| Basic Information | |
|---|---|
| Family ID | F075153 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ADQITDLLAKGNDAKKAPHKKAIAGVSADDAKAVADYVKTLK |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.84 % |
| % of genes near scaffold ends (potentially truncated) | 99.16 % |
| % of genes from short scaffolds (< 2000 bps) | 89.08 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.387 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (10.924 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.454 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00210 | Ferritin | 10.92 |
| PF01663 | Phosphodiest | 7.56 |
| PF00701 | DHDPS | 5.88 |
| PF12802 | MarR_2 | 1.68 |
| PF01740 | STAS | 1.68 |
| PF00903 | Glyoxalase | 1.68 |
| PF13356 | Arm-DNA-bind_3 | 0.84 |
| PF01156 | IU_nuc_hydro | 0.84 |
| PF01979 | Amidohydro_1 | 0.84 |
| PF01476 | LysM | 0.84 |
| PF02897 | Peptidase_S9_N | 0.84 |
| PF12706 | Lactamase_B_2 | 0.84 |
| PF04831 | Popeye | 0.84 |
| PF00753 | Lactamase_B | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 11.76 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.84 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.84 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.39 % |
| Unclassified | root | N/A | 33.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101204512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300001356|JGI12269J14319_10118681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300004081|Ga0063454_101187801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300004152|Ga0062386_101328490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 598 | Open in IMG/M |
| 3300005332|Ga0066388_104192997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300005435|Ga0070714_101643041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 628 | Open in IMG/M |
| 3300005436|Ga0070713_100981615 | Not Available | 814 | Open in IMG/M |
| 3300005437|Ga0070710_10410492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 910 | Open in IMG/M |
| 3300005437|Ga0070710_10693715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300005439|Ga0070711_100956022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 733 | Open in IMG/M |
| 3300005468|Ga0070707_101798152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300005529|Ga0070741_10137349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2486 | Open in IMG/M |
| 3300005539|Ga0068853_101432924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300005614|Ga0068856_101234849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300005712|Ga0070764_10265370 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300005874|Ga0075288_1036080 | Not Available | 740 | Open in IMG/M |
| 3300006052|Ga0075029_100506194 | Not Available | 798 | Open in IMG/M |
| 3300006102|Ga0075015_100604575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300006162|Ga0075030_100363276 | Not Available | 1154 | Open in IMG/M |
