Basic Information | |
---|---|
Family ID | F075114 |
Family Type | Metagenome |
Number of Sequences | 119 |
Average Sequence Length | 42 residues |
Representative Sequence | TALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.44 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.958 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.210 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.412 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.059 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF01740 | STAS | 15.13 |
PF03401 | TctC | 7.56 |
PF07331 | TctB | 7.56 |
PF07883 | Cupin_2 | 7.56 |
PF02684 | LpxB | 4.20 |
PF13847 | Methyltransf_31 | 2.52 |
PF03480 | DctP | 2.52 |
PF04480 | DUF559 | 2.52 |
PF08327 | AHSA1 | 2.52 |
PF12006 | DUF3500 | 1.68 |
PF03734 | YkuD | 1.68 |
PF01970 | TctA | 1.68 |
PF09265 | Cytokin-bind | 1.68 |
PF01565 | FAD_binding_4 | 1.68 |
PF11845 | DUF3365 | 1.68 |
PF14833 | NAD_binding_11 | 1.68 |
PF00067 | p450 | 1.68 |
PF13193 | AMP-binding_C | 0.84 |
PF03928 | HbpS-like | 0.84 |
PF00881 | Nitroreductase | 0.84 |
PF00296 | Bac_luciferase | 0.84 |
PF00355 | Rieske | 0.84 |
PF07715 | Plug | 0.84 |
PF03459 | TOBE | 0.84 |
PF03729 | DUF308 | 0.84 |
PF13586 | DDE_Tnp_1_2 | 0.84 |
PF00155 | Aminotran_1_2 | 0.84 |
PF00496 | SBP_bac_5 | 0.84 |
PF00072 | Response_reg | 0.84 |
PF01925 | TauE | 0.84 |
PF04011 | LemA | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 7.56 |
COG0763 | Lipid A disaccharide synthetase | Cell wall/membrane/envelope biogenesis [M] | 4.20 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 1.68 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
COG1784 | TctA family transporter | General function prediction only [R] | 1.68 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.68 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
COG3333 | TctA family transporter | General function prediction only [R] | 1.68 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.84 |
COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.84 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.96 % |
Unclassified | root | N/A | 5.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908029|A2_v1_NODE_15389_len_854_cov_9_913349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 904 | Open in IMG/M |
3300001867|JGI12627J18819_10156265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 928 | Open in IMG/M |
3300005165|Ga0066869_10014979 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1108 | Open in IMG/M |
3300005172|Ga0066683_10317148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 969 | Open in IMG/M |
3300005332|Ga0066388_101820078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1083 | Open in IMG/M |
3300005332|Ga0066388_106082982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
3300005341|Ga0070691_10209981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1027 | Open in IMG/M |
3300005454|Ga0066687_10726555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
3300005457|Ga0070662_101322582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 620 | Open in IMG/M |
3300005557|Ga0066704_10430443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 873 | Open in IMG/M |
3300005576|Ga0066708_10415356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
3300005764|Ga0066903_106016567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 635 | Open in IMG/M |
3300005764|Ga0066903_108604319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
3300005983|Ga0081540_1033905 | All Organisms → cellular organisms → Bacteria | 2763 | Open in IMG/M |
3300005995|Ga0066790_10192280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
3300006038|Ga0075365_10720851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 704 | Open in IMG/M |
3300006041|Ga0075023_100081651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1083 | Open in IMG/M |
3300006057|Ga0075026_100745965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
3300006176|Ga0070765_100972443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 802 | Open in IMG/M |
3300006642|Ga0075521_10116641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1235 | Open in IMG/M |
3300006642|Ga0075521_10136310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1145 | Open in IMG/M |
3300006795|Ga0075520_1004615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 6960 | Open in IMG/M |
3300006844|Ga0075428_100296589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1738 | Open in IMG/M |
3300006847|Ga0075431_100164018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2284 | Open in IMG/M |
3300006918|Ga0079216_11396174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 579 | Open in IMG/M |
3300009137|Ga0066709_100408463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1886 | Open in IMG/M |
3300009789|Ga0126307_11061245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
3300010337|Ga0134062_10374767 | Not Available | 691 | Open in IMG/M |
