NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F075124

Metagenome Family F075124

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075124
Family Type Metagenome
Number of Sequences 119
Average Sequence Length 76 residues
Representative Sequence MMLVTDASGKKRPAVILALAGGMMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPGVCQ
Number of Associated Samples 86
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 35.29 %
% of genes near scaffold ends (potentially truncated) 15.97 %
% of genes from short scaffolds (< 2000 bps) 78.99 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(22.689 % of family members)
Environment Ontology (ENVO) Unclassified
(57.983 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(45.378 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 33.98%    Coil/Unstructured: 66.02%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF01300Sua5_yciO_yrdC 3.36
PF00903Glyoxalase 3.36
PF07998Peptidase_M54 1.68
PF00701DHDPS 1.68
PF02543Carbam_trans_N 1.68
PF13193AMP-binding_C 1.68
PF03793PASTA 0.84
PF00326Peptidase_S9 0.84
PF04014MazE_antitoxin 0.84
PF07690MFS_1 0.84
PF10442FIST_C 0.84
PF05544Pro_racemase 0.84
PF12681Glyoxalase_2 0.84
PF01726LexA_DNA_bind 0.84
PF13744HTH_37 0.84
PF00535Glycos_transf_2 0.84
PF00034Cytochrom_C 0.84
PF14833NAD_binding_11 0.84
PF01597GCV_H 0.84
PF07503zf-HYPF 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 3.36
COG1913Predicted Zn-dependent proteaseGeneral function prediction only [R] 1.68
COG2192Predicted carbamoyl transferase, NodU familyGeneral function prediction only [R] 1.68
COG0068Hydrogenase maturation factor HypF (carbamoyltransferase)Posttranslational modification, protein turnover, chaperones [O] 0.84
COG0509Glycine cleavage system protein H (lipoate-binding)Amino acid transport and metabolism [E] 0.84
COG3938Proline racemase/hydroxyproline epimeraseAmino acid transport and metabolism [E] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003218|JGI26339J46600_10139244All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005538|Ga0070731_10803244All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium624Open in IMG/M
3300006059|Ga0075017_101548790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter523Open in IMG/M
3300006162|Ga0075030_100523059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter943Open in IMG/M
3300006176|Ga0070765_100458269All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300009525|Ga0116220_10241467All Organisms → cellular organisms → Bacteria → Acidobacteria787Open in IMG/M
3300009547|Ga0116136_1123952All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300009618|Ga0116127_1064575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1019Open in IMG/M
3300009628|Ga0116125_1036961All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1226Open in IMG/M
3300009644|Ga0116121_1262156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter554Open in IMG/M
3300009645|Ga0116106_1303137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter508Open in IMG/M
3300009764|Ga0116134_1114228All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter969Open in IMG/M
3300010341|Ga0074045_10331792All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter994Open in IMG/M
3300010379|Ga0136449_100009289All Organisms → cellular organisms → Bacteria27522Open in IMG/M
3300010379|Ga0136449_100882521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1461Open in IMG/M
3300010379|Ga0136449_101081940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1279Open in IMG/M
3300010379|Ga0136449_102022458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter850Open in IMG/M