| 3300006175|Ga0070712_101720231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300006176|Ga0070765_100366206 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300006358|Ga0068871_101075365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 751 | Open in IMG/M |
| 3300006854|Ga0075425_100173099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2478 | Open in IMG/M |
| 3300006954|Ga0079219_11104441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300009522|Ga0116218_1371738 | Not Available | 638 | Open in IMG/M |
| 3300009545|Ga0105237_10701852 | Not Available | 1018 | Open in IMG/M |
| 3300009628|Ga0116125_1000958 | All Organisms → cellular organisms → Bacteria | 13012 | Open in IMG/M |
| 3300009630|Ga0116114_1072834 | Not Available | 940 | Open in IMG/M |
| 3300009645|Ga0116106_1024107 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
| 3300009762|Ga0116130_1287993 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009764|Ga0116134_1318599 | Not Available | 534 | Open in IMG/M |
| 3300010343|Ga0074044_10516565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 780 | Open in IMG/M |
| 3300010358|Ga0126370_11708343 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300010366|Ga0126379_10473162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
| 3300010376|Ga0126381_100048761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5173 | Open in IMG/M |
| 3300010376|Ga0126381_100787046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1365 | Open in IMG/M |
| 3300010379|Ga0136449_100952730 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300010398|Ga0126383_11186971 | Not Available | 853 | Open in IMG/M |
| 3300010398|Ga0126383_12183886 | Not Available | 640 | Open in IMG/M |
| 3300012212|Ga0150985_110665687 | Not Available | 655 | Open in IMG/M |
| 3300012212|Ga0150985_112810462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300012469|Ga0150984_107163493 | Not Available | 524 | Open in IMG/M |
| 3300012469|Ga0150984_107278369 | Not Available | 693 | Open in IMG/M |
| 3300012971|Ga0126369_12636987 | Not Available | 587 | Open in IMG/M |
| 3300012989|Ga0164305_10635919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300014164|Ga0181532_10340547 | Not Available | 842 | Open in IMG/M |
| 3300014165|Ga0181523_10103032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1712 | Open in IMG/M |
| 3300014165|Ga0181523_10516790 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300014492|Ga0182013_10234573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1074 | Open in IMG/M |
| 3300014493|Ga0182016_10404296 | Not Available | 807 | Open in IMG/M |
| 3300014501|Ga0182024_10206116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2682 | Open in IMG/M |
| 3300016341|Ga0182035_11250595 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300016357|Ga0182032_10408286 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300017932|Ga0187814_10342976 | Not Available | 576 | Open in IMG/M |
| 3300017933|Ga0187801_10194896 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300017933|Ga0187801_10317775 | Not Available | 636 | Open in IMG/M |