3300010358|Ga0126370_10445825 | Not Available | 1078 | Open in IMG/M |
3300010358|Ga0126370_10766207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 856 | Open in IMG/M |
3300010360|Ga0126372_12799002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 540 | Open in IMG/M |
3300010366|Ga0126379_13544776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300010373|Ga0134128_11422350 | Not Available | 764 | Open in IMG/M |
3300010397|Ga0134124_11063641 | Not Available | 824 | Open in IMG/M |
3300010397|Ga0134124_11668422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 669 | Open in IMG/M |
3300011417|Ga0137326_1139868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 559 | Open in IMG/M |
3300012199|Ga0137383_10294118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1189 | Open in IMG/M |
3300012200|Ga0137382_10302069 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300012202|Ga0137363_10386031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1164 | Open in IMG/M |
3300012202|Ga0137363_10426008 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300012211|Ga0137377_11142585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
3300012232|Ga0137435_1266233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
3300012350|Ga0137372_10507734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
3300012362|Ga0137361_10817969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 847 | Open in IMG/M |
3300012362|Ga0137361_10998045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
3300012924|Ga0137413_11703641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
3300012948|Ga0126375_11402350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
3300012955|Ga0164298_10477399 | Not Available | 827 | Open in IMG/M |
3300012971|Ga0126369_13412915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
3300014166|Ga0134079_10243610 | Not Available | 774 | Open in IMG/M |
3300015080|Ga0167639_1000296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 7647 | Open in IMG/M |
3300015371|Ga0132258_12340943 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
3300016270|Ga0182036_10011211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4769 | Open in IMG/M |
3300016341|Ga0182035_11189653 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300016357|Ga0182032_11224243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
3300016422|Ga0182039_12244743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
3300016445|Ga0182038_11708551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
3300017947|Ga0187785_10321835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
3300017965|Ga0190266_10749245 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300018029|Ga0187787_10235413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 662 | Open in IMG/M |
3300018073|Ga0184624_10167035 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 973 | Open in IMG/M |
3300018422|Ga0190265_11925968 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
3300018482|Ga0066669_10355902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1219 | Open in IMG/M |
3300018482|Ga0066669_12330886 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300020579|Ga0210407_10327190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1198 | Open in IMG/M |
3300020579|Ga0210407_11470174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
3300021168|Ga0210406_10816345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 708 | Open in IMG/M |
3300021384|Ga0213876_10565259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300025553|Ga0208080_1076419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 755 | Open in IMG/M |
3300025878|Ga0209584_10414446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
3300025891|Ga0209585_10040983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1700 | Open in IMG/M |
3300025900|Ga0207710_10500198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 631 | Open in IMG/M |
3300025912|Ga0207707_11479879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. TF02-7 | 539 | Open in IMG/M |
3300025929|Ga0207664_11219116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
3300026142|Ga0207698_11491068 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300026223|Ga0209840_1114829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 577 | Open in IMG/M |
3300026319|Ga0209647_1202404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
3300026330|Ga0209473_1120369 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300027738|Ga0208989_10310847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
3300027894|Ga0209068_10649834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
3300027902|Ga0209048_11067023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300027907|Ga0207428_10959834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Pseudothauera → Pseudothauera lacus | 602 | Open in IMG/M |
3300028787|Ga0307323_10021016 | All Organisms → cellular organisms → Bacteria | 2233 | Open in IMG/M |
