| Basic Information | |
|---|---|
| Family ID | F075132 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 38 residues |
| Representative Sequence | AYIDTFMVLSVGAAIMFCLAFVLKKNDPGGGGVRVAE |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 98.32 % |
| % of genes from short scaffolds (< 2000 bps) | 93.28 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.639 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.294 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.101 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.85% β-sheet: 0.00% Coil/Unstructured: 66.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF13189 | Cytidylate_kin2 | 73.95 |
| PF00582 | Usp | 13.45 |
| PF08570 | DUF1761 | 1.68 |
| PF12911 | OppC_N | 0.84 |
| PF00027 | cNMP_binding | 0.84 |
| PF00343 | Phosphorylase | 0.84 |
| PF02656 | DUF202 | 0.84 |
| PF13561 | adh_short_C2 | 0.84 |
| PF01494 | FAD_binding_3 | 0.84 |
| PF02321 | OEP | 0.84 |
| PF00408 | PGM_PMM_IV | 0.84 |
| PF13602 | ADH_zinc_N_2 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.68 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.84 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 0.84 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.84 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.84 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.84 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.84 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.64 % |
| Unclassified | root | N/A | 3.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10158245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 916 | Open in IMG/M |
| 3300004091|Ga0062387_100178133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1258 | Open in IMG/M |
| 3300004092|Ga0062389_101766144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 799 | Open in IMG/M |
| 3300004092|Ga0062389_103191804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 614 | Open in IMG/M |
| 3300004635|Ga0062388_100760965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 913 | Open in IMG/M |
| 3300005332|Ga0066388_102149804 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300005468|Ga0070707_101688057 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005530|Ga0070679_101693597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300005602|Ga0070762_10386765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
| 3300005602|Ga0070762_10832544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 626 | Open in IMG/M |
| 3300005610|Ga0070763_10645735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 616 | Open in IMG/M |
| 3300005764|Ga0066903_101496210 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300006028|Ga0070717_11161903 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300006028|Ga0070717_11933895 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006176|Ga0070765_100292901 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300006176|Ga0070765_100326379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1423 | Open in IMG/M |
| 3300006176|Ga0070765_100683927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 969 | Open in IMG/M |
