| Basic Information | |
|---|---|
| Family ID | F075145 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPPGGPF |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 23.53 % |
| % of genes near scaffold ends (potentially truncated) | 38.66 % |
| % of genes from short scaffolds (< 2000 bps) | 76.47 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.387 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.084 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.933 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (29.412 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.33% β-sheet: 0.00% Coil/Unstructured: 50.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 22.69 |
| PF04519 | Bactofilin | 13.45 |
| PF13304 | AAA_21 | 10.08 |
| PF02826 | 2-Hacid_dh_C | 7.56 |
| PF13432 | TPR_16 | 3.36 |
| PF13476 | AAA_23 | 3.36 |
| PF13551 | HTH_29 | 2.52 |
| PF14559 | TPR_19 | 2.52 |
| PF13561 | adh_short_C2 | 0.84 |
| PF00665 | rve | 0.84 |
| PF13174 | TPR_6 | 0.84 |
| PF13518 | HTH_28 | 0.84 |
| PF05138 | PaaA_PaaC | 0.84 |
| PF00263 | Secretin | 0.84 |
| PF01243 | Putative_PNPOx | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 13.45 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.84 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.84 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.84 |
| COG3396 | 1,2-phenylacetyl-CoA epoxidase, catalytic subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.39 % |
| Unclassified | root | N/A | 33.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459015|G14TP7Y01DY8PU | Not Available | 586 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104781344 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300000881|JGI10215J12807_1175837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 602 | Open in IMG/M |
| 3300002122|C687J26623_10033600 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1373 | Open in IMG/M |
| 3300002886|JGI25612J43240_1058091 | Not Available | 585 | Open in IMG/M |
| 3300003347|JGI26128J50194_1007373 | Not Available | 709 | Open in IMG/M |
| 3300003994|Ga0055435_10044931 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300003995|Ga0055438_10015574 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300004114|Ga0062593_101263790 | Not Available | 779 | Open in IMG/M |
| 3300004156|Ga0062589_101895298 | Not Available | 601 | Open in IMG/M |
| 3300005295|Ga0065707_10393010 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005332|Ga0066388_101374169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1224 | Open in IMG/M |
| 3300005332|Ga0066388_106497273 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
| 3300005468|Ga0070707_100202431 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
| 3300005468|Ga0070707_101127930 | Not Available | 750 | Open in IMG/M |
| 3300005713|Ga0066905_100007141 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4956 | Open in IMG/M |
| 3300005719|Ga0068861_101893196 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005876|Ga0075300_1007473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. L21 | 1169 | Open in IMG/M |
| 3300005878|Ga0075297_1001682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1615 | Open in IMG/M |
| 3300005921|Ga0070766_10667060 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300005937|Ga0081455_10000060 | All Organisms → cellular organisms → Bacteria | 119012 | Open in IMG/M |
| 3300005937|Ga0081455_10113625 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
| 3300005937|Ga0081455_10299866 | Not Available | 1153 | Open in IMG/M |
| 3300006176|Ga0070765_100037065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3864 | Open in IMG/M |
| 3300006845|Ga0075421_100403502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1641 | Open in IMG/M |
