300025906|Ga0207699_10256460All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300025926|Ga0207659_11737246Not Available531Open in IMG/M
3300025931|Ga0207644_11774983Not Available516Open in IMG/M
3300025934|Ga0207686_10697773Not Available806Open in IMG/M
3300025940|Ga0207691_11273762Not Available608Open in IMG/M
3300025942|Ga0207689_10578081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria944Open in IMG/M
3300025961|Ga0207712_11384864Not Available629Open in IMG/M
3300026095|Ga0207676_10201991All Organisms → cellular organisms → Bacteria → Proteobacteria1757Open in IMG/M
3300026095|Ga0207676_10509630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1144Open in IMG/M
3300026291|Ga0209890_10079912All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300026320|Ga0209131_1043904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2553Open in IMG/M
3300027523|Ga0208890_1000595All Organisms → cellular organisms → Bacteria → Proteobacteria3365Open in IMG/M
3300027528|Ga0208985_1085873Not Available606Open in IMG/M
3300027729|Ga0209248_10016292All Organisms → cellular organisms → Bacteria2329Open in IMG/M
3300027867|Ga0209167_10351792Not Available801Open in IMG/M
3300027867|Ga0209167_10395748All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300027895|Ga0209624_10953733Not Available558Open in IMG/M
3300028138|Ga0247684_1092635Not Available505Open in IMG/M
3300028380|Ga0268265_12244021All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300028536|Ga0137415_10215145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1737Open in IMG/M
3300028773|Ga0302234_10388653All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300028794|Ga0307515_10443963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria914Open in IMG/M
3300028808|Ga0302228_10480356Not Available548Open in IMG/M
3300028906|Ga0308309_10447676All Organisms → cellular organisms → Bacteria → Proteobacteria1112Open in IMG/M
3300029882|Ga0311368_10388968All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300029951|Ga0311371_11355323All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300029987|Ga0311334_10802923Not Available774Open in IMG/M
3300030007|Ga0311338_11927812All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300030058|Ga0302179_10031609All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2467Open in IMG/M
3300030490|Ga0302184_10245495All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300030524|Ga0311357_10257522All Organisms → cellular organisms → Bacteria1686Open in IMG/M
3300030618|Ga0311354_10189833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2206Open in IMG/M
3300030618|Ga0311354_10601329All Organisms → cellular organisms → Bacteria → Proteobacteria1068Open in IMG/M
3300031027|Ga0302308_10372697All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300031028|Ga0302180_10370498All Organisms → cellular organisms → Bacteria → Proteobacteria722Open in IMG/M
3300031128|Ga0170823_16143942Not Available755Open in IMG/M
3300031231|Ga0170824_102939935All Organisms → cellular organisms → Bacteria → Proteobacteria696Open in IMG/M
3300031233|Ga0302307_10320059All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300031234|Ga0302325_10233724All Organisms → cellular organisms → Bacteria → Proteobacteria3096Open in IMG/M
3300031547|Ga0310887_10464645Not Available756Open in IMG/M