| 3300009093|Ga0105240_11141017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| 3300010043|Ga0126380_11157644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300010343|Ga0074044_11081634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300010358|Ga0126370_12480916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300010360|Ga0126372_10420106 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300010361|Ga0126378_10560496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1257 | Open in IMG/M |
| 3300010376|Ga0126381_100245715 | All Organisms → cellular organisms → Bacteria | 2421 | Open in IMG/M |
| 3300010401|Ga0134121_10336504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1347 | Open in IMG/M |
| 3300011270|Ga0137391_11154491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300011442|Ga0137437_1210459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300012202|Ga0137363_10740985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
| 3300012362|Ga0137361_11086108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300012917|Ga0137395_10028011 | All Organisms → cellular organisms → Bacteria | 3368 | Open in IMG/M |
| 3300012957|Ga0164303_11405504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300012971|Ga0126369_10604494 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300012989|Ga0164305_11021429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300014159|Ga0181530_10282588 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300014200|Ga0181526_10937951 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300014325|Ga0163163_11202595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300014325|Ga0163163_12178369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300015264|Ga0137403_10776668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300015371|Ga0132258_12261986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1364 | Open in IMG/M |
| 3300016270|Ga0182036_10428701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300016357|Ga0182032_11214982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300016445|Ga0182038_10333284 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300017822|Ga0187802_10456613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300017930|Ga0187825_10406762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300017933|Ga0187801_10087344 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300017942|Ga0187808_10615666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300017972|Ga0187781_11003546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300017974|Ga0187777_10301949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1094 | Open in IMG/M |
| 3300017995|Ga0187816_10131961 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300018006|Ga0187804_10264582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300018006|Ga0187804_10589869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300018043|Ga0187887_10480367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300018044|Ga0187890_10409338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300018429|Ga0190272_11211153 | Not Available | 743 | Open in IMG/M |
| 3300020022|Ga0193733_1097961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 819 | Open in IMG/M |
| 3300020199|Ga0179592_10449233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300020579|Ga0210407_10398911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1076 | Open in IMG/M |