| 3300009053|Ga0105095_10785561 | Not Available | 533 | Open in IMG/M |
| 3300009078|Ga0105106_10873145 | Not Available | 640 | Open in IMG/M |
| 3300009147|Ga0114129_10021789 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 9096 | Open in IMG/M |
| 3300009166|Ga0105100_10265104 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1028 | Open in IMG/M |
| 3300009792|Ga0126374_10376128 | Not Available | 984 | Open in IMG/M |
| 3300009809|Ga0105089_1045101 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300010358|Ga0126370_10137398 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1761 | Open in IMG/M |
| 3300010360|Ga0126372_10174286 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1756 | Open in IMG/M |
| 3300010362|Ga0126377_10552909 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1190 | Open in IMG/M |
| 3300010366|Ga0126379_12350202 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 633 | Open in IMG/M |
| 3300010391|Ga0136847_13506729 | Not Available | 906 | Open in IMG/M |
| 3300011270|Ga0137391_10086557 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2708 | Open in IMG/M |
| 3300011395|Ga0137315_1070514 | Not Available | 506 | Open in IMG/M |
| 3300011410|Ga0137440_1072627 | Not Available | 683 | Open in IMG/M |
| 3300012034|Ga0137453_1054500 | Not Available | 733 | Open in IMG/M |
| 3300012164|Ga0137352_1085625 | Not Available | 628 | Open in IMG/M |
| 3300012174|Ga0137338_1139483 | Not Available | 530 | Open in IMG/M |
| 3300012203|Ga0137399_11080423 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012207|Ga0137381_11254040 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012225|Ga0137434_1002516 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300012355|Ga0137369_10569235 | Not Available | 792 | Open in IMG/M |
| 3300012685|Ga0137397_10107864 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300012900|Ga0157292_10240411 | Not Available | 624 | Open in IMG/M |
| 3300012902|Ga0157291_10095955 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300012929|Ga0137404_10451609 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300012930|Ga0137407_12060397 | Not Available | 545 | Open in IMG/M |
| 3300012944|Ga0137410_10011592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5977 | Open in IMG/M |
| 3300014318|Ga0075351_1134830 | Not Available | 571 | Open in IMG/M |
| 3300014877|Ga0180074_1044720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 930 | Open in IMG/M |
| 3300014881|Ga0180094_1006095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2146 | Open in IMG/M |
| 3300014884|Ga0180104_1016679 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1779 | Open in IMG/M |
| 3300014885|Ga0180063_1302668 | Not Available | 507 | Open in IMG/M |
| 3300015371|Ga0132258_10006179 | All Organisms → cellular organisms → Bacteria | 23753 | Open in IMG/M |
| 3300017939|Ga0187775_10017980 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1902 | Open in IMG/M |
| 3300017959|Ga0187779_10167578 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1362 | Open in IMG/M |
| 3300018028|Ga0184608_10050115 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1641 | Open in IMG/M |
| 3300018031|Ga0184634_10244319 | Not Available | 822 | Open in IMG/M |
| 3300018052|Ga0184638_1027550 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300018078|Ga0184612_10039745 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2444 | Open in IMG/M |
| 3300018422|Ga0190265_10052049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3577 | Open in IMG/M |
| 3300018429|Ga0190272_10158817 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1570 | Open in IMG/M |
