Metagenome / Metatranscriptome Family F075120

Overview

Basic Information

• Family ID: F075120
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 119
• Average Sequence Length: 38 residues
• Representative Sequence: SLPADLENDKVAELEKKLSQSKHRVAQKSTAADAKP
• Number of Associated Samples: 106
• Number of Associated Scaffolds: 119

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 5.04 %
• % of genes near scaffold ends (potentially truncated): 94.12 %
• % of genes from short scaffolds (< 2000 bps): 89.08 %
• Associated GOLD sequencing projects: 102
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (100.000 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.168 % of family members)
• Environment Ontology (ENVO): Unclassified (29.412 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (57.143 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 48.44%
  β-sheet: 0.00%
  Coil/Unstructured: 51.56%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 119 Family Scaffolds
PF00288	GHMP_kinases_N	68.07
PF08544	GHMP_kinases_C	13.45
PF13793	Pribosyltran_N	4.20
PF14572	Pribosyl_synth	2.52
PF01386	Ribosomal_L25p	1.68
PF01195	Pept_tRNA_hydro	0.84
PF13432	TPR_16	0.84
PF13181	TPR_8	0.84
PF14693	Ribosomal_TL5_C	0.84
PF03948	Ribosomal_L9_C	0.84
PF01084	Ribosomal_S18	0.84
PF00156	Pribosyltran	0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 119 Family Scaffolds
COG1825	Ribosomal protein L25 (general stress protein Ctc)	Translation, ribosomal structure and biogenesis [J]	1.68
COG0193	Peptidyl-tRNA hydrolase	Translation, ribosomal structure and biogenesis [J]	0.84
COG0238	Ribosomal protein S18	Translation, ribosomal structure and biogenesis [J]	0.84
COG0359	Ribosomal protein L9	Translation, ribosomal structure and biogenesis [J]	0.84

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	100.00 %
Unclassified	root	N/A	0.00 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	100.00 %
Unclassified	root	N/A	0.00 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	100.00 %
Unclassified	root	N/A	0.00 %

Level 4

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	97.48 %
Unclassified	root	N/A	0.00 %

Level 5

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	30.25 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	10.92 %
Unclassified	root	N/A	0.00 %

Level 6

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium 13_2_20CM_2_57_6	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	30.25 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	10.08 %
Unclassified	root	N/A	0.00 %