3300010379|Ga0136449_102707158All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300013296|Ga0157374_12585276All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter535Open in IMG/M
3300014151|Ga0181539_1023602All Organisms → cellular organisms → Bacteria3364Open in IMG/M
3300014153|Ga0181527_1078411All Organisms → cellular organisms → Bacteria → Acidobacteria1629Open in IMG/M
3300014156|Ga0181518_10082035All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1836Open in IMG/M
3300014156|Ga0181518_10202977All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1030Open in IMG/M
3300014160|Ga0181517_10605087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter548Open in IMG/M
3300014161|Ga0181529_10009119All Organisms → cellular organisms → Bacteria9521Open in IMG/M
3300014161|Ga0181529_10214558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1119Open in IMG/M
3300014161|Ga0181529_10351558All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300014162|Ga0181538_10229265All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1031Open in IMG/M
3300014164|Ga0181532_10043459All Organisms → cellular organisms → Bacteria → Acidobacteria3010Open in IMG/M
3300014164|Ga0181532_10168523All Organisms → cellular organisms → Bacteria1304Open in IMG/M
3300014164|Ga0181532_10173501All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1280Open in IMG/M
3300014165|Ga0181523_10585582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter613Open in IMG/M
3300014167|Ga0181528_10011256All Organisms → cellular organisms → Bacteria5327Open in IMG/M
3300014167|Ga0181528_10368483All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300014169|Ga0181531_10085778All Organisms → cellular organisms → Bacteria1869Open in IMG/M
3300014169|Ga0181531_10658921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter650Open in IMG/M
3300014199|Ga0181535_10112088All Organisms → cellular organisms → Bacteria → Acidobacteria1746Open in IMG/M
3300014199|Ga0181535_10221825All Organisms → cellular organisms → Bacteria → Acidobacteria1151Open in IMG/M
3300014200|Ga0181526_10375940All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300014200|Ga0181526_10686077All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300014489|Ga0182018_10004112All Organisms → cellular organisms → Bacteria12494Open in IMG/M
3300014491|Ga0182014_10022304All Organisms → cellular organisms → Bacteria5278Open in IMG/M
3300014492|Ga0182013_10041779All Organisms → cellular organisms → Bacteria3625Open in IMG/M
3300014493|Ga0182016_10473944All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter728Open in IMG/M
3300014499|Ga0182012_10170454All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300014501|Ga0182024_10367658All Organisms → cellular organisms → Bacteria → Acidobacteria1873Open in IMG/M
3300014501|Ga0182024_12652254All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter537Open in IMG/M
3300014654|Ga0181525_10252148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter963Open in IMG/M
3300014657|Ga0181522_10876104All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300014658|Ga0181519_10251336All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1104Open in IMG/M
3300014838|Ga0182030_10001186All Organisms → cellular organisms → Bacteria → Acidobacteria53043Open in IMG/M
3300017925|Ga0187856_1132788All Organisms → cellular organisms → Bacteria → Acidobacteria954Open in IMG/M
3300017929|Ga0187849_1350338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter545Open in IMG/M