| 3300019458|Ga0187892_10064081 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300019458|Ga0187892_10555985 | Not Available | 518 | Open in IMG/M |
| 3300019487|Ga0187893_10572755 | Not Available | 721 | Open in IMG/M |
| 3300019879|Ga0193723_1020831 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300019886|Ga0193727_1172865 | Not Available | 563 | Open in IMG/M |
| 3300020061|Ga0193716_1036204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. L21 | 2378 | Open in IMG/M |
| 3300020579|Ga0210407_10152176 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1784 | Open in IMG/M |
| 3300020580|Ga0210403_10601472 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300020583|Ga0210401_11582218 | Not Available | 513 | Open in IMG/M |
| 3300021078|Ga0210381_10280553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. L21 | 598 | Open in IMG/M |
| 3300022534|Ga0224452_1035502 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1451 | Open in IMG/M |
| 3300023067|Ga0247743_1050502 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300023072|Ga0247799_1000276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7112 | Open in IMG/M |
| 3300025165|Ga0209108_10150156 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1229 | Open in IMG/M |
| 3300025324|Ga0209640_10074898 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2927 | Open in IMG/M |
| 3300025521|Ga0210083_1013894 | Not Available | 1079 | Open in IMG/M |
| 3300025580|Ga0210138_1006823 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300025907|Ga0207645_10366760 | Not Available | 965 | Open in IMG/M |
| 3300025913|Ga0207695_11166720 | Not Available | 650 | Open in IMG/M |
| 3300025917|Ga0207660_10023666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4151 | Open in IMG/M |
| 3300025922|Ga0207646_10219116 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1719 | Open in IMG/M |
| 3300025961|Ga0207712_11262426 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 660 | Open in IMG/M |
| 3300025985|Ga0210117_1033354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
| 3300026285|Ga0209438_1000687 | All Organisms → cellular organisms → Bacteria | 10615 | Open in IMG/M |
| 3300026507|Ga0257165_1048531 | Not Available | 761 | Open in IMG/M |
| 3300027364|Ga0209967_1072125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 539 | Open in IMG/M |
| 3300027384|Ga0209854_1074936 | Not Available | 597 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10126117 | Not Available | 875 | Open in IMG/M |
| 3300027815|Ga0209726_10021513 | All Organisms → cellular organisms → Bacteria | 5462 | Open in IMG/M |
| 3300027889|Ga0209380_10455026 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300028592|Ga0247822_11083810 | Not Available | 665 | Open in IMG/M |
| 3300028793|Ga0307299_10393935 | Not Available | 519 | Open in IMG/M |
| 3300028796|Ga0307287_10351562 | Not Available | 556 | Open in IMG/M |
| 3300028828|Ga0307312_10143978 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1508 | Open in IMG/M |
| 3300030006|Ga0299907_10567573 | Not Available | 887 | Open in IMG/M |
| 3300030336|Ga0247826_10265434 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300030619|Ga0268386_10018395 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 5485 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1009725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1932 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10006068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3126 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10021780 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10133845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 676 | Open in IMG/M |
| 3300031229|Ga0299913_10318550 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1542 | Open in IMG/M |