| 3300020579|Ga0210407_11203279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300020580|Ga0210403_11064582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300020581|Ga0210399_10513613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300021046|Ga0215015_10149526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 643 | Open in IMG/M |
| 3300021168|Ga0210406_11067887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300021170|Ga0210400_10578600 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300021171|Ga0210405_10259106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1376 | Open in IMG/M |
| 3300021171|Ga0210405_10305252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1258 | Open in IMG/M |
| 3300021402|Ga0210385_10854777 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300021403|Ga0210397_10334041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
| 3300021406|Ga0210386_10469363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1087 | Open in IMG/M |
| 3300021411|Ga0193709_1092262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300021420|Ga0210394_10060787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3284 | Open in IMG/M |
| 3300021420|Ga0210394_11133075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 674 | Open in IMG/M |
| 3300021432|Ga0210384_11143080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300021433|Ga0210391_10101041 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
| 3300021433|Ga0210391_10928638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300021478|Ga0210402_11076022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 731 | Open in IMG/M |
| 3300021479|Ga0210410_10749178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300021559|Ga0210409_11362279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300021560|Ga0126371_10067706 | All Organisms → cellular organisms → Bacteria | 3462 | Open in IMG/M |
| 3300023250|Ga0224544_1033854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300025588|Ga0208586_1091659 | Not Available | 661 | Open in IMG/M |
| 3300025913|Ga0207695_11670041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300025914|Ga0207671_10794826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300025932|Ga0207690_10286202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1285 | Open in IMG/M |
| 3300026557|Ga0179587_11001089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300026845|Ga0207760_116544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300027528|Ga0208985_1108369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300027609|Ga0209221_1060298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300027701|Ga0209447_10167719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300027727|Ga0209328_10064535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1122 | Open in IMG/M |
| 3300027824|Ga0209040_10404723 | Not Available | 633 | Open in IMG/M |
| 3300027882|Ga0209590_10507550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300027889|Ga0209380_10639072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300028746|Ga0302233_10040343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1944 | Open in IMG/M |
| 3300028906|Ga0308309_10424684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1142 | Open in IMG/M |
| 3300031234|Ga0302325_10189768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3565 | Open in IMG/M |
| 3300031234|Ga0302325_13168344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300031234|Ga0302325_13363771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300031561|Ga0318528_10084915 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300031708|Ga0310686_117555829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 525 | Open in IMG/M |
| 3300031708|Ga0310686_118618442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300031753|Ga0307477_10312478 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300031754|Ga0307475_10760601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 770 | Open in IMG/M |
| 3300031763|Ga0318537_10373956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300031782|Ga0318552_10430628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300031798|Ga0318523_10165857 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300031823|Ga0307478_10578266 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300031823|Ga0307478_10639179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300031833|Ga0310917_10628266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300031835|Ga0318517_10355519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300031880|Ga0318544_10364856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300031897|Ga0318520_10300388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300031962|Ga0307479_11794193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300032174|Ga0307470_10467875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
| 3300032174|Ga0307470_10984712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300032174|Ga0307470_11270362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300032897|Ga0335071_10424757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1282 | Open in IMG/M |
| 3300033289|Ga0310914_11007886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300033412|Ga0310810_10082074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3881 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.36% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.68% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.84% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.84% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026845 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_101582451 | 3300003505 | Forest Soil | AATLAYIDIFMVLCVVSGIMFFLAFLLKKNDPGGGRVLAE* |
| Ga0062387_1001781333 | 3300004091 | Bog Forest Soil | AASLAYIDTFMVLCVGAGIMFFLSFALKKNDPGGGGPRVVE* |
| Ga0062389_1017661442 | 3300004092 | Bog Forest Soil | ASLAYVDTFKVLAVGAVIMFLMAFVLKKNDPGGRGHVIVD* |
| Ga0062389_1031918042 | 3300004092 | Bog Forest Soil | QATTLAYIDIFMVLCVISGIMFFLAFLLKKNDPGGGRVLAE* |
| Ga0062388_1007609652 | 3300004635 | Bog Forest Soil | QAASLAYIDTFMVLCVAAGIMFFLAFLLKKNDPGAGHVAVE* |
| Ga0066388_1021498041 | 3300005332 | Tropical Forest Soil | ASLAYIDTFMVLSVAAGIMFLLSFLLKRNDPVSGGVHVAE* |
| Ga0070707_1016880571 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TLAYVDTFMVLCVGSAIMFGMAFFFKKNDPGGGAAAAPE* |
| Ga0070679_1016935971 | 3300005530 | Corn Rhizosphere | AGTLAYVDTFMVLSIAAGIMFFLSFMLKRNDPASGGMHVAE* |
| Ga0070762_103867651 | 3300005602 | Soil | SAEAYIDTFMVLAVGSAIMIFLSFLLKKNELGGGRIVAE* |
| Ga0070762_108325441 | 3300005602 | Soil | AAYIDTFMVLAVGSGIMFFLAFLLKKNDPGGGHVVAE* |
| Ga0070763_106457351 | 3300005610 | Soil | LDTYMVLAVGAGVMFILAFVLRRNDPHAGGEVAVG* |