3300028811|Ga0307292_10027754 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
3300028881|Ga0307277_10080335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
3300031231|Ga0170824_104334962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
3300031544|Ga0318534_10219194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1098 | Open in IMG/M |
3300031564|Ga0318573_10484974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
3300031572|Ga0318515_10136838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1301 | Open in IMG/M |
3300031572|Ga0318515_10706069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
3300031680|Ga0318574_10478549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 729 | Open in IMG/M |
3300031682|Ga0318560_10404404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
3300031747|Ga0318502_10191642 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300031747|Ga0318502_10366985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
3300031751|Ga0318494_10268168 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300031763|Ga0318537_10015951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2580 | Open in IMG/M |
3300031765|Ga0318554_10256757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
3300031770|Ga0318521_10267315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1001 | Open in IMG/M |
3300031782|Ga0318552_10664865 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300031799|Ga0318565_10383972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
3300031805|Ga0318497_10244205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
3300031819|Ga0318568_10284219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1027 | Open in IMG/M |
3300031845|Ga0318511_10551749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
3300031890|Ga0306925_10726830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1037 | Open in IMG/M |
3300031893|Ga0318536_10303209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
3300031942|Ga0310916_10536606 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300031945|Ga0310913_10335470 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300032001|Ga0306922_10052689 | All Organisms → cellular organisms → Bacteria | 4212 | Open in IMG/M |
3300032009|Ga0318563_10496091 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
3300032054|Ga0318570_10160415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1008 | Open in IMG/M |
3300032067|Ga0318524_10077943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1619 | Open in IMG/M |
3300032067|Ga0318524_10288936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
3300032076|Ga0306924_10699573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1138 | Open in IMG/M |
3300032089|Ga0318525_10362603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 743 | Open in IMG/M |
3300032089|Ga0318525_10635137 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300033290|Ga0318519_10608886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
3300033486|Ga0316624_12139177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
3300033758|Ga0314868_006535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1100 | Open in IMG/M |
3300034148|Ga0364927_0044561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1143 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.21% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.04% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.04% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.20% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.36% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.52% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.52% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.68% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.68% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.68% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.84% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.84% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.84% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.84% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.84% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.84% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.84% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908029 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300025553 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A2_v1_00013940 | 2124908029 | Soil | EAFLAVLNNAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGKQG |
JGI12627J18819_101562651 | 3300001867 | Forest Soil | MTTLANVGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG* |
Ga0066869_100149793 | 3300005165 | Soil | TTLANVGQELAYLDGPDFQKFWDIDGRRTDEAVILIGRQG* |
Ga0066683_103171481 | 3300005172 | Soil | AQSDQFMTTLANVGQELAYLDGPDFQKFWDIDGRRTDEAVMSIGRQG* |
Ga0066388_1018200781 | 3300005332 | Tropical Forest Soil | ALANAGQELAYLDGPDFQKFWDIDGQRTDEAVISIGRQG* |
Ga0066388_1060829821 | 3300005332 | Tropical Forest Soil | FKTALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG* |