| (restricted) 3300031237|Ga0255334_1027363 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031720|Ga0307469_11322094 | Not Available | 685 | Open in IMG/M |
| 3300031740|Ga0307468_100030882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2551 | Open in IMG/M |
| 3300031858|Ga0310892_11129977 | Not Available | 556 | Open in IMG/M |
| 3300031949|Ga0214473_11059758 | Not Available | 851 | Open in IMG/M |
| 3300031962|Ga0307479_10970096 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 820 | Open in IMG/M |
| 3300032174|Ga0307470_10002584 | All Organisms → cellular organisms → Bacteria | 6913 | Open in IMG/M |
| 3300032770|Ga0335085_10096073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3844 | Open in IMG/M |
| 3300033233|Ga0334722_10137694 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1834 | Open in IMG/M |
| 3300033813|Ga0364928_0053387 | Not Available | 892 | Open in IMG/M |
| 3300034165|Ga0364942_0010442 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2878 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.08% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.20% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 4.20% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.36% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.52% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.68% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.68% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 1.68% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.68% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.68% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.84% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.84% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Host-Associated | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011395 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2 | Environmental | Open in IMG/M |
| 3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
| 3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300023067 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025521 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031237 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_35cm_T3_129 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4PV_02944030 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | LHVAIWLATLFFTAMLFVPLLREALRRVIELPAGGGHF |
| INPhiseqgaiiFebDRAFT_1047813441 | 3300000364 | Soil | MAQPDRPSRLIQVAIWLATLFFTVMLFVPLIREALRRAAEALPGGHF* |
| JGI10215J12807_11758372 | 3300000881 | Soil | MPPPARRARLVQVGIWLATLVFIVMLFLPLIREALRR |
| C687J26623_100336003 | 3300002122 | Soil | MLDAGGRARLLHVVIWLATLFFAAMLFVPLLREALRRMTDLPPGGPF* |
| JGI25612J43240_10580911 | 3300002886 | Grasslands Soil | ASMLDGGGRARLLHVAIWLATLFFTAMLFVPLLSEALRRVTDTPPGGPF* |
| JGI26128J50194_10073732 | 3300003347 | Arabidopsis Thaliana Rhizosphere | MPPPARRARLVQVGIWLATLVFIVMLFLPLIREALRRAAEPLPGGHF* |
| Ga0055435_100449313 | 3300003994 | Natural And Restored Wetlands | WAGRGTTLPALMVDTGGRARLLHVVIWLATLFFTAMLFVPLLREALRRVTDLPSGGHF* |
| Ga0055438_100155743 | 3300003995 | Natural And Restored Wetlands | MVDTGGRARLLHVVIWLATLFFTAMLFVPLLREALRRVTDLPSGGHF* |
| Ga0062593_1012637902 | 3300004114 | Soil | MLDSGGRARLLHVAIWLATLFFTAMLFVPLLSEALRRVTDTPPGGPF* |
| Ga0062589_1018952981 | 3300004156 | Soil | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVIELPAGGGHF* |
| Ga0065707_103930103 | 3300005295 | Switchgrass Rhizosphere | GDYPAPSMLDSGGRARLLHVAIWLATLFFTAMLFVPLLREVLRRLTEPPPGGPF* |
| Ga0066388_1013741693 | 3300005332 | Tropical Forest Soil | STMREGGRGARLLHIGIWLATLFFAAKLFVPLVKEALRRAGSVPPGGPF* |
| Ga0066388_1064972731 | 3300005332 | Tropical Forest Soil | STMREGGRGARLLHIGIWLATLFFAAKLFVPLVKEALRRAGSIPPGGPF* |