| 3300017937|Ga0187809_10110980 | Not Available | 926 | Open in IMG/M |
| 3300017941|Ga0187850_10090466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1499 | Open in IMG/M |
| 3300017972|Ga0187781_11333450 | Not Available | 530 | Open in IMG/M |
| 3300017973|Ga0187780_11214095 | Not Available | 553 | Open in IMG/M |
| 3300017994|Ga0187822_10155641 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300018009|Ga0187884_10387469 | Not Available | 562 | Open in IMG/M |
| 3300018013|Ga0187873_1090143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300018017|Ga0187872_10348489 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300018021|Ga0187882_1257076 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300018025|Ga0187885_10106047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1361 | Open in IMG/M |
| 3300018030|Ga0187869_10165168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1093 | Open in IMG/M |
| 3300018034|Ga0187863_10259799 | Not Available | 965 | Open in IMG/M |
| 3300018035|Ga0187875_10185757 | Not Available | 1151 | Open in IMG/M |
| 3300018038|Ga0187855_10292855 | Not Available | 953 | Open in IMG/M |
| 3300018046|Ga0187851_10433930 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300018047|Ga0187859_10889838 | Not Available | 513 | Open in IMG/M |
| 3300018057|Ga0187858_10809854 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018062|Ga0187784_11329943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 570 | Open in IMG/M |
| 3300018085|Ga0187772_10774937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300018085|Ga0187772_10851896 | Not Available | 660 | Open in IMG/M |
| 3300018086|Ga0187769_10524422 | Not Available | 894 | Open in IMG/M |
| 3300018088|Ga0187771_10268971 | Not Available | 1424 | Open in IMG/M |
| 3300018088|Ga0187771_10941463 | Not Available | 733 | Open in IMG/M |
| 3300018090|Ga0187770_10045690 | All Organisms → cellular organisms → Bacteria | 3137 | Open in IMG/M |
| 3300018090|Ga0187770_10874276 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300019787|Ga0182031_1111884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1321 | Open in IMG/M |
| 3300019787|Ga0182031_1120398 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300019787|Ga0182031_1143710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1633 | Open in IMG/M |
| 3300020581|Ga0210399_11346911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300024323|Ga0247666_1038732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 982 | Open in IMG/M |
| 3300025404|Ga0208936_1012198 | Not Available | 1067 | Open in IMG/M |
| 3300025406|Ga0208035_1045536 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300025412|Ga0208194_1060900 | Not Available | 579 | Open in IMG/M |
| 3300025928|Ga0207700_10008160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6468 | Open in IMG/M |
| 3300025929|Ga0207664_11751154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300026078|Ga0207702_10920552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300026078|Ga0207702_12059967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300027073|Ga0208366_1025525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