Level 7

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium 13_2_20CM_2_57_6	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	30.25 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	10.08 %
Unclassified	root	N/A	0.00 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001356|JGI12269J14319_10168854	All Organisms → cellular organisms → Bacteria → Acidobacteria	905
3300002245|JGIcombinedJ26739_100600848	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	977
3300002347|JGIcombinedJ26865_1067255	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	572
3300004635|Ga0062388_102307530	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	562
3300005538|Ga0070731_10142463	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1590
3300005542|Ga0070732_10257253	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1046
3300005568|Ga0066703_10845268	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	522
3300005602|Ga0070762_10350096	All Organisms → cellular organisms → Bacteria → Acidobacteria	942
3300005764|Ga0066903_106055949	All Organisms → cellular organisms → Bacteria	633
3300006086|Ga0075019_10549350	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	720
3300006176|Ga0070765_100637450	All Organisms → cellular organisms → Bacteria → Acidobacteria	1005
3300006755|Ga0079222_10209374	All Organisms → cellular organisms → Bacteria → Acidobacteria	1182
3300006800|Ga0066660_10704312	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	829
3300006806|Ga0079220_10058133	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1854
3300006806|Ga0079220_10699988	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	744
3300007788|Ga0099795_10475576	All Organisms → cellular organisms → Bacteria → Acidobacteria	579
3300009088|Ga0099830_10459417	All Organisms → cellular organisms → Bacteria → Acidobacteria	1035
3300009176|Ga0105242_10466639	All Organisms → cellular organisms → Bacteria → Acidobacteria	1193
3300009525|Ga0116220_10307387	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	699
3300010325|Ga0134064_10293241	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	617
3300010339|Ga0074046_10599661	All Organisms → cellular organisms → Bacteria → Acidobacteria	652
3300010376|Ga0126381_100746837	All Organisms → cellular organisms → Bacteria → Acidobacteria	1402
3300010379|Ga0136449_103211983	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	631
3300011270|Ga0137391_11488490	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	522
3300012096|Ga0137389_11023489	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	708
3300012189|Ga0137388_11157107	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	711
3300012208|Ga0137376_10854817	All Organisms → cellular organisms → Bacteria → Acidobacteria	782
3300012210|Ga0137378_10511189	All Organisms → cellular organisms → Bacteria → Acidobacteria	1108
3300012357|Ga0137384_11389574	All Organisms → cellular organisms → Bacteria → Acidobacteria	550
3300012362|Ga0137361_11753793	All Organisms → cellular organisms → Bacteria → Acidobacteria	540
3300012363|Ga0137390_11226066	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	697
3300012917|Ga0137395_11275408	All Organisms → cellular organisms → Bacteria → Acidobacteria	509
3300012918|Ga0137396_10716536	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	738
3300012923|Ga0137359_10676811	All Organisms → cellular organisms → Bacteria → Acidobacteria	900
3300012925|Ga0137419_10022522	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3712
3300012927|Ga0137416_10886343	All Organisms → cellular organisms → Bacteria → Acidobacteria	793
3300012927|Ga0137416_11541225	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	604
3300012960|Ga0164301_11305734	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	588
3300012971|Ga0126369_11738667	All Organisms → cellular organisms → Bacteria → Acidobacteria	713
3300012971|Ga0126369_12192351	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	640
3300012976|Ga0134076_10374253	All Organisms → cellular organisms → Bacteria → Acidobacteria	630
3300012977|Ga0134087_10087434	All Organisms → cellular organisms → Bacteria → Acidobacteria	1287
3300012986|Ga0164304_11494734	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	558
3300014638|Ga0181536_10261728	All Organisms → cellular organisms → Bacteria → Acidobacteria	822
3300015052|Ga0137411_1364082	All Organisms → cellular organisms → Bacteria → Acidobacteria	6031
3300015053|Ga0137405_1277265	All Organisms → cellular organisms → Bacteria → Acidobacteria	2229
3300015054|Ga0137420_1163380	All Organisms → cellular organisms → Bacteria → Acidobacteria	1339
3300015054|Ga0137420_1337079	All Organisms → cellular organisms → Bacteria	5591
3300016294|Ga0182041_11878780	All Organisms → cellular organisms → Bacteria → Acidobacteria	556
3300017657|Ga0134074_1252806	All Organisms → cellular organisms → Bacteria → Acidobacteria	634
3300017822|Ga0187802_10081496	All Organisms → cellular organisms → Bacteria → Acidobacteria	1207
3300017933|Ga0187801_10001344	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	7267
3300017933|Ga0187801_10243016	All Organisms → cellular organisms → Bacteria → Acidobacteria	722
3300017966|Ga0187776_10501893	All Organisms → cellular organisms → Bacteria → Acidobacteria	830
3300017972|Ga0187781_10442685	All Organisms → cellular organisms → Bacteria → Acidobacteria	930
3300017975|Ga0187782_10001151	All Organisms → cellular organisms → Bacteria → Acidobacteria	18970
3300018007|Ga0187805_10083887	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1436
3300018007|Ga0187805_10635664	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	505