| Ga0070707_1002024313 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGAHF* |
| Ga0070707_1011279301 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDSGGRARLLHVAIWLATLFFTAMLFVPLLREVLRRLTEPPPGGPF* |
| Ga0066905_1000071415 | 3300005713 | Tropical Forest Soil | MAQPDRPSRLIQVAIWLATLFFTVMLFVPLIREALRRAAERAPGGPF* |
| Ga0068861_1018931961 | 3300005719 | Switchgrass Rhizosphere | ARRARLVQVGIWLATLVFIVMLFLPLIREALRRAAEPLPGGHF* |
| Ga0075300_10074731 | 3300005876 | Rice Paddy Soil | GPSSRLLQLAIWLATLFFAAMLFVPLIRAVLRRAAEVPPGHF* |
| Ga0075297_10016822 | 3300005878 | Rice Paddy Soil | MPEDSGPSSRLLQLAIWLATLFFAAMLFVPLIRAVLRRAAEVPPGF* |
| Ga0070766_106670603 | 3300005921 | Soil | LHLLIWLATLFFAAMLFVPLVREALRRLFEAPLGGHF* |
| Ga0081455_1000006096 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPDAHRRAWLIRAAIWLATLFFAAMLFVPLVREAVRRAAEQVPGGHF* |
| Ga0081455_101136253 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAQPDRPSRLIQVAIWLATLFFTVMLFVPLIREALRRAAEPLPGGPF* |
| Ga0081455_102998663 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPVGGLRVRLLQVAIWLATLFFAAMLFVPLLREALRRMAEPLPGSHF* |
| Ga0070765_1000370653 | 3300006176 | Soil | MTDGGPRARLLHLLIWLATLFFAAMLFVPLVREALRRLFEAPLGGHF* |
| Ga0075421_1004035023 | 3300006845 | Populus Rhizosphere | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGGPF* |
| Ga0105095_107855611 | 3300009053 | Freshwater Sediment | MLDSAGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSSGHF* |
| Ga0105106_108731452 | 3300009078 | Freshwater Sediment | MLDSAGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELSSSGHF* |
| Ga0114129_1002178911 | 3300009147 | Populus Rhizosphere | MLDSGGRARLLHVAIWLATLFFTAMLFVPLLREVLRRLTEPPPAGPF* |
| Ga0105100_102651044 | 3300009166 | Freshwater Sediment | MLDSAGRARLLHVAIWLATLFFTAKIFVTLMREALRRVTQQPYRGQY |
| Ga0126374_103761283 | 3300009792 | Tropical Forest Soil | MREGGRGARLLHIGIWLATLFFAAKLFVPLVKEALRRAGSIPPGGPF* |
| Ga0105089_10451011 | 3300009809 | Groundwater Sand | MPDGGLRARLLHVAIWLATLLFAALLFVPLVREALRRAAEPLPGVHF* |
| Ga0126370_101373982 | 3300010358 | Tropical Forest Soil | MREGGRGARLLHIGIWLATLFFAAKLFVPLVKEALRRAGSVPPGGPF* |
| Ga0126372_101742861 | 3300010360 | Tropical Forest Soil | EGGRGARLLHIGIWLATLFFAAKLFVPLVKEALRRAGSIPPGGPF* |
| Ga0126377_105529091 | 3300010362 | Tropical Forest Soil | MAQPDRPSRLIQVAIWLATLFFTVMLFVPLIREALRRAAERAPG |
| Ga0126379_123502023 | 3300010366 | Tropical Forest Soil | GARLLHIGIWLATLFFAAKLFVPLVKEALRRAGSVPPGGPF* |
| Ga0136847_135067292 | 3300010391 | Freshwater Sediment | MLDSGRRARLLHVAIWLATLFFTAMLFVPLLREALRRVFDLPSSGPF* |
| Ga0137391_100865571 | 3300011270 | Vadose Zone Soil | GSMLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGGPF* |
| Ga0137315_10705141 | 3300011395 | Soil | MLDTGGRARLLHVAIWLATLFFTAMLVVPLLREALRRVTELPSGGPF* |
| Ga0137440_10726273 | 3300011410 | Soil | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPS |
| Ga0137453_10545001 | 3300012034 | Soil | MPESGRRARLLHVAIWLATLFFTAMLFVPLLREALRRVSELPSGGPF* |
| Ga0137352_10856253 | 3300012164 | Soil | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTERPSGGPF |
| Ga0137338_11394832 | 3300012174 | Soil | MLDTGGHARLLHVAIWLATLFFTAMLFVPLLREALRRVTERPSGGPFSF* |
| Ga0137399_110804231 | 3300012203 | Vadose Zone Soil | HVAIWLATLFFTAMLFVPLLREVLRRLTEPPPGGPF* |
| Ga0137381_112540403 | 3300012207 | Vadose Zone Soil | AASMLDGGGRARLLHVAIWLATMFFTAMLFVPLLREVLRRLTEPPPGGPF* |
| Ga0137434_10025164 | 3300012225 | Soil | PGSMLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGGPF* |
| Ga0137369_105692353 | 3300012355 | Vadose Zone Soil | MLDSGGRARLLHVAIWLATLFFTAMLFVPLLREVLRRLTEPPASGPF* |
| Ga0137397_101078644 | 3300012685 | Vadose Zone Soil | MLDGGGRARLLHVAIWLATLFFTAMLFVPLLSEALRRVTDTPPGGPF* |
| Ga0157292_102404113 | 3300012900 | Soil | MPPPARRARLVQVGIWLATLVFIVMLFLPLIREALRRAA |