3300017935|Ga0187848_10007730All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6637Open in IMG/M
3300017946|Ga0187879_10351213All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter818Open in IMG/M
3300017946|Ga0187879_10390706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter771Open in IMG/M
3300017946|Ga0187879_10484988All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter685Open in IMG/M
3300017948|Ga0187847_10795843All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter535Open in IMG/M
3300017948|Ga0187847_10892533All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter506Open in IMG/M
3300017988|Ga0181520_10086492All Organisms → cellular organisms → Bacteria → Acidobacteria2744Open in IMG/M
3300017988|Ga0181520_10101061All Organisms → cellular organisms → Bacteria2472Open in IMG/M
3300017988|Ga0181520_10939299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter575Open in IMG/M
3300018008|Ga0187888_1316040All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter598Open in IMG/M
3300018016|Ga0187880_1155811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1068Open in IMG/M
3300018022|Ga0187864_10491627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter516Open in IMG/M
3300018024|Ga0187881_10170724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter938Open in IMG/M
3300018033|Ga0187867_10714688All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter546Open in IMG/M
3300018034|Ga0187863_10648257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter595Open in IMG/M
3300018035|Ga0187875_10145034All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1329Open in IMG/M
3300018038|Ga0187855_10220627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1116Open in IMG/M
3300018043|Ga0187887_10746121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter578Open in IMG/M
3300018044|Ga0187890_10520653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter669Open in IMG/M
3300018088|Ga0187771_11275670All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter623Open in IMG/M
3300021181|Ga0210388_10384682All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1234Open in IMG/M
3300021181|Ga0210388_11465825All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter571Open in IMG/M
3300021433|Ga0210391_11233491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter578Open in IMG/M
3300027825|Ga0209039_10000163All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus61789Open in IMG/M
3300027854|Ga0209517_10224112All Organisms → cellular organisms → Bacteria → Acidobacteria1143Open in IMG/M
3300027854|Ga0209517_10658616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter545Open in IMG/M
3300027869|Ga0209579_10702379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus547Open in IMG/M
3300027905|Ga0209415_10444179All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1024Open in IMG/M
3300027911|Ga0209698_10908711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter660Open in IMG/M
3300028800|Ga0265338_11103374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter534Open in IMG/M
3300028800|Ga0265338_11152642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter521Open in IMG/M
3300028866|Ga0302278_10271664All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300029817|Ga0247275_1056953All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1094Open in IMG/M
3300029911|Ga0311361_10306344All Organisms → cellular organisms → Bacteria → Acidobacteria1778Open in IMG/M
3300029914|Ga0311359_10682302All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300029954|Ga0311331_11724008All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter502Open in IMG/M