| 3300027634|Ga0209905_1013529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1087 | Open in IMG/M |
| 3300027869|Ga0209579_10309709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300027905|Ga0209415_10013803 | All Organisms → cellular organisms → Bacteria | 13270 | Open in IMG/M |
| 3300028800|Ga0265338_10419874 | Not Available | 951 | Open in IMG/M |
| 3300028800|Ga0265338_10788353 | Not Available | 652 | Open in IMG/M |
| 3300028866|Ga0302278_10174268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1094 | Open in IMG/M |
| 3300028909|Ga0302200_10497337 | Not Available | 556 | Open in IMG/M |
| 3300029817|Ga0247275_1156736 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300029907|Ga0311329_10624318 | Not Available | 710 | Open in IMG/M |
| 3300029911|Ga0311361_10914296 | Not Available | 752 | Open in IMG/M |
| 3300029939|Ga0311328_10106730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2323 | Open in IMG/M |
| 3300031128|Ga0170823_10674551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
| 3300031231|Ga0170824_114163738 | Not Available | 895 | Open in IMG/M |
| 3300031788|Ga0302319_11156369 | Not Available | 720 | Open in IMG/M |
| 3300031879|Ga0306919_10959913 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031912|Ga0306921_12283368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300032174|Ga0307470_10026527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2697 | Open in IMG/M |
| 3300032205|Ga0307472_100623089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300032805|Ga0335078_10713245 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300032893|Ga0335069_10036108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6637 | Open in IMG/M |
| 3300032897|Ga0335071_10282852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1612 | Open in IMG/M |
| 3300033004|Ga0335084_10879204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300033134|Ga0335073_10584779 | Not Available | 1251 | Open in IMG/M |
| 3300033158|Ga0335077_10042783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5565 | Open in IMG/M |
| 3300033807|Ga0314866_006247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1463 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 10.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.04% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.04% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.20% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 4.20% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.36% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.68% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.84% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.84% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.84% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.84% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.84% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027634 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1012045121 | 3300000364 | Soil | GKVGPAVKGSSLSADQITNLLVKGEDAKKAPHKKAIAGVSADDAKAIADYIKTLK* |