3300018020|Ga0187861_10466555	All Organisms → cellular organisms → Bacteria → Acidobacteria	523
3300018047|Ga0187859_10158285	All Organisms → cellular organisms → Bacteria → Acidobacteria	1202
3300018060|Ga0187765_10500206	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	769
3300018062|Ga0187784_10651849	All Organisms → cellular organisms → Bacteria → Acidobacteria	844
3300018064|Ga0187773_10062640	All Organisms → cellular organisms → Bacteria → Acidobacteria	1744
3300018088|Ga0187771_11385590	All Organisms → cellular organisms → Bacteria → Acidobacteria	596
3300018433|Ga0066667_10101689	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1915
3300020580|Ga0210403_10497589	All Organisms → cellular organisms → Bacteria → Acidobacteria	990
3300021168|Ga0210406_11181100	All Organisms → cellular organisms → Bacteria → Acidobacteria	558
3300021171|Ga0210405_11079021	All Organisms → cellular organisms → Bacteria → Acidobacteria	601
3300021181|Ga0210388_10978366	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	726
3300021432|Ga0210384_10035127	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4649
3300021432|Ga0210384_10312445	All Organisms → cellular organisms → Bacteria → Acidobacteria	1415
3300021432|Ga0210384_10356450	All Organisms → cellular organisms → Bacteria → Acidobacteria	1317
3300021432|Ga0210384_11026071	All Organisms → cellular organisms → Bacteria → Acidobacteria	727
3300021476|Ga0187846_10224475	All Organisms → cellular organisms → Bacteria → Acidobacteria	784
3300021559|Ga0210409_10561082	All Organisms → cellular organisms → Bacteria → Acidobacteria	1008
3300021560|Ga0126371_12672763	All Organisms → cellular organisms → Bacteria → Acidobacteria	605
3300021560|Ga0126371_13505247	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	530
3300022532|Ga0242655_10313360	All Organisms → cellular organisms → Bacteria → Acidobacteria	514
3300024179|Ga0247695_1049784	All Organisms → cellular organisms → Bacteria → Acidobacteria	610
3300024330|Ga0137417_1310355	All Organisms → cellular organisms → Bacteria → Acidobacteria	1596
3300024331|Ga0247668_1046835	All Organisms → cellular organisms → Bacteria → Acidobacteria	880
3300026304|Ga0209240_1029091	All Organisms → cellular organisms → Bacteria → Acidobacteria	2110
3300026309|Ga0209055_1240305	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	558
3300026507|Ga0257165_1002223	All Organisms → cellular organisms → Bacteria → Acidobacteria	2477
3300026508|Ga0257161_1107430	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	582
3300026537|Ga0209157_1154384	All Organisms → cellular organisms → Bacteria → Acidobacteria	1026
3300026555|Ga0179593_1235325	All Organisms → cellular organisms → Bacteria	1528
3300026810|Ga0207801_104512	All Organisms → cellular organisms → Bacteria → Acidobacteria	937
3300026849|Ga0207804_105623	All Organisms → cellular organisms → Bacteria → Acidobacteria	1215
3300027105|Ga0207944_1018543	All Organisms → cellular organisms → Bacteria → Acidobacteria	605
3300027591|Ga0209733_1136322	All Organisms → cellular organisms → Bacteria → Acidobacteria	603
3300027674|Ga0209118_1137002	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	679
3300027684|Ga0209626_1126179	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	671
3300027701|Ga0209447_10136233	All Organisms → cellular organisms → Bacteria → Acidobacteria	674
3300027727|Ga0209328_10261791	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	515
3300027826|Ga0209060_10018322	All Organisms → cellular organisms → Bacteria → Acidobacteria	3739
3300027846|Ga0209180_10346647	All Organisms → cellular organisms → Bacteria → Acidobacteria	847
3300027855|Ga0209693_10376752	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	687
3300027879|Ga0209169_10234585	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	961
3300027884|Ga0209275_10078348	All Organisms → cellular organisms → Bacteria → Acidobacteria	1652
3300027884|Ga0209275_10438479	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	740
3300028536|Ga0137415_11420401	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	516
3300030738|Ga0265462_12299324	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	533
3300030841|Ga0075384_10599242	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	719
3300031344|Ga0265316_11056392	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	564
3300031446|Ga0170820_10141651	All Organisms → cellular organisms → Bacteria → Acidobacteria	514
3300031718|Ga0307474_10449954	All Organisms → cellular organisms → Bacteria → Acidobacteria	1006
3300031718|Ga0307474_11622919	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	508
3300031753|Ga0307477_11021202	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	542
3300031754|Ga0307475_10129018	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1996
3300031754|Ga0307475_11236771	All Organisms → cellular organisms → Bacteria → Acidobacteria	580
3300031820|Ga0307473_10936341	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_2_20CM_2_57_6	628
3300031823|Ga0307478_10620389	All Organisms → cellular organisms → Bacteria → Acidobacteria	905
3300031946|Ga0310910_11244610	All Organisms → cellular organisms → Bacteria → Acidobacteria	576
3300032063|Ga0318504_10007962	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3525
3300032261|Ga0306920_100498734	All Organisms → cellular organisms → Bacteria → Acidobacteria	1807
3300032897|Ga0335071_10100000	All Organisms → cellular organisms → Bacteria → Acidobacteria	2845
3300032954|Ga0335083_10120500	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	2537
3300033820|Ga0334817_041271	All Organisms → cellular organisms → Bacteria → Acidobacteria	917