3300031708|Ga0310686_104007512All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300031726|Ga0302321_100511696All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300031820|Ga0307473_10168836All Organisms → cellular organisms → Bacteria → Proteobacteria1266Open in IMG/M
3300031852|Ga0307410_10603295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria916Open in IMG/M
3300031995|Ga0307409_100303098All Organisms → cellular organisms → Bacteria → Proteobacteria1487Open in IMG/M
3300032012|Ga0310902_11339066Not Available508Open in IMG/M
3300032144|Ga0315910_10199667All Organisms → cellular organisms → Bacteria → Proteobacteria1500Open in IMG/M
3300032261|Ga0306920_101235978All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPLOWO2_02_FULL_56_151077Open in IMG/M
3300032892|Ga0335081_12198135Not Available581Open in IMG/M
3300034163|Ga0370515_0067990All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300034965|Ga0370497_0182876Not Available537Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa11.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.20%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.20%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.36%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.52%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.68%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.68%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.68%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.68%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.68%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.68%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.84%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.84%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.84%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.84%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.84%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.84%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.84%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.84%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.84%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.84%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.84%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.84%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300009701Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027528Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034965Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_029958823300000156Sugar Cane Bagasse Incubating BioreactorMATVESFSTFGLDPRRKLSYWNDRATETFSPLVSDP
JGI10216J12902_11622697223300000956SoilMASVESFSTFGLDPRRKLTYWNDRATETFSPLVSDPADIRTFNGSIARATIGDLT
JGI12712J15308_1018199513300001471Forest SoilMAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVF
JGIcombinedJ26739_10129050423300002245Forest SoilMAPIVSFSTAGLDPRRKLAFWNDQACESFSPLVSDPVDIRTFHGSIARTTI
JGIcombinedJ26739_10156988413300002245Forest SoilMRTIGGSNMARIVSFSTAGLDARRKLVHWNERASESFSPLVSDPVDIHTFNGSI
JGI25616J43925_1033985913300002917Grasslands SoilMAHIESFSTIGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGSIGD
soilL2_1004588713300003319Sugarcane Root And Bulk SoilMATVESFSTAGLDPRRKLAYWNERACESFSPLVSDPADIRTFNGSIARA
Ga0062384_10136889123300004082Bog Forest SoilMAHIESFSTAGLDPRHKLTFWNDRASESFSPLVSEPQDIRAFNGSIARGTLGELS
Ga0062387_10169874313300004091Bog Forest SoilMMLESFSTVGMDPRRKLTFWNDRASESFSPLVSEPDDIQMFNGSIVRGSI