| JGI12269J14319_101186812 | 3300001356 | Peatlands Soil | KIGPKLAGTAVTADQIVDMLTKGNDAKKVPHKKPLSGLSADDAKSVADFVKSLK* |
| Ga0063454_1011878012 | 3300004081 | Soil | GPEGQGKVGPAVKGTTVSVDQITDLLTKGAEAKKAPHKKSISGLSADDAKAVADYVKTLK |
| Ga0062386_1013284901 | 3300004152 | Bog Forest Soil | ADEIADLLTKGNDAKKPPHKKAVGGLTADDAKAVADYVKTLK* |
| Ga0066388_1041929973 | 3300005332 | Tropical Forest Soil | KVGPTVKGSTLTADQINDQLRKGNDAQEGSHKKAVAGVSAEVAKAVADYVKTVK* |
| Ga0070714_1016430412 | 3300005435 | Agricultural Soil | TSLTADQITDLLTKGNDAKKAPHKKAMSTVPADDAKAVADFVKTLK* |
| Ga0070713_1009816151 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | KGTALSADQITDLLTKGEDAKKAPHKKALSGLTADDAKAVADYVKSLK* |
| Ga0070710_104104922 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EGQGKIGPAVKGISLSTEQITDLLTKGQEAKKAPHKKAVAGLSADDAKAVAEYVKTLK* |
| Ga0070710_106937152 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | DQITDLLVKGEDAKKAPHKKAIAGVSADDAKAIADYIKTLK* |
| Ga0070711_1009560221 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ALKGTSLTEDQIADMLTKGDEAKKAPHKKAMSGFSADDAKAVATFVKGLK* |
| Ga0070707_1017981521 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LKGTTLTADQIADMLTKGNDARKPPHKKPLASLSADHAKAVADFVKTLK* |
| Ga0070741_101373493 | 3300005529 | Surface Soil | LTKGAEAKKAPHKKPVSGVSADDAKAVAEYVKSLK* |
| Ga0068853_1014329241 | 3300005539 | Corn Rhizosphere | STEQITDLLTKGEEAKKAPHKKAMAGLSADDAKAVAEYVKTLK* |
| Ga0068856_1012348491 | 3300005614 | Corn Rhizosphere | SADQITDLLVKGEDAKKAPHKKAIAGVSADDAKAIADYIKTLK* |
| Ga0070764_102653704 | 3300005712 | Soil | TKGDDAKKAPHKKAVAGVAADDAKAVAEYVKSLK* |
| Ga0075288_10360801 | 3300005874 | Rice Paddy Soil | EGQGKIGPAVKGTTLSADQITDLLTKGAEAKKAPHKKSISGLSADDAKAVAEHVKTLK* |
| Ga0075029_1005061941 | 3300006052 | Watersheds | KGTSVTADQIVEMLTKGNDAKKPPHKKPLSGLSAEDAKAVADFVKTLK* |
| Ga0075015_1006045752 | 3300006102 | Watersheds | HGPEGQGKVGPAVKGTTLTADQITDLLAKGNDAKKNPHKKAVAGVSADDAKAVADYVKTLK* |
| Ga0075030_1003632761 | 3300006162 | Watersheds | GTTLTADQITDLLAKGNDAKKVPHKKAVVGVSAEDAKAVADYVKTLK* |
| Ga0070712_1017202312 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QITDLLTKGEDAKKAPHKKAMAGLSADDAKAVAEYVKTLK* |
| Ga0070765_1003662063 | 3300006176 | Soil | SADQIAVLLTKGDDAKKPPHKKPMSSLSADDAKAVADFVKSLQ* |
| Ga0068871_1010753652 | 3300006358 | Miscanthus Rhizosphere | SLSADQITDLLVKGEDAKKAPHKKAIAGVSADDAKAIADYIKTLK* |
| Ga0075425_1001730991 | 3300006854 | Populus Rhizosphere | PAVKGSSLSADQITDLLVKGEDAKKAPHKKAIAGVSADDAKAIADYIKTLK* |
| Ga0079219_111044411 | 3300006954 | Agricultural Soil | QITDLLTKGGEAKKAPHKKAIAGLSADDAKAVAEYVKTLK* |
| Ga0116218_13717381 | 3300009522 | Peatlands Soil | TKGDDAKKAPHKKALAGLSADDAKALATYVKSLK* |
| Ga0105237_107018521 | 3300009545 | Corn Rhizosphere | QITDLLTKGEEAKKAPHKKAMAGLSADDVKAVAEYVKTLK* |
| Ga0116125_10009581 | 3300009628 | Peatland | IADLLTKGNDTRKMPHKKPVSGLSADDAKAVADYVKTLK* |