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.32%
Host-Associated	Host-Associated	1.68%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	89.08%
Aquatic	Environmental → Aquatic	9.24%
Plants	Host-Associated → Plants	1.68%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	87.39%
Freshwater	Environmental → Aquatic → Freshwater	8.40%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.68%
Sediment	Environmental → Aquatic → Sediment	0.84%
Peat	Environmental → Terrestrial → Peat	0.84%
Cave	Environmental → Terrestrial → Cave	0.84%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	66.39%
Loam	Environmental → Terrestrial → Soil → Loam	12.61%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	8.40%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.40%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.84%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.84%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.84%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.84%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	34.45%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	23.53%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	12.61%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.40%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.04%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	4.20%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	4.20%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.52%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.84%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.84%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.84%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.84%

Habitat

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	20.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	15.13%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	5.88%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	5.88%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	5.04%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	5.04%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	4.20%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.20%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.36%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.52%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	2.52%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.52%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.52%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	1.68%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	1.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.68%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.68%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.68%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.84%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.84%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.84%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.84%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.84%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.84%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.84%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.84%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.84%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001356	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007	Environmental
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental
3300002347	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219)	Environmental
3300004635	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3	Environmental
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300006086	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013	Environmental
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009525	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG	Environmental
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010379	Sb_50d combined assembly	Environmental
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental
3300014638	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG	Environmental
3300015052	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)	Environmental
3300015053	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)	Environmental
3300015054	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)	Environmental
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental
3300017657	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015	Environmental
3300017822	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2	Environmental
3300017933	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1	Environmental
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental
3300018007	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5	Environmental
3300018020	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100	Environmental
3300018047	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10	Environmental
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental
3300018062	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG	Environmental
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental
3300018088	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG	Environmental
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental
3300021181	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O	Environmental
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental
3300021476	Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)	Environmental
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300022532	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)	Environmental
3300024179	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36	Environmental
3300024330	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)	Environmental
3300024331	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09	Environmental
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental
3300026309	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)	Environmental
3300026507	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B	Environmental
3300026508	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A	Environmental
3300026537	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)	Environmental
3300026555	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)	Environmental
3300026810	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16 (SPAdes)	Environmental
3300026849	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 46 (SPAdes)	Environmental
3300027105	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes)	Environmental
3300027591	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)	Environmental
3300027674	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)	Environmental
3300027684	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)	Environmental
3300027701	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)	Environmental
3300027727	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)	Environmental
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental
3300027855	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)	Environmental
3300027879	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)	Environmental