| Ga0157291_100959551 | 3300012902 | Soil | PPARRARLVQVGIWLATLVFIVMLFLPLIREALRRAAEPLPGGHF* |
| Ga0137404_104516093 | 3300012929 | Vadose Zone Soil | VAIWLATLFFTAMLFVPLLREVLRRLTEPPPGGPF* |
| Ga0137407_120603973 | 3300012930 | Vadose Zone Soil | MLDSGGRARLLRVAISPAPLFFTAMLFVPLLREVLRRLTEPPPGGPF* |
| Ga0137410_100115925 | 3300012944 | Vadose Zone Soil | MLDGGGRARLLHVAIWLATLFFTATLFVPLLSEALRRVTDTPPGGPF* |
| Ga0075351_11348302 | 3300014318 | Natural And Restored Wetlands | MDDDGRRARLLHVAIWLATLFFTAMLFVPLLREALRRMSDLPSGSHF* |
| Ga0180074_10447203 | 3300014877 | Soil | MLDSARRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGGHF* |
| Ga0180094_10060951 | 3300014881 | Soil | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTERPSGGPF* |
| Ga0180104_10166793 | 3300014884 | Soil | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTERPSGGPFSF* |
| Ga0180063_13026681 | 3300014885 | Soil | ARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGGPFSF* |
| Ga0132258_1000617927 | 3300015371 | Arabidopsis Rhizosphere | MLHRRAWLVQAGIWLATLFFVVMLFVPLVREALRRAAEPLPGGHF* |
| Ga0187775_100179804 | 3300017939 | Tropical Peatland | MPAGGLRARLLHVAIWLATLFFAVMLFVPLIREALRRVSMLPPGGHF |
| Ga0187779_101675783 | 3300017959 | Tropical Peatland | MPEGGSRTRLLHLLIWLATLFFAAMLFVPLVREALHRLVTSPLGGQF |
| Ga0184608_100501151 | 3300018028 | Groundwater Sediment | MLDSGGRARLLHVAIWLATLFFTAMLFVPLLREVLRRLTEPPPGGPF |
| Ga0184634_102443193 | 3300018031 | Groundwater Sediment | ADRARDYCPGSMLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGGPF |
| Ga0184638_10275503 | 3300018052 | Groundwater Sediment | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGGPF |
| Ga0184612_100397454 | 3300018078 | Groundwater Sediment | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPPGGPF |
| Ga0190265_100520493 | 3300018422 | Soil | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTEVPSGGPF |
| Ga0190272_101588171 | 3300018429 | Soil | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTE |
| Ga0187892_100640815 | 3300019458 | Bio-Ooze | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPTGGPF |
| Ga0187892_105559853 | 3300019458 | Bio-Ooze | LLHVAIWLATLFFTAMLFVPLLREALRRVTERPTGGPF |
| Ga0187893_105727553 | 3300019487 | Microbial Mat On Rocks | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTERPTGGPF |
| Ga0193723_10208314 | 3300019879 | Soil | MLDGGGRARLLHVAIWLATLFFTAMLFVPLLSEALRRVTETPPGGPF |
| Ga0193727_11728651 | 3300019886 | Soil | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVT |
| Ga0193716_10362042 | 3300020061 | Soil | MPDSGRRARLLHVVIWLATLFFTAMLFVPLLREALRRMTDLPSGSHF |
| Ga0210407_101521762 | 3300020579 | Soil | MTDGGPRARLLHLLIWLATLFFAAMLFVPLVREALRRLFEPPLGGHF |
| Ga0210403_106014723 | 3300020580 | Soil | MTDGGPRARLLHLLIWLATLFFAAMLFVPLVREALRRLFEAPLGGHF |
| Ga0210401_115822181 | 3300020583 | Soil | LHAMTDGGPRARLLHLLIWLATLFFAAMLFVPLVREALRRLFEAPLGGHF |
| Ga0210381_102805531 | 3300021078 | Groundwater Sediment | DSGGRARLLHVAIWLATLFFTAMLFVPLLREVLRRLTEPPPGGPF |
| Ga0224452_10355024 | 3300022534 | Groundwater Sediment | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELP |
| Ga0247743_10505023 | 3300023067 | Soil | RLVQVGIWLATLVFIVMLFLPLIREALRRAAEPLPGGHF |
| Ga0247799_10002769 | 3300023072 | Soil | MPPPARRARLVQVGIWLATLVFIVMLFLPLIREALRRAAEPLPGGHF |
| Ga0209108_101501563 | 3300025165 | Soil | MLDAGGRARLLHVVIWLATLFFAAMLFVPLLREALRRMTDLPPGGPF |
| Ga0209640_100748986 | 3300025324 | Soil | LHVAIWLATLFFTAMLFVPLLREALRRVTELPSRGPFSF |
| Ga0210083_10138941 | 3300025521 | Natural And Restored Wetlands | MVDTGGRARLLHVVIWLATLFFTAMLFVPLLREALRRVTDLPSGGHF |
| Ga0210138_10068235 | 3300025580 | Natural And Restored Wetlands | MVDTGGRARLLHVVIWLATLFFTAMLFVPLLREAL |
| Ga0207645_103667602 | 3300025907 | Miscanthus Rhizosphere | MLDSGGRARLLHVAIWLATLFFTAMLFVPLLSEALRRVTDTPPGGPF |