| Ga0116114_10728343 | 3300009630 | Peatland | LSNGDDAKKPPHKKALNGVSADDAKAVADFVKSLK* |
| Ga0116106_10241071 | 3300009645 | Peatland | PERQGKVGSVLKGTSLTADQITELLTKGNDAKKQPHKKALSGVSADDAKAVADFVKTLK* |
| Ga0116130_12879931 | 3300009762 | Peatland | TFLTTGDDSKKAPHKKPVSGLTADDAKAVGEYVNSLK* |
| Ga0116134_13185992 | 3300009764 | Peatland | TSLTAEQITDLLAKGNDARKPPHKKALSGVSADDAKAVADFVKTLK* |
| Ga0074044_105165651 | 3300010343 | Bog Forest Soil | KRADEIVAFLTTGDESKKAPHKKPVGGLSADDAKAVADYVKSLK* |
| Ga0126370_117083431 | 3300010358 | Tropical Forest Soil | LLTKGNDAKKAPHKKAVAGVSADDAKAAADYVKTLK* |
| Ga0126379_104731622 | 3300010366 | Tropical Forest Soil | VTADQIIDMLTKGNDAKKPPHKKPLSGLTPEDAKAVADFVKSLK* |
| Ga0126381_1000487615 | 3300010376 | Tropical Forest Soil | TDLLTKGDDAKKAPHKKAVAGLSADDAKAAAEYVKTLK* |
| Ga0126381_1007870462 | 3300010376 | Tropical Forest Soil | EGQGKVGPAVKGTSLSADQITDLLTKGEDAKKAPHKKAIAGLSADDAKAVADYAKTLK* |
| Ga0136449_1009527301 | 3300010379 | Peatlands Soil | DVQISDLLTKGEDAKKAPHKKGLAGLSADDAKALATYVKALK* |
| Ga0126383_111869711 | 3300010398 | Tropical Forest Soil | DLLTKGEDAKKAPHKKAISGLSPEDAKAVADYVKTLK* |
| Ga0126383_121838861 | 3300010398 | Tropical Forest Soil | LTKGNDAKKPPHKKPLSGLTPEDAKAVADFVKSLK* |
| Ga0150985_1106656871 | 3300012212 | Avena Fatua Rhizosphere | LTSGQITDLLTKGDEARKAPHKKPLSSMAADDAKAVADFVKTLK* |
| Ga0150985_1128104621 | 3300012212 | Avena Fatua Rhizosphere | EGQGKVGPAVKGTSMTADQITDLLTKGTDAKKAPHKKAVTGVAAEDAKAVAEYVKTLK* |
| Ga0150984_1071634931 | 3300012469 | Avena Fatua Rhizosphere | PEWASGRGQEGQARGAPAVKGTTLGADQITDLLTKGAEAKKAPHKKSISGLSADDAKAVADYVKTLK* |
| Ga0150984_1072783691 | 3300012469 | Avena Fatua Rhizosphere | PALKRSALTSGQITDLLTKGDEARKAPHKKPLSSMAADDAKAVADFVKTLK* |
| Ga0126369_126369872 | 3300012971 | Tropical Forest Soil | DLLTKGNDAKKAPHKKEISGVAGDDAKGVAEYVKTLK* |
| Ga0164305_106359191 | 3300012989 | Soil | GPEGQGKVGPAVKGTALTADQITDLIVKGEDAKKAPHKKAMAGVTADDAKAVADYVKTLK |
| Ga0181532_103405471 | 3300014164 | Bog | GPEGQGKVGPVLKGTSLTADQITELLTKGNDAKKPPHKKALSGVSADDAKAVADFVKTLK |
| Ga0181523_101030324 | 3300014165 | Bog | GQIADLLTKGNDAKKAPHKKPVALSADEAKAVATFVTTLK* |
| Ga0181523_105167901 | 3300014165 | Bog | SLTADQISDILTKGNDAKKAPHKKPVSGVSADDAKAVAEYVKSLK* |
| Ga0182013_102345733 | 3300014492 | Bog | TAKSADEIATFITTGDEAKKAPHKKPIAGVSAEDAKAVADYIKSLK* |
| Ga0182016_104042961 | 3300014493 | Bog | LLTKGDDAKKAPHKKAISSLSADDAKAVAAFVKNLK* |
| Ga0182024_102061166 | 3300014501 | Permafrost | TELLTKGNDAKKPPHKKALSGVSADDAKAVADFVKTLK* |
| Ga0182035_112505951 | 3300016341 | Soil | LLTKGNDAKKAPHKKAVAGVSADDAKAAADYVKTLK |
| Ga0182032_104082861 | 3300016357 | Soil | TADQITDLLTKGNDAKKAPHKKAVAGVSADDAKAAADYVKTLK |
| Ga0187814_103429762 | 3300017932 | Freshwater Sediment | LLTKGNDAKKVPHKKAVAGVSADDAKAVADYVKTLK |
| Ga0187801_101948961 | 3300017933 | Freshwater Sediment | LKGTSLTSDQIVALLTKGNDAKKAPHKKEISGVTPDDAKAVADFVKTLK |
| Ga0187801_103177751 | 3300017933 | Freshwater Sediment | QISDLLTKGDDAKKAPHKKAVSGLSADDAKAVAAFVKTLK |
| Ga0187809_101109801 | 3300017937 | Freshwater Sediment | SLSADQITDLLTKGEDAKKAPHKKAITGLSADDAKAAAEYVKSLK |