| Ga0066903_1014962101 | 3300005764 | Tropical Forest Soil | AYIDTFMVLSVASAIMFCLSFALRKNDPGGGGVRMAE* |
| Ga0070717_111619032 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LAYVDTFMVLSVGAAIMFCLAFVLKKNDPGGGGVRVAE* |
| Ga0070717_119338952 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AQAASLAYVDTFMVLAVGAAIMFWLAFVLKKNDPGGGGVRVVE* |
| Ga0075028_1000675953 | 3300006050 | Watersheds | QAQAGASAYVDTFMVLAVGSGIMFFLAFILKRNEPGGGHVVAE* |
| Ga0070765_1002929013 | 3300006176 | Soil | IDTFMVLAVGAAIMFCLTFVLKKNNPGAGGRVVVE* |
| Ga0070765_1003263791 | 3300006176 | Soil | QAQATTLAYIDIFMVLCVISGIMFFLAFLLKKNDPGGGRVLAE* |
| Ga0070765_1006839272 | 3300006176 | Soil | AASLAYIDTFMVLCVGSAIMFGLAFLLKKNDPGGGGVRIAE* |
| Ga0105240_111410171 | 3300009093 | Corn Rhizosphere | AYIDTFMVLSIGSAIMIFLAFALKKNDPGGGGHVVAE* |
| Ga0126380_111576441 | 3300010043 | Tropical Forest Soil | QAQAASLAYVDVFMVLAVGAAIMFCLSFALKKNDPSGGGHVVVE* |
| Ga0074044_110816342 | 3300010343 | Bog Forest Soil | VDVFMVLAVVGGIMFFLAFTLGKNEPGGGHVIAE* |
| Ga0126370_124809162 | 3300010358 | Tropical Forest Soil | AYIDTYMVLCVGAVIMFFISFFLKKNDPGSGGVVVE* |
| Ga0126372_104201063 | 3300010360 | Tropical Forest Soil | GALAYIDTFMVLSIAAGIMFFLSFLLKGNDPGSGGGHVAE* |
| Ga0126378_105604961 | 3300010361 | Tropical Forest Soil | ASLAYIDTYMVLCVGAVIMFFISFFLKKNDPGSGGVVVE* |
| Ga0126381_1002457151 | 3300010376 | Tropical Forest Soil | IDTFMVLSVASAIMFCLSFALKKNDPGGGGVRVAE* |
| Ga0134121_103365041 | 3300010401 | Terrestrial Soil | VQAQASAAAYIDTFMVLSIGSAIMIFLAFALKKNDPGGGGHVVAE* |
| Ga0137391_111544912 | 3300011270 | Vadose Zone Soil | AYIDTFMVLSVGSALMIFLSFILKKNELGGGRIVAE* |
| Ga0137437_12104592 | 3300011442 | Soil | DTFMVLAVAAAIMFFLSFILRKNDPGGGGRVLAE* |
| Ga0137363_107409851 | 3300012202 | Vadose Zone Soil | MAAYARIYQLVQGQASAAAYIDTFMVLSVGSALMIFLSFILKKNELGGGRIVAE* |
| Ga0137361_110861081 | 3300012362 | Vadose Zone Soil | ASLAYIDVFMVLAVGAAIMFCLSFALKKNDPGGGGRVVVE* |
| Ga0137395_100280111 | 3300012917 | Vadose Zone Soil | DTFMVLAVGAAIMFFLAFILRKNDPGGGGHIAVD* |
| Ga0164303_114055041 | 3300012957 | Soil | LAYVDVFMVLAVGAAIMFCLSFALKKNDPGGGAVVEVG* |
| Ga0126369_106044941 | 3300012971 | Tropical Forest Soil | ASLAYIDTFMVLSVAAGIMFFLSFMLKRNDLASGGVHVAE* |
| Ga0164305_110214291 | 3300012989 | Soil | YIDTFMVLCIAAGIMFFLSFLLKRNDPGGGGVHIAE* |
| Ga0181530_102825883 | 3300014159 | Bog | QSQTLAYVDTFMVLAVMAGIMFVLSFIVRKNNPAGGGPVVAE* |
| Ga0181526_109379512 | 3300014200 | Bog | AYIDTFMVLSVGAAIMFCLAFVLKKNDPGGGGVRVAE* |
| Ga0163163_112025951 | 3300014325 | Switchgrass Rhizosphere | QAQASAAAYIDTFMVLSIGSAIMIFLAFALKKNDPGGGGHVVAE* |
| Ga0163163_121783692 | 3300014325 | Switchgrass Rhizosphere | LAYIDTFMVLCIAAGIMFFLSFLLKRNDPGGGGVHIAE* |
| Ga0137403_107766682 | 3300015264 | Vadose Zone Soil | ASLAYIDVFMVLAVGAAIMFCLSFALKKNDPGGGGQVIVE* |
| Ga0132258_122619864 | 3300015371 | Arabidopsis Rhizosphere | IDTFMILSVAAGIMFFLSFMLKKNDPGGGVHVAE* |
| Ga0182036_104287012 | 3300016270 | Soil | AQAASLAYIDTFMVLCVGAAIMFLLTFFLKKNDPGGAAVRME |
| Ga0182032_112149822 | 3300016357 | Soil | YVDTFMVLAVGSAIMFFLSFILKKNSPGAGGDLAVG |
| Ga0182038_103332844 | 3300016445 | Soil | ADLAYVDTFMVLAVGSAIMFFLSFILKKNSPGSGGDLAAG |
| Ga0187802_104566131 | 3300017822 | Freshwater Sediment | IDTFMVLCVASAIMFFLAFVLKKNDPGGGGVRVME |
| Ga0187825_104067621 | 3300017930 | Freshwater Sediment | ASAQAYVDTFMVLAVGSGIMFFLSFILKGNDPSGGGHVVAE |