3300027884	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)	Environmental
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental
3300030738	Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly	Environmental
3300030841	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)	Environmental
3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Host-Associated
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental
3300032063	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17	Environmental
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental
3300032897	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5	Environmental
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental
3300033820	Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-D	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12269J14319_101688542	3300001356	Peatlands Soil	PADMESDKVAELEKKLGQVKHRVAQKSPPADSKP*
JGIcombinedJ26739_1006008481	3300002245	Forest Soil	SLSEWRHALPADVENDKIAEIEKKLGQTKHRVAQKSSVQEAKPQ*
JGIcombinedJ26865_10672551	3300002347	Arctic Peat Soil	WHRSLPGDVENDKVAELEKKLGQVKHRVAQKAPATEAKP*
Ga0062388_1023075302	3300004635	Bog Forest Soil	WHRALPGDVENDKIAEVEKKLGQAKHHVAQKSPAPDTKP*
Ga0070731_101424633	3300005538	Surface Soil	EWHRSLPADLEEDKVADVEKKLNEYKHRVAQKSPAGDAKP*
Ga0070732_102572532	3300005542	Surface Soil	MEWKRSLPADVENDKMAEVEKKLSQSKHRVAQKATSQEAKPQ*
Ga0066703_108452681	3300005568	Soil	SLPADLETDKVAELEKKLSQSKRRVAQKSTTNVAKP*
Ga0070762_103500962	3300005602	Soil	SLPADVETDKIAEIEKKVGQTKHRVAQKSVPQDAKHQ*
Ga0066903_1060559492	3300005764	Tropical Forest Soil	WRRSLPADIENDKIAELEKKLSTTKHRVAQKSSAQDAKPR*
Ga0075019_105493502	3300006086	Watersheds	EWHRSLPGDVENDKVADLEKKLGQAKHRVAQKSPATDPKP*
Ga0070765_1006374502	3300006176	Soil	TEWHRSLPADMEADKIAEVEKKVGSVKHRVAQKSPPQDKQ*
Ga0079222_102093743	3300006755	Agricultural Soil	LQEWKHVLPADVEDDKIAEVEKRISLVKHRVAQKAPSEEIKQQ*
Ga0066660_107043121	3300006800	Soil	WRRSLPADVENDKVAELEKKLSQSKHRVAQKATATDDKP*
Ga0079220_100581333	3300006806	Agricultural Soil	LAEWRRSLPADVETDKVAELEKKLSQSKHRVAQKSTATNDKP*
Ga0079220_106999882	3300006806	Agricultural Soil	LPADVENEKVAEVEKKLSQVKHRVAQKSSPQDAKPQ*
Ga0099795_104755762	3300007788	Vadose Zone Soil	ADVENEKIAEIEKKLGQTKHRVAQKSSVQEAKPQ*
Ga0099830_104594171	3300009088	Vadose Zone Soil	EWHRSLPADMEVDKVAELEKKISQSKHRVAQKSTANDAKP*
Ga0105242_104666392	3300009176	Miscanthus Rhizosphere	EWRRSLPADIETDKSAELEKKLSQTKHRVAQKSSSQDAKPR*
Ga0116220_103073871	3300009525	Peatlands Soil	PADIEADKVAELEKKLSRSKHRVAQKSAPPDAKPQ*
Ga0134064_102932411	3300010325	Grasslands Soil	LPADVETDKVAELEKKISQTKHRVAQKSTATDAKP*
Ga0074046_105996612	3300010339	Bog Forest Soil	RSLPADVESDKVAELEKKLGQVKHRVAQKSPVGDSKP*
Ga0126381_1007468373	3300010376	Tropical Forest Soil	WHRSLPADMEEDKVAELEKKVTQNKHRVAQKTPSADAKP*
Ga0136449_1032119832	3300010379	Peatlands Soil	PGDLENDKVAEVEKKLNQVKHRVAQKTSVPDAKP*
Ga0137391_114884902	3300011270	Vadose Zone Soil	ADVENDKIAEIEKKLGQTKHRIAQKSSAQEAKPQ*
Ga0137389_110234891	3300012096	Vadose Zone Soil	RHALPADVENDKIAEIEKKLGQTKHRIAQKSSAQEAKPQ*
Ga0137388_111571071	3300012189	Vadose Zone Soil	PADVEADKVAELEKKLSQSKHRVAQKSTASDAKP*
Ga0137376_108548172	3300012208	Vadose Zone Soil	KSLPADLETDKVAELEKKLSQSKHRVAQKSTASDAKP*
Ga0137378_105111891	3300012210	Vadose Zone Soil	ALPTELEADKVAEVEKKLTQVKHHIAQQKPAGEDTKPQ*
Ga0137384_113895742	3300012357	Vadose Zone Soil	RSLPADIESDKVAELEKKLSQSKHRVAQKSAATDAKP*
Ga0137361_117537932	3300012362	Vadose Zone Soil	WRHALPADVENDKIAEIEKKLGQTKHRVAQKSSVQEAKPQ*
Ga0137390_112260661	3300012363	Vadose Zone Soil	WRRSLPADVEADKVAELEKKLSQSKHRVAQKSTASDAKP*