| Ga0207695_111667201 | 3300025913 | Corn Rhizosphere | LDSGGRARLLHVAIWLATLFFTAMLFVPLLSEALRRVTDTPPGGPF |
| Ga0207660_100236665 | 3300025917 | Corn Rhizosphere | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVIELPAGGGHF |
| Ga0207646_102191162 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGAHF |
| Ga0207712_112624261 | 3300025961 | Switchgrass Rhizosphere | LLHVAIWLATLFFTAMLFVPLLSEALRRVTDTPPGGPF |
| Ga0210117_10333541 | 3300025985 | Natural And Restored Wetlands | MVDTGGRARLLHVVIWLATLFFTAMLFVPLLREALRRMSDLPSGSHF |
| Ga0209438_100068713 | 3300026285 | Grasslands Soil | VASMLDGGGRARLLHVAIWLATLFFTAMLFVPLLSEALRRVTDTPPGGPF |
| Ga0257165_10485313 | 3300026507 | Soil | DYAPASMLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGGPF |
| Ga0209967_10721252 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MGHLPPPARRARLVQVGIWLATLVFIVMLFLPLIREALRRAAEPLPGGHF |
| Ga0209854_10749362 | 3300027384 | Groundwater Sand | MLDSGRHARLLHVAIWLATLFFTAMLFVPLLREALRRVTEL |
| (restricted) Ga0233416_101261173 | 3300027799 | Sediment | MLDTDGRMRLLRVVIWLATLFFAAMLFVPLLREAARRMSELPSGAAF |
| Ga0209726_100215136 | 3300027815 | Groundwater | MLDTGGHARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGGHF |
| Ga0209380_104550261 | 3300027889 | Soil | TDGGPRARLLHLLIWLATLFFAAMLFVPLVREALRRLFEAPLGGHF |
| Ga0247822_110838101 | 3300028592 | Soil | MLDSGGRARLLHVAIWLATLFFTAMLFVPLLSEALRRVTDTPPG |
| Ga0307299_103939351 | 3300028793 | Soil | LDSGGRARLLHVAIWLATLFFTAMLFVPLLREVLRRLTEPPPGGPF |
| Ga0307287_103515622 | 3300028796 | Soil | LDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSGGPF |
| Ga0307312_101439783 | 3300028828 | Soil | MLDTGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSSGPF |
| Ga0299907_105675731 | 3300030006 | Soil | MPDTGRRARLLHVAIWLATLFFTAMLFVPLVREALRRMTELPTGGPF |
| Ga0247826_102654344 | 3300030336 | Soil | LHVAIWLATLIFTAMLFVPLLSEAVRRVTEMPAGGHF |
| Ga0268386_100183956 | 3300030619 | Soil | MPDTGRRARLLHVAIWLATLFFTAMLFVPLVREALRRMTELPSGGPF |
| (restricted) Ga0255311_10097254 | 3300031150 | Sandy Soil | MRDYSPVLMLDSAGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSSGHF |
| (restricted) Ga0255310_100060683 | 3300031197 | Sandy Soil | MLDSGGRARLLHVAIWLATLFFTAMLFAPLLSEAVRRVTETPSGGHF |
| (restricted) Ga0255310_100217801 | 3300031197 | Sandy Soil | AGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSSGHF |
| (restricted) Ga0255310_101338451 | 3300031197 | Sandy Soil | MRDYAPVLMLDSVGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSSGHF |
| Ga0299913_103185504 | 3300031229 | Soil | MPDTGRRARLLHVAIWLATLFFTAMLFVPLAREALRRMTELPSGGPF |
| (restricted) Ga0255334_10273633 | 3300031237 | Sandy Soil | LMLDSAGRARLLHVAIWLATLFFTAMLFVPLLREALRRVTELPSSGHF |
| Ga0307469_113220942 | 3300031720 | Hardwood Forest Soil | MLEPGGRARLLHVAIWLATLFFTAMLFVPLLREALRRVIELPAGGHF |
| Ga0307468_1000308825 | 3300031740 | Hardwood Forest Soil | TTLQASMLDGGGRARLLHVAIWLATLFFTAMLFVPLLSEALRRVTETPPGGPF |
| Ga0310892_111299772 | 3300031858 | Soil | MPPPDRRARLVQVGIWLATLVFIVMLFLPLIREALRRAAEPLPGGHF |
| Ga0214473_110597582 | 3300031949 | Soil | MLDTGGRARLLHVAIWLATLFFTAMLFVPLVREALHRVTELPSGGPF |
| Ga0307479_109700963 | 3300031962 | Hardwood Forest Soil | MTDGGPRARLLHLLIWLATLFFAAMLFVPLVREALRRLFEAPLGG |
| Ga0307470_100025847 | 3300032174 | Hardwood Forest Soil | MRDAGRRARLLHVAIWLATLFFTAMLFVPLLREALRRVTDLPSGSHF |
| Ga0335085_100960737 | 3300032770 | Soil | VAIWLATLFFAVMLFVPLIREALRRAAQPLPGGHF |
| Ga0334722_101376944 | 3300033233 | Sediment | MLDSGRRARLLHVAIWLATLFFTAMLFVPLLREALRRVTDLPSAGHF |
| Ga0364928_0053387_13_120 | 3300033813 | Sediment | VAIWLATLFFTAMLFVPLLREALRRVTELPSGGPF |
| Ga0364942_0010442_1816_1959 | 3300034165 | Sediment | MPDGGLRARLLHVAIWLATLLFVAMLFVPLVREALRRAAESLPGGHF |
| ⦗Top⦘ |