3300031232|Ga0302323_102332494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter610Open in IMG/M
3300031234|Ga0302325_10192378All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter3532Open in IMG/M
3300031234|Ga0302325_10228427All Organisms → cellular organisms → Bacteria → Acidobacteria3144Open in IMG/M
3300031234|Ga0302325_11223047All Organisms → cellular organisms → Bacteria997Open in IMG/M
3300031235|Ga0265330_10483640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter526Open in IMG/M
3300031236|Ga0302324_100104833All Organisms → cellular organisms → Bacteria → Acidobacteria4778Open in IMG/M
3300031236|Ga0302324_100702314All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales1427Open in IMG/M
3300031250|Ga0265331_10099164All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300031344|Ga0265316_10001336All Organisms → cellular organisms → Bacteria26525Open in IMG/M
3300032160|Ga0311301_10016368All Organisms → cellular organisms → Bacteria → Acidobacteria21877Open in IMG/M
3300032160|Ga0311301_10738822All Organisms → cellular organisms → Bacteria → Acidobacteria1371Open in IMG/M
3300032160|Ga0311301_11135756All Organisms → cellular organisms → Bacteria → Acidobacteria1011Open in IMG/M
3300032770|Ga0335085_11305939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter765Open in IMG/M
3300032783|Ga0335079_10004085All Organisms → cellular organisms → Bacteria → Acidobacteria16789Open in IMG/M
3300032783|Ga0335079_10917046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter899Open in IMG/M
3300032805|Ga0335078_10001825All Organisms → cellular organisms → Bacteria32218Open in IMG/M
3300032805|Ga0335078_10903773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1060Open in IMG/M
3300032805|Ga0335078_11786149All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter669Open in IMG/M
3300032892|Ga0335081_10001355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales39030Open in IMG/M
3300032897|Ga0335071_10535311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1124Open in IMG/M
3300032898|Ga0335072_10033242All Organisms → cellular organisms → Bacteria → Acidobacteria7141Open in IMG/M
3300032898|Ga0335072_10391096All Organisms → cellular organisms → Bacteria → Acidobacteria1498Open in IMG/M
3300032898|Ga0335072_10441618All Organisms → cellular organisms → Bacteria → Acidobacteria1376Open in IMG/M
3300033402|Ga0326728_10439924All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1090Open in IMG/M
3300033405|Ga0326727_10195828All Organisms → cellular organisms → Bacteria → Acidobacteria2226Open in IMG/M
3300033405|Ga0326727_10875169All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter677Open in IMG/M
3300033561|Ga0371490_1021702All Organisms → cellular organisms → Bacteria2157Open in IMG/M
3300033755|Ga0371489_0174727All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1142Open in IMG/M
3300033887|Ga0334790_025403All Organisms → cellular organisms → Bacteria2561Open in IMG/M
3300034282|Ga0370492_0470602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter510Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog22.69%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland15.13%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil10.08%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil9.24%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.04%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog4.20%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.20%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.20%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere4.20%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.36%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.52%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.68%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.84%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.84%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.84%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.84%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.84%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.84%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26339J46600_1013924423300003218Bog Forest SoilMMIVRVADGTKRAAVILALTGRIMRVALKETDDVTEYKLVNQTWITEDCEPVTFEFPLGVFEAIGIMPPGPGAPGHK*
Ga0070731_1080324423300005538Surface SoilMMLVRQSNGQARPAVILALAGDTIRVALKDNDDVAEYRLVKQSWIAENFDPVSFEFPLGIFEAIGIVPPPEDFAGRQ*
Ga0075017_10154879013300006059WatershedsMLIRYSDGKTLVAALLSLTGPVMRVALKNSDDVAEYRLTDGTWLSEDSHPVTFEFPLGVFEAIGMMPPGPRAWTVQ*
Ga0075030_10052305923300006162WatershedsMLIRYSDGKTLVAVLLSLTGPVMRVALKNSDDVAEYRLTDGTWLSEDSHPVTFEFPLGVFEAIGMMPPGPRAWTVQ*
Ga0070765_10045826923300006176SoilLSPDSFGSNLSLPNTMMLVRNSSGSRQPAVILALTGDVMRVALKDGDDVEEYRLVNRTWISTNCEPVTFEFPLGVFEAIGMMPPLTGVPQ*
Ga0116220_1024146723300009525Peatlands SoilMMLVTDASGNKRPAVILALVGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDSGMCQ*
Ga0116136_112395223300009547PeatlandMMIVRVANGKKRAAVILALTGRVMRVALKDTDDVMECKLVNQTWISEDCEPVTFEFPLGVFEAIGIMPPGPGSPRYK*
Ga0116127_106457533300009618PeatlandRMMIVRVANGKKRAAVILALTGRVMRVALKDTDDVMECKLVNQTWISEDCEPVTFEFPLGVFEAIGIMPPGPGSPRYK*
Ga0116125_103696123300009628PeatlandMMLVTDTSGNKRPAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPGVCQ*
Ga0116121_126215623300009644PeatlandMMLIRNASGSKQPAVILVLTGGMMRVALKDGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDSGLCQ*
Ga0116106_130313713300009645PeatlandLTAMMLVRNASGTTQAAVILALTGATMRVALKDSDDVEEYRLMNQTWVSTQCEPVTFEFPLGIFEAIGMMPPPTTGVRQ*
Ga0116134_111422823300009764PeatlandMMIVRVANGKKRAAVMLALTGRMMRVALKDTDDVMEYKLVDQTWISEDCEPVTFEFPLGVFEAIGIMPPGPGVGSPRYK*
Ga0074045_1033179223300010341Bog Forest SoilMMLVTDGNGKKQPAVILALSGDVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPGVCQ*
Ga0136449_100009289143300010379Peatlands SoilMMIVRVANGTKRAAVILALTGRIMRVALKETDDVTEYKLVNQTWITEDCEPVTFEFPLGVFEAIGIMPPGPGTPGYK*
Ga0136449_10088252123300010379Peatlands SoilMMIVRMANGKRRAAVMLALTGRTMRLALKDTDDVMEYKLVDQTWISEDCEPVTFEFPLGVFEAIGIMPPGPSSGYTKRG*
Ga0136449_10108194033300010379Peatlands SoilMMLVTDASGKKRPAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPASGVCQ*
Ga0136449_10202245823300010379Peatlands SoilMMLVTDASGNKRPAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPEPGVCQ*
Ga0136449_10270715823300010379Peatlands SoilMMLVRNSRGETQPAVILALNGPNMRVALKDSDDVEEYRLLDRTWISGHCEPVTFEFPLGIFEAIGIMPPDPAFRTRQ*
Ga0157374_1258527623300013296Miscanthus RhizosphereMMLVRNTNGSKQAAVILALIGSTLRVALKDSDDVEEYRLVNGTWVSAHCEPVTFEFPLGIFEAIGMMPPGPGFPRMQ*
Ga0181539_102360233300014151BogMMIVRVANGKKRAAVILALTGRTMRVALKDTDDVMEYKLVDQTWISEDCEPLTFEFPLGVFEAIGIMPPGPGAGSLTYK*
Ga0181527_107841123300014153BogMMIVRMANGKKRAAVILALTGRTMRVALKDTDDVMEYKLVDQTWISEDCEPVTFEFPLGVFEAIGIMPPGPGAGSPKYR*
Ga0181518_1008203533300014156BogMMLVRNASGRKQPGVILALTGGTMRVALKDSDDVEEYRLLNETWVSTQCEPVTFEFPLGVFEAIGIMPPEPGVRQ*
Ga0181518_1020297713300014156BogMLLVRNNSGKTQPAVILALTGTIMRVALQDSDDVEEYRLVQQTWVNATCEPVTFEFPLGIFEAIGMMPPGPVSTRRQ*
Ga0181517_1060508723300014160BogMMLVRNASGTTQPGVILALTGAMMRVALKDSDDVEEYRLMNQTWISTQCEPVTFEFPLGVFEAIGMMPPPTTGLRQ*
Ga0181529_1000911973300014161BogMMLVRNFRGETQPAVILALTGPTMRVALKDSDDVEEYRLLDQTWISGHCEPVTFEFPLGIFEAIGIMPSDPAFRVRQ*