Ga0137395_112754081	3300012917	Vadose Zone Soil	WKHSLPADVETDKIAELEKKLSQMKHRVAQKSSAQENKPQ*
Ga0137396_107165362	3300012918	Vadose Zone Soil	LPADVENEKIAEIERKLGQTKHRVAQKSSVQEAKPQ*
Ga0137359_106768112	3300012923	Vadose Zone Soil	HALPADVENDKIAEIEKKLGQTKHRVAQKSSVQEAKPQ*
Ga0137419_100225221	3300012925	Vadose Zone Soil	ALPADVENDKIAEIEKKLGQTKHRVAQKSSVQEAKPQ*
Ga0137416_108863432	3300012927	Vadose Zone Soil	SLPADVEPAKVAELEKKLSQSKRRLAQKSTSSVAKP*
Ga0137416_115412252	3300012927	Vadose Zone Soil	RSLPADVETDKVAELEKKISQTKHRVAQKSTATDAKP*
Ga0164301_113057341	3300012960	Soil	LPADVEPEKVAELEKKLSQSKHRLAQKSTSTVAKP*
Ga0126369_117386671	3300012971	Tropical Forest Soil	PGDVESDKVAEVERKLTQAKHHVAQKTQAPDAKP*
Ga0126369_121923512	3300012971	Tropical Forest Soil	PADIENDKIAELEKKLSTTKHRVAQKSSAQDAKPR*
Ga0134076_103742532	3300012976	Grasslands Soil	LPTELEPDKVAEVEKKLTQVKHRIAQQKPAGEDTKPQ*
Ga0134087_100874343	3300012977	Grasslands Soil	PADLEADKVAELEKKLSQSKHRVAQKSTTSVAKP*
Ga0164304_114947342	3300012986	Soil	PADVEPEKVAELEKKLSQSKHRLAQKSTSTVAKP*
Ga0181536_102617282	3300014638	Bog	PADLESDKVAELEKKLGQVKHRVAQKSPPADSKP*
Ga0137411_13640829	3300015052	Vadose Zone Soil	MAAFPAADLEPEKVAELEKKLSQSKHRLAQKSTSSVAKP*
Ga0137405_12772653	3300015053	Vadose Zone Soil	LPADVEPEKVAELEKKLSQSKRRLAQKSTSSVAKP*
Ga0137420_11633803	3300015054	Vadose Zone Soil	PPADLETDKVAELEKKLTQSKHRVAQKSTASDAKP*
Ga0137420_13370794	3300015054	Vadose Zone Soil	LPADLEEDKVAEVEKKLSQNKHRVAQKTPPADAKP*
Ga0182041_118787802	3300016294	Soil	LPGDVEADKVAEVEKKLTQAKHHVAQKTQAPDAKP
Ga0134074_12528062	3300017657	Grasslands Soil	RSLPAELETDKVAELERKLSQSKHRVAQKSSASDAKP
Ga0187802_100814962	3300017822	Freshwater Sediment	LPADLENDKVAEVEKKLNQVKHRVAQKTPTTDAKP
Ga0187801_100013441	3300017933	Freshwater Sediment	NEWHRSLPADLENDKVAEVEKKLNQVKHRVAQKTPTTDAKP
Ga0187801_102430161	3300017933	Freshwater Sediment	WRRSLPADLESDKVAEVEKKLNQVKHRVAQKAPATDAKP
Ga0187776_105018932	3300017966	Tropical Peatland	RSLPADLESDKVAEVEKKLNQVKHRVAQKTPATDAKP
Ga0187781_104426851	3300017972	Tropical Peatland	HRSLPADLESDKVAEVEKKLSQVKHRVAQKTPVTDAKP
Ga0187782_100011511	3300017975	Tropical Peatland	LNEWHRSLPADLESDKVAEVEKKLSQVKHRVAQKTPVTDAKP
Ga0187805_100838871	3300018007	Freshwater Sediment	WHRSLPADVETDKIAELEKKLGQSKHRVAQKSSPQDAKPQ
Ga0187805_106356642	3300018007	Freshwater Sediment	WHRSLPADLESDKVAEVEKKLNQVKHRVAQKAPATDAKP
Ga0187861_104665552	3300018020	Peatland	LPADLENDKIAELEKKLGQVKHRVAQKSPVDDSKP
Ga0187859_101582853	3300018047	Peatland	RSLPADVENDKIAELEKKVGQTKHRVAQKSVPQDAKPQ
Ga0187765_105002062	3300018060	Tropical Peatland	RRSLPADIENDKIAEIEKKLSQSKHRVAQKSVPGDSKP
Ga0187784_106518492	3300018062	Tropical Peatland	EWHRSLPADLESDKVAEVEKKLSQVKHRVAQKTPVTDAKP
Ga0187773_100626401	3300018064	Tropical Peatland	LPADLESDKVAEVEKKLNQVKHRVAQKSPATDAKP
Ga0187771_113855902	3300018088	Tropical Peatland	WRRSLPADLESDKVAELEKKLGQVKHRVAQKSPPADSKP
Ga0066667_101016893	3300018433	Grasslands Soil	AEWRRSLPADVESDKVAELEKKLSQSKHRVAQKSIATDDKP
Ga0210403_104975892	3300020580	Soil	NEWRRSLPADLEEDKVAEVEKKLSQNKHRVAQKTPPADAKP
Ga0210406_111811002	3300021168	Soil	LEWRRSLPADVEADKVAELEKKVSQSKHRVAQKSVPSDNKP
Ga0210405_110790211	3300021171	Soil	AEWRRSLPADIESDKVAEVEKRLGQVKHRVAQKSDSQDAKPQ
Ga0210388_109783662	3300021181	Soil	HRSLPADVETEKIAEIEKKLSQVKHRVAQKSSPQDAKPQ
Ga0210384_100351271	3300021432	Soil	PADIEADKIAEIEKRLGQVKHRVAQKSSPQDAKPQ
Ga0210384_103124453	3300021432	Soil	LPAEVEADKVAELEKKVSQSKHRVAQKSVPSDNKP
Ga0210384_103564503	3300021432	Soil	SLPADLEEDKVAEVEKKLSQNKHRVAQKTPPADAKP
Ga0210384_110260711	3300021432	Soil	LPADVEPDKVAELEKKLSHSKHRVAQKSTSRDAKP
Ga0187846_102244751	3300021476	Biofilm	LEWHKALPADLENDKVAELEKKLLQSKHRVAQKATTSDAKP
Ga0210409_105610821	3300021559	Soil	RSLPADLEEDKVAEVEKKLSQNKHRVAQKAPPADAKP