| Ga0187801_100873441 | 3300017933 | Freshwater Sediment | IDTFMVLAVASSIMFFLAFILKGNRPGAGGDLAVG |
| Ga0187808_106156661 | 3300017942 | Freshwater Sediment | AASLAYIDTFMVLCVASAIMFFLAFVLKKNDPGGGGVRVME |
| Ga0187781_110035462 | 3300017972 | Tropical Peatland | YIDTFMVLSVGAAVMFFLSFLLKKNEPGGGMRAAE |
| Ga0187777_103019491 | 3300017974 | Tropical Peatland | QAASLAYLDTFMVLSVGAAIMFCLAFALKKNDPGGGGLAVAE |
| Ga0187816_101319613 | 3300017995 | Freshwater Sediment | SGAAAYVDTFMVLAVGSGIMFFLAFILRKNDPGGGHVVAE |
| Ga0187804_102645822 | 3300018006 | Freshwater Sediment | YIDAFWVLSVGAAIMFCLSFLMKKNDPHVGGPAAVG |
| Ga0187804_105898691 | 3300018006 | Freshwater Sediment | AGAAAYIDTFMVLAVGSAIMFFLAFILKKNDPGGGHVVAE |
| Ga0187887_104803671 | 3300018043 | Peatland | IDTFMVLCVGSAIMFFLAFVLKKNEPGGGGVRVAE |
| Ga0187890_104093382 | 3300018044 | Peatland | AYVDTFMVLAVAGGIMFFLAFALGRNEPGGGQVIAE |
| Ga0190272_112111531 | 3300018429 | Soil | YVDVFSLLAVLAALMFALSFALKKNQVGGAHGVVE |
| Ga0193733_10979611 | 3300020022 | Soil | AYVDTFMVLAVGAAIMFCLAFVLKKNDPGGGGRVAVD |
| Ga0179592_104492332 | 3300020199 | Vadose Zone Soil | IDTFMVLCVGAAIMFCLAFVLKKNDPGAGGVRVAE |
| Ga0210407_103989113 | 3300020579 | Soil | LAYVDTFMVLCVGAGIMFFLSFLLKKNEPGGGGELAAG |
| Ga0210407_112032792 | 3300020579 | Soil | ASMAYVDTFMVLCVGAAIMFVLAFFLKKNEPGGGMTVAE |
| Ga0210403_110645822 | 3300020580 | Soil | VDTFMVLCVGAAIMFFLSFALKKNEPGGGADLAAG |
| Ga0210399_105136131 | 3300020581 | Soil | QAQASAAAYIDTFMVLAVGSAMMIFLAFVLKKNDPGGGGHVVAE |
| Ga0215015_101495262 | 3300021046 | Soil | YIDTFMVLAVGAAMMFCLTFVLKKNDPGGGGRVAVE |
| Ga0210406_110678872 | 3300021168 | Soil | IDTFMVLAVGAGIMFFLAFVLKKNEPGGGGAVEVG |
| Ga0210400_105786001 | 3300021170 | Soil | IDMFWVLCVGAAIMFLLSFALRKNQVGAGRQVALE |
| Ga0210405_102591061 | 3300021171 | Soil | AQASAAAYIDTFMVLAVGSACMIFLAFILKKNDPGGGHVVAE |
| Ga0210405_103052521 | 3300021171 | Soil | DTFMVLAVGAGIMFFLAFMLKRNDPGGGGAELAAG |
| Ga0210385_108547772 | 3300021402 | Soil | IDTFMVLAAAAGIMFFLSFMLKRNNPASGGVHVAE |
| Ga0210397_103340413 | 3300021403 | Soil | VDTFMVLAVGAGIMFFLAFLLKKNDPGGGGRIIVD |
| Ga0210386_104693633 | 3300021406 | Soil | IDTFMVLAVGAAIMFCLAFFLKKNDPGAGGLTVAE |
| Ga0193709_10922622 | 3300021411 | Soil | YIDTFMVLAVGAGIMFFLAFVLKTNEPGGGGAVEVG |
| Ga0210394_100607876 | 3300021420 | Soil | TLAYIDIFMVLCVISGIMFFLAFLLKKNDPGGGRVLAE |
| Ga0210394_111330752 | 3300021420 | Soil | SLAYVDTFMVLAVGAGIMFFLAFLLKKNDPGGGGRIIVE |
| Ga0210384_111430802 | 3300021432 | Soil | QATTLAYIDIFMVLCVVSGIMFFLAFALKKNDPGGGRVLAE |
| Ga0210391_101010411 | 3300021433 | Soil | AYIDTFMVLAVGSAIMIFLSFLLKKNELGGGRIVAE |
| Ga0210391_109286381 | 3300021433 | Soil | QATTLAYIDIFMVLCVISGIMFFLAFLLKKNDPGGGRVLAE |
| Ga0210402_110760221 | 3300021478 | Soil | MAYIDMYWVLTVGTAMMFFLFFLLKKNDPRAGGHVAVH |
| Ga0210410_107491781 | 3300021479 | Soil | AYIDTFMVLAVGAAIMFCLAFFLKANDPGAGGLTVAE |
| Ga0210409_113622791 | 3300021559 | Soil | YIDTFMVLAVGSGIMFFLSFILKRNDPGGGGHVAVE |
| Ga0126371_100677061 | 3300021560 | Tropical Forest Soil | YIDTFMVLSIASLIMFCLSFVLKKNDPGGGGVRVAE |
| Ga0224544_10338541 | 3300023250 | Soil | SLAYIDTFMVLCVVAGIMFCLAFVLKKNDPGGGGVRVVE |
| Ga0208586_10916592 | 3300025588 | Arctic Peat Soil | TEAYIDTFMVLAIGSAIMFVLSFALKKNDPRGGHVVAE |
| Ga0207695_116700412 | 3300025913 | Corn Rhizosphere | YIDTFMVLSIGSAIMIFLAFALKKNDPGGGGHVVAE |
| Ga0207671_107948262 | 3300025914 | Corn Rhizosphere | QAQASAAAYIDTFMVLSIGSAIMIFLAFALKKNDPGGGGHVVAE |