| Ga0187850_100904661 | 3300017941 | Peatland | TLPAGQIADLLTKGNDAKKAPHKKPVALSADEAKAVATFVTTLK |
| Ga0187781_113334502 | 3300017972 | Tropical Peatland | LTKGDDAKKAPHKKPISGLSDDDAKAVADFVKTLK |
| Ga0187780_112140952 | 3300017973 | Tropical Peatland | ADGAGKIGPALKGSALTADQINDLLTKGNDAKKVPHKKPIAGLSADDSKAVADYVKTLK |
| Ga0187822_101556412 | 3300017994 | Freshwater Sediment | CHGAEGQGKIGPALKGVGLSEEQIVALLTKGDEAKKPPHKKPVNGLSADDAKAVAEHVKGLK |
| Ga0187884_103874691 | 3300018009 | Peatland | HGPEGQGKVGPVLKGTSLTADQITELLTKGNDAKKPPHKKALSGVSADDAKAVADFVKTL |
| Ga0187873_10901431 | 3300018013 | Peatland | TDLLTKGNDAKKAPHKKALSSLSADDAKAVAAYVKTLK |
| Ga0187872_103484891 | 3300018017 | Peatland | VGPALKGTNLSADQIVALLSNGDDAKKPPHKKALNGVSADDAKAVADFVKSLK |
| Ga0187882_12570761 | 3300018021 | Peatland | KVGPALKGTNLSADQIVALLSNGDDAKKPPHKKALNGVSADDAKAVADFVKSLK |
| Ga0187885_101060471 | 3300018025 | Peatland | KVGPVLKGTSLTADQITELLTKGNDAKKPPHKKALSGVSADDAKAVADFVKTLK |
| Ga0187869_101651681 | 3300018030 | Peatland | EGQGKVGPALKGTNLSADQIVALLSNGDDAKKPPHKKALNGVSADDAKAVADFVKSLK |
| Ga0187863_102597991 | 3300018034 | Peatland | IADFLTKGDDAKKAPHKKPLNGLSADDAKAVAEYVKTLK |
| Ga0187875_101857571 | 3300018035 | Peatland | LLTTGDDAKKAPHKKAISGLSADDAKAVAAFVKTLK |
| Ga0187855_102928552 | 3300018038 | Peatland | PALKGTALTEDQITGLLTKGDDAKKAPHKKPLTLSADDAKAVAAFVKTLK |
| Ga0187851_104339301 | 3300018046 | Peatland | LKGTSKSADEIVAFLTTGDESKKAPHKKPVGGLSADDAKAVADYVKSLK |
| Ga0187859_108898381 | 3300018047 | Peatland | ALTADQITALLTAGDDAKKAPHKKAISGLSPDDAKAVAGFVKTLK |
| Ga0187858_108098541 | 3300018057 | Peatland | LLTKGDDAKKAPHKKALSGVSADDAKALATYVKALK |
| Ga0187784_113299431 | 3300018062 | Tropical Peatland | PKLAGTAVTADQITDMLTKGDDAKKPPHKKPLSGLSADDAKAVAAFVKTLK |
| Ga0187772_107749372 | 3300018085 | Tropical Peatland | LTKGNDAKKVPHKKAINGLSADDVKAVAAFVKTLK |
| Ga0187772_108518961 | 3300018085 | Tropical Peatland | LLTKGADARKPPHKKPFSLSADEIKAVAAFVKTLK |
| Ga0187769_105244221 | 3300018086 | Tropical Peatland | ADEITDLLTKGNDAKKPPHKKPAAGLSADDAKAVAAFVKTLK |
| Ga0187771_102689711 | 3300018088 | Tropical Peatland | KVGPALKGASLNADQIANLLTKGDDAKKVPHKKPMSGLSADDAKAVAEFVKSLK |
| Ga0187771_109414631 | 3300018088 | Tropical Peatland | TALTADQIADLLTKGDDAKKPPHKKPFAGLSADDIKAVAAFVKSLK |
| Ga0187770_100456903 | 3300018090 | Tropical Peatland | LKGTSLSADEITDLLTKGNDAKKPPHKKPAAGLSADDAKAVAAFVKTLK |
| Ga0187770_108742761 | 3300018090 | Tropical Peatland | ADLLTKGNEAKKAPHKKPLSGLSADDAKAVAAFVKGLK |
| Ga0182031_11118844 | 3300019787 | Bog | ITTGDEAKKAPHKKPIAGVSAEDAKAVADYIKSLK |
| Ga0182031_11203982 | 3300019787 | Bog | TAKSADEIATFITTGDEAKKAPHKKPIAGVSAEDAKAVADYIKSLK |
| Ga0182031_11437104 | 3300019787 | Bog | AKSADEIATFITTGDEAKKAPHKKPIAGVSAEDAKAVADYIKSLK |
| Ga0210399_113469111 | 3300020581 | Soil | EGQGKIGPAVKGATLTADQITDLLAKGNDAKKAPHKKAIASVSADDAKAVADYVETLK |
| Ga0247666_10387321 | 3300024323 | Soil | GPAVKGSSLSADQITDLLVKGEDAKKAPHKKAIAGVSADDAKAIADYIKTLK |
| Ga0208936_10121981 | 3300025404 | Peatland | IADLLTKGDDAKKAPHKKAISSLSADDAKAVAAFVKNLK |
| Ga0208035_10455361 | 3300025406 | Peatland | LITTGDDSKKPPHKKPVTGLSPDDAKAVADYIKSLK |