Ga0126371_126727632	3300021560	Tropical Forest Soil	RHTLPGDVEADKVAEVEKKLTQAKHHVAQKTQVPDAKP
Ga0126371_135052472	3300021560	Tropical Forest Soil	SLPADVENDKMAEVEKKLSQSRHRVAQKATSQDAKPQ
Ga0242655_103133602	3300022532	Soil	SLPADLEEDKVAEVEKKISQNKHRVAQKTPPADAKP
Ga0247695_10497841	3300024179	Soil	SLPADLEEDKVAEVEKKLSQNKHRVAQKTPAADAKP
Ga0137417_13103552	3300024330	Vadose Zone Soil	VEWRRSLPADVETDKVAELEKKISQTKHRVAQKSTATDAKP
Ga0247668_10468352	3300024331	Soil	RSLPADLEEDKVAEVEKKLSQNKHRVAQKTPAADAKP
Ga0209240_10290913	3300026304	Grasslands Soil	ALPADVESDKIAEVEKRLGKVKHRVAQKSSSQDAKPQ
Ga0209055_12403051	3300026309	Soil	RRSLPADMEADKVAELEKKLSQSKHRVAQKSTTSVAKP
Ga0257165_10022234	3300026507	Soil	SLPADFEEDKVAEVEKKLSQNKHRVAQKTPPADAKP
Ga0257161_11074302	3300026508	Soil	PPADMETEKVAELEKKLTQSKHRVAQKSTASDAKP
Ga0209157_11543842	3300026537	Soil	WHRALPTELEADKVAEVEKKLTQVKHRIAQQKPAGEDTKPQ
Ga0179593_12353253	3300026555	Vadose Zone Soil	LPADLEEDKVAEVEKKLSQNKHRVAQKTPPADAKP
Ga0207801_1045122	3300026810	Tropical Forest Soil	RRTLPGDVEAEKVAEVEKKLTLAKHHVAQKAQAPDAKP
Ga0207804_1056232	3300026849	Tropical Forest Soil	MMHRSLPADLESDKVAEVEKKLNQVKHRVAQKAPAAEDKP
Ga0207944_10185431	3300027105	Forest Soil	WRHALPADVENDKIAELEKKLGQTKHRVAQKSSNQEAKPQ
Ga0209733_11363222	3300027591	Forest Soil	HALPADVENDKIAEIEKKLGQTKHRVAQKSSVQEAKPQ
Ga0209118_11370022	3300027674	Forest Soil	LPADVETDKVAELEKKISQTKHRVAQKSTATDAKP
Ga0209626_11261791	3300027684	Forest Soil	EWRHALPADVENDKIAEIEKKLGQTKHRVAQKSSIQEAKPQ
Ga0209447_101362332	3300027701	Bog Forest Soil	RSLPADIETDKIAELEKKVGQTKHRVAQKSVPQDSKHQ
Ga0209328_102617912	3300027727	Forest Soil	PADVENDKIAEIEKKLGQTKHRVAQKSSVQEAKPQ
Ga0209060_100183225	3300027826	Surface Soil	HRSLPADMETDKIAEVEKKVGSVKHRVAQKSTPQDKQ
Ga0209180_103466472	3300027846	Vadose Zone Soil	PADVENEKIAEIEKKLGQTKHRVAQKSSVQEAKPQ
Ga0209693_103767521	3300027855	Soil	TEWHRSLPADMEADKIAEVEKKVGSVKHRVAQKSPPQDKQ
Ga0209169_102345853	3300027879	Soil	RSLPADVENDKIAEIEKKLSQVKHRVAQKSSPQDAKPQ
Ga0209275_100783483	3300027884	Soil	WRRSLPADVETDKIAEIEKKVGQTKHRVAQKSVPQDAKHQ
Ga0209275_104384791	3300027884	Soil	SLPADVETEKIAEIEKKLSQVKHRVAQKSSPQDAKPQ
Ga0137415_114204011	3300028536	Vadose Zone Soil	RRSLPADVEADKVAELEKKLSQSKHRVAQKSTTSVAKP
Ga0265462_122993241	3300030738	Soil	LPADMENDKIAEIERKLSQVKHRVAQKSSPQDAKPQ
Ga0075384_105992421	3300030841	Soil	WHKSLPSDVESDKVAELEKKLGQMKHRVAQKAAAPDAKP
Ga0265316_110563922	3300031344	Rhizosphere	RSLPGDVENDKVAELEKKLGQVKHRVAQKSPPTDAKP
Ga0170820_101416511	3300031446	Forest Soil	RSLPADMEPDKIAEVEKKVGSSKHRVAQKSTPQSSNKQQ
Ga0307474_104499541	3300031718	Hardwood Forest Soil	HRSLPADVENDKIAEIEKKLSQVKHRVAQKSSPQDAKPQ
Ga0307474_116229192	3300031718	Hardwood Forest Soil	SLAEWHHSLPADMENDKIAEIERKLSQVKHRVAQKSSPQDAKPQ
Ga0307477_110212021	3300031753	Hardwood Forest Soil	HALPADVENDKIAEIEKKLGQTKHRVAQKSSAQEAKPQ
Ga0307475_101290181	3300031754	Hardwood Forest Soil	LPADVENDKIAEIEKKLGQSKHRVAQKSSVQEPKPQ
Ga0307475_112367711	3300031754	Hardwood Forest Soil	WKHSLPADVETDKIAELEKKLSQMKHRVAQKSSAQEAKPQ
Ga0307473_109363411	3300031820	Hardwood Forest Soil	PADIETEKIAELEKKLSQTKHRVAQKSSSQDAKPR
Ga0307478_106203891	3300031823	Hardwood Forest Soil	WRRSLPADVETDKIAELEKKVGQTKHRVAQKSVPQDSKHQ
Ga0310910_112446101	3300031946	Soil	HTLPGDVEADKVAEVEKKLTQAKHHVAQKTQAPDAKP
Ga0318504_100079625	3300032063	Soil	SLPADLENDKVAELEKKLSQSKHRVAQKSTAADAKP
Ga0306920_1004987343	3300032261	Soil	WRRALPADLEEDKVAEVEKKLNQYKHRVAQKTPASDAKP
Ga0335071_101000001	3300032897	Soil	NEWHRSLPADMETDKIAEVEKKVGSVKHRVAQKSTPQDNKHQ
Ga0335083_101205001	3300032954	Soil	SLPADLESDKVAEVEKKVNQVKHRVAQKTPATDAKP
Ga0334817_041271_3_128	3300033820	Soil	EEWRRSLPADLESDKVAELEKKLGQVKHRVAQKSPVADSKP