| Ga0207690_102862023 | 3300025932 | Corn Rhizosphere | LAYVDTFMVLSIAAGIMFFLSFMLKRNDPASGGMHVAE |
| Ga0179587_110010892 | 3300026557 | Vadose Zone Soil | GGYARIYQLVQGQASAAAYIDTFMVLSVGSALMIFLSFILKKNELGGGRIVAE |
| Ga0207760_1165441 | 3300026845 | Tropical Forest Soil | AYVDTFMVLAVGSAIMFFLSFALKKNAPGGGGEMAAG |
| Ga0208985_11083691 | 3300027528 | Forest Soil | KATTLAYIDIFMVLCVVSGIMFFLAFALKKNDPGGGRVLAE |
| Ga0209221_10602981 | 3300027609 | Forest Soil | YIDTFMVLCVGSAIMFGLAFALKKNDPGGGGVRVME |
| Ga0209447_101677192 | 3300027701 | Bog Forest Soil | TLAYIDIFMVLCVVSGIMFFLAFLLKRNDPGGGRVLAE |
| Ga0209328_100645351 | 3300027727 | Forest Soil | QATTLAYIDIFMVLCVVSGIMFFLAFALNKNDPGGGRVLAE |
| Ga0209040_104047231 | 3300027824 | Bog Forest Soil | YQSILAQASGAAYIDTFMVLCVGSVVMFFLSFALRKNDPSGGHMVAE |
| Ga0209590_105075502 | 3300027882 | Vadose Zone Soil | ATSLAYIDIFMVLCVASAIMFVLSFLLEKNDPGGGRFSPE |
| Ga0209380_106390722 | 3300027889 | Soil | AQSSAQAYIDTFMVLAVGSGIMFFLSFILKRNDPGGGGHVAVE |
| Ga0302233_100403434 | 3300028746 | Palsa | IYTFMVLCVGAAIMFGLAFVLKKNDPGGGGPRVME |
| Ga0308309_104246842 | 3300028906 | Soil | LAYIDIFMVLCVVSGIMFFLAFALKKNDPGGGRVLAE |
| Ga0302325_101897681 | 3300031234 | Palsa | QAASLAYVDTFMVLCVGSAIMFCLAFLLKKNDPGGGGAHVAE |
| Ga0302325_131683442 | 3300031234 | Palsa | YIDTFMVLAVGSAIMVFLAFILRKNDPGGGGEMAVG |
| Ga0302325_133637711 | 3300031234 | Palsa | SLAYIDTFQVLCVGSAIMFCLAFVLKKNEPGGGGAHVAE |
| Ga0318528_100849153 | 3300031561 | Soil | AYVDTFMVLAVGSAIMFFLAFALKKNSPGAGGEMAAG |
| Ga0310686_1175558291 | 3300031708 | Soil | YIDTFMVLAVGAAIMFCLTFALKKNDPGGGGNVEAG |
| Ga0310686_1186184421 | 3300031708 | Soil | YIDTFMVLSVGAAIMFCLAFVLKKNDPGGGGVRVAE |
| Ga0307477_103124783 | 3300031753 | Hardwood Forest Soil | YIDTFMVLAVGAGIMFFLAFMLKRNEPGGGGATIAE |
| Ga0307475_107606012 | 3300031754 | Hardwood Forest Soil | YIDTFKVLAVGAGIMFFLAFLLKKNDPGAGGVRVAE |
| Ga0318537_103739561 | 3300031763 | Soil | VDTFMVLAVGSAIMFLLSFILKKNSPGAGGDLAVG |
| Ga0318552_104306282 | 3300031782 | Soil | VDTFMVLAVGSAIMFFLAFALKKNSPGAGGEMAAG |
| Ga0318523_101658571 | 3300031798 | Soil | YVDTFMVLAVGSAIMFFLAFALKKNSPGAGGEMAAG |
| Ga0307478_105782661 | 3300031823 | Hardwood Forest Soil | VDTFMVLCVGAAIMFFLSFALKKNDPGAGGVRVAE |
| Ga0307478_106391792 | 3300031823 | Hardwood Forest Soil | ASAAAYIDTFMVLSVGSAIMILLAFVLKKNDLGGGGRVAVE |
| Ga0310917_106282661 | 3300031833 | Soil | STRTFGIDTFMVLAVGAAIMFCLAFFLKRNDPGAGGLTVAE |
| Ga0318517_103555191 | 3300031835 | Soil | VDTFMVLAVGSAIMFFLAFALKKNTPGGGGELAAG |
| Ga0318544_103648561 | 3300031880 | Soil | YVDTFMVLAVGSAIMFFLSFILKKNSPGSGGDLAVG |
| Ga0318520_103003883 | 3300031897 | Soil | AYVDTFMVLAVGSAIMFFLAFALKKNTPGGGGELAAG |
| Ga0307479_117941931 | 3300031962 | Hardwood Forest Soil | VDTFMVLAVGAAIMFCLAFALKKNDPGGGGVRVVE |
| Ga0307470_104678751 | 3300032174 | Hardwood Forest Soil | YIDTFMVLAVGAAIMFCLAFFLKANDPGAGGLTVAE |
| Ga0307470_109847121 | 3300032174 | Hardwood Forest Soil | LAYVDVFMVLAVGAAIMFCLSFALKKNDPGGSGHVVVE |
| Ga0307470_112703621 | 3300032174 | Hardwood Forest Soil | YIDTFMVLSVAAGVMFFLSFMLKRNDPASGGVHVAE |
| Ga0335071_104247571 | 3300032897 | Soil | SLLAQAATMAYLDTFMVLSVGAAIMFALAFILKKNQPGGGGDLAVG |
| Ga0310914_110078861 | 3300033289 | Soil | ATTLAYIDIFMVLCVVSGIMFFLAFALKKNDPGGGRVLAE |
| Ga0310810_100820745 | 3300033412 | Soil | TLAYIDTFMVLSIAAGIMFFLSFFLKKNDPGGGGVHIAE |
| ⦗Top⦘ |