Ga0181529_1021455823300014161BogMMLVRNSNGKTQPAVILALTGTAMRVALKDSDDVEEYRLVNQTWISGHCEPVTFEFPLGIFEAIGIMPPNPVFPTRL*
Ga0181529_1035155823300014161BogMMLVRNNSGKAQPAVILAISGPMMRVALKDSDDVEEYRLLNQTWISTNCEPVTFEFPLGIFEAIGMMPPGPVNPTRQ*
Ga0181538_1022926523300014162BogMMIVRTANGKKRAAVILVLTGRMMRVALKDTDDVMECKLVDQTWISEDCEPVTFEFPLGVFEAIGIMPPVTGSGHFEERMP*
Ga0181532_1004345933300014164BogMMFVTDASGNKRPAVILALAGGMMRVALRNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDSGVRQ*
Ga0181532_1016852323300014164BogMMLVRLANGQKHEAVILALSGGVMRVALKDTDDVAEYRLVKETWISEDFERVTFEFPLGVFEAIGIMPPALVM*
Ga0181532_1017350133300014164BogMMLVRNASGTTQAAVILALTGATMRVALKDSDDVEEYRLMNQTWVSTQCEPVTFEFPLGIFEAIGMMPPPTTGVRQ*
Ga0181523_1058558213300014165BogNNSGKTQPAVILALTGTIMRAALQDSADVAEYRLVQQTWVNATCEPVTFEFPLGIFEAIGMMPPGPVSTRRQ*
Ga0181528_1001125663300014167BogMMLVTDASGNKRAAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPGVCQ*
Ga0181528_1036848323300014167BogMMLVRNSRGAKHPAVILVLTGGMMRVALKDSDDVEEYRLMNDTWVSGECEPVTFEFPLGIFEAIGMMPPATGVRQ*
Ga0181531_1008577813300014169BogMMLVRNSSGNKQPGVILALSGTMMRVALKDSDDVEEYRLVNETWVSGKCEPVTFEFPLGIFEAIGMMPPATGARQ*
Ga0181531_1065892123300014169BogMLVTDTSGNKRPAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPEPGVCQ*
Ga0181535_1011208823300014199BogMLVTDASGNKRPAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPGVCQ*
Ga0181535_1022182523300014199BogMLVRNASGELHPAVILALTGATIRVALKDSDDVEEYRLVNHTWVSGRCEPVTFEFPLGIFEAIGMMPPAPGVN*
Ga0181526_1037594023300014200BogMMLVTDASGNKRPAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDTGVFQ*
Ga0181526_1068607713300014200BogMMLVRNFRGETQPAVILALTGPTLRVALKDSDDVEEYRLLDQTWISGRCEPVTFEFPLGIFEAIGIM
Ga0182018_10004112103300014489PalsaMMLVTDASGHKQPAVILALAGGMMRVALKNGDDVEEYRLVNQTWVSTHCEPVTFEFPLGVFEAIGMMPPDPGVCQ*
Ga0182014_1002230423300014491BogMILVRNASGAKQPAVILALIGPTMRVALKDSDDVEEYRLVNQTWVSGQCEPVTFEFPLGIFEAIGMMPPVPGVQ*
Ga0182013_1004177933300014492BogMMLVRNSSGSRQPAVILALTADVMRVALKNGDDVEEYRLVKDTWVSTHCEPVTFEFPLGIFEAIGIMPPAPGVRQ*
Ga0182016_1047394413300014493BogMMLVRNNSGKTQPAVILAISGPMMRVALKDSDDVEEYRLLNETWISTNCEPVTFEFPLGIFEAIGMMPPGPVNPTRQ*
Ga0182012_1017045423300014499BogMMLVRNSSGSRQPAVILALTAGVMRVALKNGDDVEEYRLVKDTWVSTHCEPVTFEFPLGIFEAIGIMPPAPGVRQ*
Ga0182024_1036765823300014501PermafrostMMIVRVANGKKHAAVILALTGHMMRVALKDTDDVMEYKLVNQTWISEDCEPVTLEFPLGVFEAIGIMPPGPGPHNHK*
Ga0182024_1265225423300014501PermafrostMMLVRNSSGSRQPAVILALTGDVMRVALKDGDDVEEYRLVNQTWVSTHCDPVTFEFPLGVFEAIGMMPPLTGSTQ*
Ga0181525_1025214823300014654BogMMLVTDASGKKRPAVILALAGGMMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPGVCQ*
Ga0181522_1087610423300014657BogMMLVRNASGELHPAVILALTGATIRVALKDSDDVEEYRLVNHTWVSGRCEPVTFEFPLGIFEAIGMMPP
Ga0181519_1025133613300014658BogMMLVRNSSGSRQPAVILALTAGVMRVALRNGDDVEEYRLVKDTWVSTHCEPVTFEFPLGIFEAIGMMPPASGMRQ*
Ga0182030_10001186243300014838BogMRSAVLLALTGQVMRVALKDTDDVMEYRLVNQTWISEDCEPVTFEFPLSVFEAIGIMPAGSGVPNTK*
Ga0187856_113278823300017925PeatlandMMIVRMTNGKKRAAVILALTGRTMRVALKDTDDVMEYKLVDQTWISEDCEPVTFEFPLGVFEAIGIMPPGPGAGSPKYR
Ga0187849_135033813300017929PeatlandMMIVRVANGKKRAAVILALTGRVMRVALKDTDDVMECKLVNQTWISEDCEPVTFEFPLGVFEAIGIMPPGPGSPRYK
Ga0187848_1000773043300017935PeatlandMMIVRVANGKKRAAVILALTGRTMRVALKDTDDVMEYKLVDQTWISEDCEPLTFEFPLGVFEAIGIMPPGPGAGSLTYK
Ga0187879_1035121313300017946PeatlandMMIVRTANGKKRAAVILVLTGRMMRVALKDTDDVMECKLVDQTWISEDCEPVTFEFPLGVFEAIGIMPPVTGSGHFEERMP
Ga0187879_1039070613300017946PeatlandMMLVRNASGTTQAAVILALTGATMRVALKDSDDVEEYRLMNQTWVSTQCEPVTFEFPLGIFEAIGMMPPPTTGVRQ
Ga0187879_1048498823300017946PeatlandMMLVTDASGNKRPAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPEPGVCQ
Ga0187847_1079584313300017948PeatlandMMLVTDASGNKRAAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPGVCQ
Ga0187847_1089253323300017948PeatlandMMLVRNASGELHPAVILALTGATIRVALKDSDDVEEYRLVNHTWVSGRCEPVTFEFPLGIFEAIGMMPPA
Ga0181520_1008649233300017988BogMMLVRNASGTTQPGVILALTGAMMRVALKDSDDVEEYRLMNQTWISTQCEPVTFEFPLGVFEAIGMMPPPTTGLRQ
Ga0181520_1010106133300017988BogMLLVRNNSGKTQPAVILALTGTIMRVALQDSDDVEEYRLVQQTWVNATCEPVTFEFPLGIFEAIGMMPPGPVSTRRQ
Ga0181520_1093929923300017988BogMMLVRNFRGETQPAVILALTGPSMRVALKDSDDVEEYRLLDQTWISGRCEPVTFEFPLGIFVAIGIMPPDPAFRVPQ
Ga0187888_131604013300018008PeatlandMMIVRMANGKKRAAVILALTGRTMRVALKDTDDVMEYKLVDQTWISEDCEPVTFEFPLGVFEAIGIMPPGPGAGSPKYR
Ga0187880_115581123300018016PeatlandMMIVRVANGKKRAAVMLALTGRMMRVALKDTDDVMEYKLVDQTWISEDCEPVTFEFPLGVFEAIGIMPPGPGVGSPRYK
Ga0187864_1049162713300018022PeatlandMMIVRVANGKKRAAVMLALTGRMMRVALKDTDDVMEYKLVDQTWISEDCEPVTFEFPLGVFEAIGIMPPGPGSPRYK
Ga0187881_1017072413300018024PeatlandLKDACFGLTLKPNCLEKRMMIVRVANGKKRAAVILALTGRVMRVALKDTDDVMECKLVNQTWISEDCEPVTFEFPLGVFEAIGIMPPVTGSGHFEERMP
Ga0187867_1071468823300018033PeatlandMMLVRNSRGETQPAVILALNGPNMRVALKDSDDVEEYRLLDRTWISGHCEPVTFEFPLGIFEAIGIMPPDPAFQRRQ
Ga0187863_1064825713300018034PeatlandMMLVTDASGNKRPAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPGVCQ
Ga0187875_1014503423300018035PeatlandMMIVRTANGKKRAAVILVLTGRMMRVALKDTDDVMECKLEDQTWISEDCEPVTFEFPLGVFEAIGIMPPVTGSGHFEERMP
Ga0187855_1022062713300018038PeatlandMMLVRLANGQKHEAVILALSGGVMRVALKDTDDVAEYRLVKETWISEDFERVTFEFPLGVFEAIGIMPPELVM
Ga0187887_1074612113300018043PeatlandIMMLIRNASGSKQPAVILVLTGGMMRVALKDGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDSGLCQ
Ga0187890_1052065323300018044PeatlandMMLIRNASGSKQPAVILVLTGGMMRVALKDGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDSGLCQ
Ga0187771_1127567013300018088Tropical PeatlandMAMMLVRSAGGSKKPGVILALTGGVMRVALKDGDDVEEYRLINQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPGVCQ
Ga0210388_1038468223300021181SoilMMLVRNVSGAKHPAVILALTGDLMRVALKDSDDVEEYRLVNQTWVSTHCEPVTFEFPLGIFEAIGMMPPAGVTQ
Ga0210388_1146582523300021181SoilPLQVFQLLSRWSFGFNLRLHKMMFVTTSSGSKHPAVILALTGGMIRVALKDSDDVEEYRLVNQTWVSSQCEPVTFEFPLGIFEAIGMMPPSSGVRQ
Ga0210391_1123349123300021433SoilMMLVRNVSGAKHPAVILALTGDLMRVALKDSDDVEEYRLVNQTWVSAQCEPVTFEFPLGIFEAIGMMPPGPEVHQ
Ga0209039_10000163333300027825Bog Forest SoilMMIVRVADGTKRAAVILALTGRIMRVALKETDDVTEYKLVNQTWITEDCEPVTFEFPLGVFEAIGIMPPGPGAPGHK
Ga0209517_1022411223300027854Peatlands SoilMMLVRNSRGEAQPAVILALTGPTMRVALKDSDDVEEYRLLDQTWISGHCEPVTFEFPLSIFEAIGMMPPDPGFRTQ
Ga0209517_1065861613300027854Peatlands SoilMMLVTDASGKKRPAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPASGVCQ
Ga0209579_1070237913300027869Surface SoilMMLVRQSNGQARPAVILALAGDTIRVALKDNDDVAEYRLVKQSWIAENFDPVSFEFPLGIFEAIGIVPPPEDFAGRQ
Ga0209415_1044417923300027905Peatlands SoilMMLVTDASGNKRPAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDSGMCQ
Ga0209698_1090871113300027911WatershedsYSDGKTLVAVLLSLTGPVMRVALKNSDDVAEYRLTDGTWLSEDSHPVTFEFPLGVFEAIGMMPPGPRAWTVQ
Ga0265338_1110337423300028800RhizosphereMLVRNSSGAKQPAVILALTGAMMRVALKDSDDVEEYRLVNETWVSGHCEPVTFEFPLGIFEAIGMMPPTPVFPPR
Ga0265338_1115264223300028800RhizosphereMVLVRSADGAKHPAVVLSLIGSTIRVAMKDREDVEEYHLVNETWVSTQCEPVTFEFPLGIFEAIGIMPPGSRVFVRQ
Ga0302278_1027166423300028866BogMMLVRNNSGKTQPAVILAISGPMMRVALKDSDDVEEYRLLNQTWISTNCEPVTFEFPLGIFEAIGMMPPGPVNPTRQ
Ga0247275_105695313300029817SoilMMIVRVANGKKRAAVMLALTGRMMRVALKDTDDVMEYKLVDQTWISEDCEPVTFEFPLGVFEAIGMMPPEPGVCQ
Ga0311361_1030634413300029911BogMMLVRNNSGKTQPAVILAISGPMMRVALKDSDDVEEYRLLNQTWISTNCEPVTFEFPLGIFEAIGMMPPGPVNP
Ga0311359_1068230213300029914BogMMLVRNNSGKTQPAVILAISGPMMRVALKDSDDVEEYRLLNETWISTNCEPVTFEFPLGIFEAIGMMPPGPVNPTRQ
Ga0311331_1172400813300029954BogMMLVRNSNGKTQPAVILALTGTAMRVALKDSDDVEEYRLVNQTWISGHCEPVTFEFPLGIFEAIGIMP