| Ga0208194_10609002 | 3300025412 | Peatland | ALKGTTLGADKIVALLTTGDDAKKAPHKKPISGLTADDAKAVADYVKTLK |
| Ga0207700_100081609 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SALTADQITDLLVKGNDAKKVPHKKAVAGVSAEDAKAIADYVKTLK |
| Ga0207664_117511541 | 3300025929 | Agricultural Soil | LIVKGEDAKKAPHKKAMAGVTADDAKAVADYVKTLK |
| Ga0207702_109205522 | 3300026078 | Corn Rhizosphere | AVKGISLSTEQITDLLTKGEEAKKAPHKKAMAGLSADDAKAVAEYVKTLK |
| Ga0207702_120599672 | 3300026078 | Corn Rhizosphere | KGSSLSADQITDLLVKGEDAKKAPHKKAIAGVSADDAKAIADYIKTLK |
| Ga0208366_10255251 | 3300027073 | Forest Soil | ADQITDLLAKGNDAKKAPHKKAIAGVSADDAKAVADYVKTLK |
| Ga0209905_10135293 | 3300027634 | Thawing Permafrost | FITTGDEAKKAPHKKPIAGVSAEDAKAVADYIKSLK |
| Ga0209579_103097091 | 3300027869 | Surface Soil | LLAKGDDAKKAPHKKAISGVAGDDAKAVADYVKSLK |
| Ga0209415_100138031 | 3300027905 | Peatlands Soil | LKGTKLTDAQISDLLTKGDDAKKAPHKKAIASLSADDAKALATYVKSLK |
| Ga0265338_104198742 | 3300028800 | Rhizosphere | ADQIVDVLTKGNDAKKAPHKKPLSGMAADDAKAVAAYVKGMK |
| Ga0265338_107883532 | 3300028800 | Rhizosphere | DQIIDLLTKGNDAKKAPHKKALTGLSADDAKSVADFVKGLK |
| Ga0302278_101742681 | 3300028866 | Bog | GPKLAGTSLTADQISDLLTKGDDAKKAPHKKPVSGLSADDAKAVAAFVKTLK |
| Ga0302200_104973372 | 3300028909 | Bog | LTADQIADLLTKGDDAKKAPHKKAFSSLSADDAKAVAAFVKNLK |
| Ga0247275_11567361 | 3300029817 | Soil | LSADQIVALLSNGDDAKKPPHKKALNGVSADDAKAVADFVKSLK |
| Ga0311329_106243182 | 3300029907 | Bog | LLTKGDDAKKAPHKKPVSGLSADDAKAVAAFVKTLK |
| Ga0311361_109142962 | 3300029911 | Bog | SSGDIADLLTKGNDTRKMPHKKPVSGLSADDAKAVADYVKTLK |
| Ga0311328_101067301 | 3300029939 | Bog | ADLLTKGDDAKKAPHKKAFSSLSADDAKAVAAFVKNLK |
| Ga0170823_106745513 | 3300031128 | Forest Soil | DLLAKGNDTKKAPHKKAIAGVSADDAKAVADYVKTLK |
| Ga0170824_1141637381 | 3300031231 | Forest Soil | QITDLLTKGDDAKKAPHKKAMSGLSADDVKAVAAFVKTLK |
| Ga0302319_111563692 | 3300031788 | Bog | DLLTKGNDTRKMPHKKPVSGLSADDAKAVADYVKTLK |
| Ga0306919_109599131 | 3300031879 | Soil | PAVKGSSLTADQITDLLTKGNDAKKAPHKKAVAGVSADDAKAAADYVKTLK |
| Ga0306921_122833681 | 3300031912 | Soil | VKGTSLSADQINDLLTKGNDAKKAPHKKAVAGVAAEDAKAVADYVKTLK |
| Ga0307470_100265277 | 3300032174 | Hardwood Forest Soil | TADQITDLLAKGNDTKKAPHKKAIAGVSADDAKAVADYVKTLK |
| Ga0307472_1006230891 | 3300032205 | Hardwood Forest Soil | GPEGQGKVGPAVKGATLTTDQITDLLAKGNDAKKAPHKKAIAGLSADDAKAVADYVKTLK |
| Ga0335078_107132451 | 3300032805 | Soil | GADGGGKVGPALKGNSMSADQIAAFLTKGDDARKAPHKKPISGLSPDDAKSVAEYVKSLK |
| Ga0335069_100361086 | 3300032893 | Soil | FLTKGDDAKKAPHKKAITGLSADDAKSVAEYVKTLK |
| Ga0335071_102828523 | 3300032897 | Soil | TSLSEDQIAGVLTKGDDAKKPPHKKPLNGLSADDAKAVAAFVKSLK |
| Ga0335084_108792041 | 3300033004 | Soil | QITDLLTKGEDAKKAPHKKAINGVSADDAKAVADYVKTLK |
| Ga0335073_105847791 | 3300033134 | Soil | SLSAEQITDLLTKGDAAKKAPHKAAISSLAADDAKAVAEFVKSLK |
| Ga0335077_100427831 | 3300033158 | Soil | SLTADQITDLLTKGEDAKKAPHKKALAGLSADDAKAVAEYVKTLK |
| Ga0314866_006247_55_216 | 3300033807 | Peatland | VGPALKGTSLNEDQISGLLAKGDDTKKPPHKKPMNGLSADDAKAVAAFVKTLK |
| ⦗Top⦘ |