Ga0062593_10090132913300004114SoilMASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIARASIGDLTLA
Ga0068869_10139665313300005334Miscanthus RhizosphereMATIESFSTFGLDPRRKLTYWNERACESFSPLVSDPVDIR
Ga0070682_10060481823300005337Corn RhizosphereMATVESFSTTGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFNGSI
Ga0070691_1031695423300005341Corn, Switchgrass And Miscanthus RhizosphereMASVESFSTYGLDPRRKLTYWNDRACETFSPLVSDPADIRSFNGSIARAAIGDLTL
Ga0070685_1021104923300005466Switchgrass RhizosphereMAQIVSFTTAGLDPRRKLAYWNDRACESFSPLVSDPADIRSFNGSIARTA
Ga0070684_10197343423300005535Corn RhizosphereMASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIARASI
Ga0070693_10104518013300005547Corn, Switchgrass And Miscanthus RhizosphereMATVESFSTNGLDPRRKLNYWNDRASEAFSPLVSDPVDIRTFNGSI
Ga0068854_10162791823300005578Corn RhizosphereMASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIARASIGDLTL
Ga0070761_1088381113300005591SoilMAAIVSFSTAGLDPRRKLACWNDQASETFSPLVSD
Ga0068852_10203187213300005616Corn RhizosphereMATVESFSTTGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFN
Ga0068866_1093132223300005718Miscanthus RhizosphereMATVESFSTFGLDPRRKLSYWNDRATETFSPLVSD
Ga0068862_10261579513300005844Switchgrass RhizosphereMAQIVSFTTAGLDPRRKLAYWNDRACESFSPLVSDP
Ga0066789_1049629713300005994SoilLVPIQSFSTAGMDPRRKLAFWNDRVSESLTPLVSEPVDVRDFNGSISQVSIDDMS
Ga0075014_10043963813300006174WatershedsMAPIVSFSTAGLDPRRKLAFWNDQACESFSPLVSDPVDIRSFHGSIARTTIGELT
Ga0070765_10212785413300006176SoilMAHIESFSTIGLDPRRKLAFWNDLASESFSPLVSEPQDIRVFNGSIVRGSIGDMT
Ga0075366_1066952313300006195Populus EndosphereMASVESFSTYGLDPRRKLTYWNDRACETFSPLVSDPADI
Ga0068871_10088674613300006358Miscanthus RhizosphereMATVESFSTAGLDPRRKLTYWNERACESFSPLVSDPADIRTFNGSIARASIGDLTLA
Ga0075522_1002125263300006638Arctic Peat SoilMTQIVSFSTAGVDPRRKAAYWNEHACESFSPLVSDPVDIRTFDGSIA
Ga0075471_1048097523300006641AqueousMAQLQSYSTAGLDPRAKLQFWNDMASDCFSPLVSDP
Ga0079221_1140725823300006804Agricultural SoilMATVESFSTNGLDPRRKLNYWNDRASEAFSPLVSDPVDIR
Ga0075420_10182287723300006853Populus RhizosphereMATVESFSTAGLDPRRKLTYWNERACESFSPLVSDPADIRTFNGSIA
Ga0079218_1209969223300007004Agricultural SoilMATVESFSTAGLDPRRKLTYWNERACESFSPLVSDPADIR
Ga0079218_1380182613300007004Agricultural SoilMATVESFSTIGLDPRRKLNYWNERASESFSPLVSDPVDIRT
Ga0114129_1230231813300009147Populus RhizosphereMAIVESFSTAGLDLRRKLTHWNERVSESAAPLFCDPADRTFNGS
Ga0105238_1227625223300009551Corn RhizosphereMATVESFSTTGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFNGSIARATIGDLTLA
Ga0116105_121578523300009624PeatlandMAHIESFSTIGLDPRRKLAFWNDRASESFSPLVSEPQ
Ga0105858_121924823300009661Permafrost SoilMAQIESFSTYGLDPRRKLAFWNDRANETFSPLVSEPEDIRLFNG
Ga0116228_1061070423300009701Host-AssociatedMAHIESFSTIGLDPRVKLAFWNDKASESFSPLVSQPDDIRFFNG
Ga0137392_1086969423300011269Vadose Zone SoilMAHIESFSTIGLDPRRKLAFWNDRANETFSPLVSEPEDIRVFNGSIV
Ga0137384_1013870813300012357Vadose Zone SoilMAHIESFSTAGLEPRRKLAFWNDRASESFSPMVSEPEDIRVFNGCIV
Ga0137398_1056321823300012683Vadose Zone SoilLAHIESFSTAGLDPRRKLAFWNDRVSESLTPLVSEPVDVRDFNGSISRV
Ga0137413_1070440523300012924Vadose Zone SoilMAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSE
Ga0137404_1073912823300012929Vadose Zone SoilMAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSE
Ga0164299_1147287613300012958SoilMAQIVSFTTAGLDPRRKLAYGNDRACESFSPLVSDPADIRSFN
Ga0157378_1299363813300013297Miscanthus RhizosphereMATVESFSTFGLDPRRKLNYWNDRASEAFSPLVSDPVDIRTFNGSIARATIGDLTL
Ga0181524_1032027623300014155BogMAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSILR
Ga0157380_1073385313300014326Switchgrass RhizosphereMASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIA
Ga0182019_1097876623300014498FenMDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGSIGDMTLSEVYSD
Ga0132257_10103387033300015373Arabidopsis RhizosphereMATVESFSTFGLDPRRKLSYWNDRATETFSPLVSDPVDIRTFNGSI
Ga0182040_1112846813300016387SoilMAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRVFNGSIVRGSIGDMSL
Ga0187781_1013235633300017972Tropical PeatlandMTQIVSFSTVGLEPHRKLNCWNERASESFSPLVSDPVDLRSFNGSIART
Ga0187782_1167383113300017975Tropical PeatlandMAEIESFSTIGLDPRRKLAFWNDWASESFSPLVSEPEDIHIFNG
Ga0187765_1117876123300018060Tropical PeatlandMAVIESFSTAGLDPRRKLAYWNDLGSESFSPLVSDPVDIRTFNGSIS
Ga0187784_1157587323300018062Tropical PeatlandMAHIESFSTVGLDQRFKLAHWNDYATDSFNPLVSDPADV
Ga0190274_1137970013300018476SoilMATVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIS
Ga0193728_115729213300019890SoilMAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGSIGDMTLSE
Ga0210403_1098218223300020580SoilMAQIESFSTFGLDPRRKLAFWNDTASESFSPLVSEPE
Ga0210395_1144871313300020582SoilMARIESFSTAGLDPRHKLAFWNDRASESFSPLVSEPEDI
Ga0210406_1137535223300021168SoilMAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGTIGDMTL
Ga0210405_1057985323300021171SoilMARIESFSTAGLDPRHKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGSLGD
Ga0210388_1017937343300021181SoilMAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRAFNGSIV
Ga0210385_1062354913300021402SoilMAPIVSFSTAGLDPRRKLAFWNDQACESFSPLVSDPVDIRT
Ga0210397_1062886013300021403SoilMAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPD
Ga0210397_1160957013300021403SoilMAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRA
Ga0210386_1112281123300021406SoilMAHIESFSTIGLDPRRKLAFWNDLASESFSPLVSEPQDIRVFNGSIV
Ga0210394_1005934753300021420SoilMAHIESFSTVGLDPRRKLAFWNDRASESFSPLVSEPEDI
Ga0210390_1091986413300021474SoilMARIESFSTAGLDPRHKLAFWNDRASESFSPLVSEP
Ga0247790_1016944523300022915SoilMASVESFSTIGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFNGSIARASIGDLTLA
Ga0247679_101727433300024251SoilMAHIESFSTIGLDPRRKLAFWNDCASESFSPLVSEPEDIRVFNGAITRGSIGNMT
Ga0207699_1025646013300025906Corn, Switchgrass And Miscanthus RhizosphereMATVESFSTTGLDPRRKLTYWNDRACETFSPLVSDPVDIRT
Ga0207659_1173724623300025926Miscanthus RhizosphereMATVESFSTFGLDPRRKLSYWNDRATETFSPLVSDPVDIR
Ga0207644_1177498323300025931Switchgrass RhizosphereMASVESFSTYGLDPRRKLTYWNDRACETFSPLVSDPADIRSFNGSIARANIGDLTL
Ga0207686_1069777323300025934Miscanthus RhizosphereMATVESFSTNGLDPRRKLNYWNDRASEAFSPLVSDPVDIRTFNGSIARATIGD
Ga0207691_1127376213300025940Miscanthus RhizosphereMASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIARA
Ga0207689_1057808113300025942Miscanthus RhizosphereMATIESFSTFGLDPRRKLTYWNERACESFSPLVSDPVDIRT
Ga0207712_1138486423300025961Switchgrass RhizosphereMATVESFSTFGLDPRRKLSYWNDRATETFSPLVSDPVDIRTFNGSIARASIGDL
Ga0207676_1020199133300026095Switchgrass RhizosphereMAQIVSFTTAGLDPRRKLAYWNDRACESFSPLVSD
Ga0207676_1050963013300026095Switchgrass RhizosphereMASVESFSTIGLDPRRKLTYWNDRATETFSPLVSDPVDIRTFNGSIAR
Ga0209890_1007991223300026291SoilMANIESFSTAGLDPRRKLAFWNERASESFSPLVSEPEDIRVFNGSIVRG
Ga0209131_104390413300026320Grasslands SoilMAQIESFSTVGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGSIG
Ga0208890_100059563300027523SoilMQSFTTTGLDPHRRLAYWNERAGESFSPLVSDPAD
Ga0208985_108587323300027528Forest SoilMAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRAFNGSIVRGSIGDMS
Ga0209248_1001629253300027729Bog Forest SoilMAHIESFSTAGLDPRHKLTFWNDRASESFSPLVSEPQDIRAFNGSIARGTLGELSV
Ga0209167_1035179213300027867Surface SoilMSHIESFSTAGLDPRHKLTFWNDRASESFSPLVSEPEDIREFNGSIVRGSLGN
Ga0209167_1039574833300027867Surface SoilMAAIVSFSTAGLDLRRKLACWNDQASETFSPLVSDPADLRTFNGSIAR
Ga0209624_1095373313300027895Forest SoilMAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRAFNGSILRGSIGDM
Ga0247684_109263523300028138SoilMAHIESFSTIGLDPRRKLAFWNDCASESFSPLVSEPEDIRVFNGAITRGSIGNMTLAE
Ga0268265_1224402123300028380Switchgrass RhizosphereMAQIVSFTTAGLDPRRKLAYWNDRACESFSPLVSDPA
Ga0137415_1021514533300028536Vadose Zone SoilMAHIESFSTIGLDPRRKLAFWNDRANETFSPLVSEPEDIRVFNGSI
Ga0302234_1038865323300028773PalsaMTQIVSFSTAGLDPRRKLACWNEHACESFSPLVSDPADLR
Ga0307515_1044396333300028794EctomycorrhizaMATVESFSTFGLDPRRKLTYWNERACESFSPLVSDPVDIRTFNGSISRA
Ga0302228_1048035613300028808PalsaMAHLESFSTIGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGS
Ga0308309_1044767633300028906SoilMAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPEDIRAFNGSIVRGSIGDMSLAE
Ga0311368_1038896823300029882PalsaMAHIDSFSTFGLDQRRKLAHWNDYATDSFNPLVSDPADVR
Ga0311371_1135532313300029951PalsaMMHIDSFSTIGLDQRRKLDHWNDYATVSFNPLVSD
Ga0311334_1080292313300029987FenMAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRMF
Ga0311338_1192781223300030007PalsaMAHIDSFSTFGLDQRRKLAHWNDYATDSFNPLVSDPADVRTFNGSISRTTIGDIT
Ga0302179_1003160933300030058PalsaMAAIVSFSTAGLDPRRKLACWNDQASETFSPLVSDPADLRSFNGSIARTTIGDLTLA
Ga0302184_1024549513300030490PalsaMMHIDSFSTIGLDQRRKLDHWNDYATDSFNPLVSDPADVRSFNGSIAR
Ga0311357_1025752213300030524PalsaMAHIDSFSTFGLDQRRKLAHWNDYATDSFNPLVSDPADVRTFNG
Ga0311354_1018983333300030618PalsaMAPIVSFSTAGLDPRRKLAFWNEHACESFSPLVSDPV
Ga0311354_1060132923300030618PalsaMTQIVSFSTAGLDPRRKLACWNEHACESFSPLVSD
Ga0302308_1037269713300031027PalsaMAHIDSFSTFGLDQRRKLAHWNDYATDSFNPLVSDPADVRTFN
Ga0302180_1037049823300031028PalsaMAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIREF
Ga0170823_1614394223300031128Forest SoilMAHIESFSTIGLDPRRKLAFWNDCASESFSPLVSEPEDIRVFNGAITRGSIGDMT
Ga0170824_10293993523300031231Forest SoilMAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSIVRGTI
Ga0302307_1032005923300031233PalsaMAAIVSFSTAGLDPRRKLACWNDQASETFSPLVSDPADL
Ga0302325_1023372443300031234PalsaMAHIESFSTAGLDPRRKLAFWNDRASESFSPLVSEPEDLRGFNGS
Ga0310887_1046464513300031547SoilMASVESFSTYGLDPRRKLTYWNDRACETFSPLVSDPADIRSF
Ga0310686_10400751213300031708SoilMMHIDSFSTIGLDQRRKLDHWNDYATDSFNPLVSD
Ga0302321_10051169613300031726FenMTQIVSYTTAGLDPRRKLSYWNDRACESFSPLVSDPVD
Ga0307473_1016883613300031820Hardwood Forest SoilMQSFSTAGLDPRRKLAYWNERAGESFSPLVSDPAD
Ga0307410_1060329533300031852RhizosphereMAAVESFSTNGLDPRRKLTYWNDRACETFSPLVSD
Ga0307409_10030309833300031995RhizosphereMAAVESFSTNGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFNGSIAR
Ga0310902_1133906613300032012SoilMATVESFSTNGLDPRRKLTYWNDRACETFSPLVSDPVDIRTFNGSISRA
Ga0315910_1019966733300032144SoilMATVESFSTFGLDPRRKLSYWNDRATETFSPLVSDPADIRTFNGSIAR
Ga0306920_10123597833300032261SoilMAHLESFSTAGLDPRRKLAFWNDCASESFSPLVSEPED
Ga0335081_1219813523300032892SoilMAHIESFSTAGLDPRRKLEFWNDRASASFSPLVSEPEDIRVFNGSIVR
Ga0370515_0067990_1399_15513300034163Untreated Peat SoilMAHIESFSTVGLDPRRKLAFWNDRASESFSPLVSEPEDIRVFNGSILRGSI
Ga0370497_0182876_1_1263300034965Untreated Peat SoilMAQLESFSTVGIDPRRKLAFWNDRASESFSPLVSEPEDIRVF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.