Ga0302323_10233249423300031232FenMMLVRNASGAKQPAVILALSGDVLRVALKDSDDVEEYRLLNGTWVSAHCEPVTFEFPWGIFEAIGMMPPGPSFPTMQ
Ga0302325_1019237853300031234PalsaMMLVKNANGATQPGIILALTGTIMRVALKNSDDVEEYRLVNHTWVSSHCEPVTFEFPLGVFEAIGMMPPAPAVPERQ
Ga0302325_1022842733300031234PalsaMMLVRNSSGSRQPAVILALTGDVMRVALKDGDDVEEYRLLNQTWVSTRCEPVTFEFPLGVFEAIGMMPPDGVTQ
Ga0302325_1122304733300031234PalsaMMLVRNSSGTKQPGVILVLTGSMMRVALKDSDDVEEYRLMNDTWVSGQCEPVTFEFPLGIFEAIGMMPPATGV
Ga0265330_1048364013300031235RhizosphereLSLVSFGLTLSLPTTMMLVRNSSGSRRPAVILALTGGVMRVALKGGEDVEEYRLLNETWVSTQCEPVTFEFPLGVFEAIGMMPPVGVRQ
Ga0302324_10010483333300031236PalsaMMLVTDASGNKQPAVILALAGGVMRVALRNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPGMCQ
Ga0302324_10070231433300031236PalsaLSQGSFGSNLSLLNTMMLVRNSSGSRQPAVILALTGDVMRVALKDGDDVEEYRLLNQTWVSTRCEPVTFEFPLGVFEAIGMMPPDGVTQ
Ga0265331_1009916423300031250RhizosphereMMLVRNSSGRRQAAVVLSLIGRVMRVALKDGDDVEEYRLVNETWVSTQCEPVTFEFPLGVFEAIGMMPPAGATQ
Ga0265316_10001336223300031344RhizosphereMMLVRNFRGETQPAVILALTGPTMRVALKDTDDVEEYRLLDQTWISGHCEPVTFEFPLGIFEAIGIMPPDPAFQVRQ
Ga0311301_1001636843300032160Peatlands SoilMMIVRVANGTKRAAVILALTGRIMRVALKETDDVTEYKLVNQTWITEDCEPVTFEFPLGVFEAIGIMPPGPGTPGYK
Ga0311301_1073882223300032160Peatlands SoilMMLVTDASGNKRPAVILALAGGVMRVALKNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPASGVCQ
Ga0311301_1113575623300032160Peatlands SoilMMLVRNSRGEAQPAVILALTGPTMRVALKDSDDVEEYRLLDQTWISGHCEPDTFEFPLSIFEAIGMMPPDPGFRTQ
Ga0335085_1130593923300032770SoilMMLVRNANGNKQQGVILALTGGTMRVALKDSDDVEEYRLLNETWVSTHCEPVTFEFPLGVFEAIGMMPPERGTRQ
Ga0335079_1000408523300032783SoilMMIIRRLNGETHAAVMLALTGDQLRVALKDRDDVAEFRLVNGAWISEDCEPVTFEFPLGVFEAIGMMPQAGFITRQ
Ga0335079_1091704623300032783SoilMLVRNASGAKHPAVILALIGATMRVALKDSDDVEEYRLVNQTWVSTDLEPVTFEFPLGVFEAIGMIPPVPALRQ
Ga0335078_1000182533300032805SoilMMLVRNASGGKQPGIILALTGGTMRVALKDSDDVEEYRLLNGTWVSTQCEPVTFEFPLGVFEAIGMMPPGPGVCQ
Ga0335078_1090377313300032805SoilMMLVRNASGKKHPGVILALTGNVMRVALRDSDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAVGIMPPDPGVWQ
Ga0335078_1178614923300032805SoilNPFRLKLRLLRNMIFVRTANGVKQPAVILALTGPTMRVALKDGKDVEEYRLVNQTWVSSQCEPVTFEFPLGIFEAIGIMPPVAGVQ
Ga0335081_10001355123300032892SoilMMIIRRLNGETRAAIVLALTGGQLRVALKDSDDVAEFHLVNGNWISDDCEPVTFEFPLGVFEAIGMMPPQPGFITRQ
Ga0335071_1053531123300032897SoilMMLVRASDGKKRAAVILALTGQVMRVALKDTDDVMEYQLINGTWISEDCEPVTFEFPLGVFEAVGIMPPGPGGPHKR
Ga0335072_1003324233300032898SoilMMLVRNASGKKQQGVILALTGGTMRVALKDSDDVEEYRLLNETWISTQCEPVTFEFPLGVFEAIGMMPPERGMRQ
Ga0335072_1039109623300032898SoilMMLVRNSSGTKQPAVILALTGDMMRVALKDADDVEEYRLVNQTWVSSHCEPVTFEFPLGVFEAIGMMPPATGVHQ
Ga0335072_1044161823300032898SoilMMLVRNGNGSKQPGVILALTGSRMRVALKDGDDVEEYRLVNETWVSTQCEPVTFEFPLGVFEAIGIMPPDPGVLR
Ga0326728_1043992423300033402Peat SoilMMLVTDASGNKRPAVILALAGGMMRVALRNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPGVCQ
Ga0326727_1019582833300033405Peat SoilMMIVRNSSGNRQPAVILALTGGMMRVALKDSDDVEEYRLVNETWVSTQCEPVTFEFPLGIFEAIGMIPPNGVRQ
Ga0326727_1087516923300033405Peat SoilMMLVTDASGNKRPAVILALAGGMMRVALRNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPEVCQ
Ga0371490_102170233300033561Peat SoilMMLVRNTSGVTQPAVILVLTGGMMRVALKDSDDVEEYRLVNQTWVSTQCEPVTFEFPLGIFEAIGMMPPRGVGQ
Ga0371489_0174727_360_5843300033755Peat SoilMLVTDASGNKRPAVILALAGGMMRVALRNGDDVEEYRLVNQTWVSTQCEPVTFEFPLGVFEAIGMMPPDPEVCQ
Ga0334790_025403_2108_23323300033887SoilMMLVRNASGATQPAVILVLSGDMMRVALKDSDDVEEYRLVNRTWVSTQCEPVTFEFPLGIFEAIGMMPPTGVWQ
Ga0370492_0470602_1_2043300034282Untreated Peat SoilMMLVRNSSGKTQPAVILALTGAVMRVALKDGDDVEEYRLVNQTWISGHCEPVTFEFPLGIFEAIGMMP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.