Ga0070691_102099812 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | KAAQSDQFTAALANAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGRQ* |
Ga0066687_107265551 | 3300005454 | Soil | ANSDAFKAALTNAGQELAYLNGPDFQKFWDDDGKKTDEAVVFIGKQ* |
Ga0070662_1013225822 | 3300005457 | Corn Rhizosphere | TALTNAGLELAYLDGPDFQKFWDVDGARTDEAVIAIGRQG* |
Ga0066704_104304431 | 3300005557 | Soil | IGKAAQSDQFMTTLANVGQELAYLDGPDFQKFWDIDGRRTDEAVMSIGRQG* |
Ga0066708_104153561 | 3300005576 | Soil | AHSSEYTTALANAGQELAYLDGPDFQKFWDIDGQRTDEAVISIGRQG* |
Ga0066903_1060165671 | 3300005764 | Tropical Forest Soil | QELDYLDGPDFQKFWDIDGKRTDDAVNSIGRVQG* |
Ga0066903_1086043191 | 3300005764 | Tropical Forest Soil | TLVNIGLELAYLDGPDFQKFWDIDGRRTDEAVIAIGRQG* |
Ga0081540_10339054 | 3300005983 | Tabebuia Heterophylla Rhizosphere | EFLAALTNAGQELAYLDGPDFQKFWDIDGQRTDEAVIAIGKQG* |
Ga0066790_101922801 | 3300005995 | Soil | VLSNAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGRQG* |
Ga0075365_107208511 | 3300006038 | Populus Endosphere | VLTNIGQELAYLNGPDFQKFWDTDGKRTDEAVVSIGKQ* |
Ga0075023_1000816514 | 3300006041 | Watersheds | ANVGQELDYLDGPDFQKFWDIDGKRTDEAVISIGRQG* |
Ga0075026_1007459652 | 3300006057 | Watersheds | QFKTALVNAGQEPDYLDGPDFQKFWDLDGKRTDEAVVSIGRQG* |
Ga0070765_1009724433 | 3300006176 | Soil | TLANVGQELDYLDGPDFQRFWEIDGKRTDEAVMAIGRQG* |
Ga0075521_101166413 | 3300006642 | Arctic Peat Soil | FLTVLSNAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGRQG* |
Ga0075521_101363101 | 3300006642 | Arctic Peat Soil | TTVLANAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGKQG* |
Ga0075520_10046157 | 3300006795 | Arctic Peat Soil | HSEAFLAVLNNAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGKQG* |
Ga0075428_1002965893 | 3300006844 | Populus Rhizosphere | GQELAYLDGPDFQKFWDIDGKRTDEAVISIGRQG* |
Ga0075431_1001640181 | 3300006847 | Populus Rhizosphere | AGQELAYLDGPDFQKFWDIDGKRTDEAVISIGRQG* |
Ga0079216_113961742 | 3300006918 | Agricultural Soil | NAGQELAYLDMPEFQTFFDQDGKRVDETVRSIGRQG* |
Ga0066709_1004084631 | 3300009137 | Grasslands Soil | NAGQELAYLDGPDFQKFWDIDGQRTDEAVISIGRQG* |
Ga0126307_110612451 | 3300009789 | Serpentine Soil | KAAQSDQFKAALVNVGQELNYLDGPDFQTFWDIDGKRTDEAVISIGRQ* |
Ga0134062_103747671 | 3300010337 | Grasslands Soil | TAALANAGQELAYLDEPDFQKFWDIDGKRTDEAVIFIGRQG* |
Ga0126370_104458253 | 3300010358 | Tropical Forest Soil | IGLELAYLDGPDFAAFWDSEIKRSEEAVRAIGRA* |
Ga0126370_107662071 | 3300010358 | Tropical Forest Soil | TALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG* |
Ga0126372_127990022 | 3300010360 | Tropical Forest Soil | SNAGQELAYLDGPDFQKFWDIDGQRTDEAVRLIGRQG* |
Ga0126379_135447761 | 3300010366 | Tropical Forest Soil | NAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG* |
Ga0134128_114223501 | 3300010373 | Terrestrial Soil | KTAITNAGQELAYLDGPDFQKFWDVDGRRTDEAVIAIGRQG* |
Ga0134124_110636413 | 3300010397 | Terrestrial Soil | GQELDYLDGPDFQKFWDIDGKRSDEAVIAIGRQG* |
Ga0134124_116684222 | 3300010397 | Terrestrial Soil | LVNIGQELEYLDGPDFQKFWDLDGKRTDEAVISIGKQG* |
Ga0137326_11398681 | 3300011417 | Soil | AAIGKAAHSDQFTAAIANAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGRQ* |
Ga0137383_102941184 | 3300012199 | Vadose Zone Soil | GQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG* |
Ga0137382_103020692 | 3300012200 | Vadose Zone Soil | FQTALANAGQELAYLDGPEFQKFWDVDGARTDEAVIAIGRQG* |
Ga0137363_103860312 | 3300012202 | Vadose Zone Soil | DEIVTTLRGAIDKAAHSAEFIAALANAGQELAYLDGPDFQTFWDVDGRRTDEAVISIGRQG* |
Ga0137363_104260082 | 3300012202 | Vadose Zone Soil | ALANAGQELAYLDGPDFQTFWDVDGRRTDEAVISIGRQG* |
Ga0137377_111425852 | 3300012211 | Vadose Zone Soil | AAQSDQFMTTLANVGQELAYLDGPDFQKFWDIDGQRTDEAVISIGRQG* |
Ga0137435_12662331 | 3300012232 | Soil | AIGKAVHSDTFLAVLANAGQELAYLDGPDFQKFWDVDGKRTDEAVISIGKQG* |
Ga0137372_105077341 | 3300012350 | Vadose Zone Soil | KTALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG* |
Ga0137361_108179691 | 3300012362 | Vadose Zone Soil | NAGQELDYLDGPEFQKFWDIDGKRTDDAVISIGRQG* |
Ga0137361_109980451 | 3300012362 | Vadose Zone Soil | KAAQSDQFMTTLANVGQELAYLDGPDFQKFWDIDGQRTDEAVISIGRQG* |
Ga0137413_117036411 | 3300012924 | Vadose Zone Soil | NVGQELDYLDGPDFQKFWDIDGKRSDEAVISIGRQG* |
Ga0126375_114023502 | 3300012948 | Tropical Forest Soil | AALTNLGLDLAYLDGPDFQKFWDVDGKRTDEAVILIGRQG* |
Ga0164298_104773993 | 3300012955 | Soil | ALANAGQELAYLDEPDFQKFWDIDGKRTDEAVIFIGRQG* |
Ga0126369_134129151 | 3300012971 | Tropical Forest Soil | ALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG* |
Ga0134079_102436102 | 3300014166 | Grasslands Soil | AALANAGQELAYLDEPDFQKFWDIDGKRTDEAVIFIGRQG* |
Ga0167639_10002961 | 3300015080 | Glacier Forefield Soil | FTTVLTNAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGRQG* |
Ga0132258_123409433 | 3300015371 | Arabidopsis Rhizosphere | LVNIGQDLAYLDGPDFQKFWDLDGKRTDEAVISIGKQG* |
Ga0182036_100112111 | 3300016270 | Soil | AVGNAGLELDYLDGPEFQKFWNIDGRRTDEAVIAIGRQG |
Ga0182035_111896531 | 3300016341 | Soil | KAVQSQQFRTALVNAGQELDYLDGPDFQKFWDIDGKRTDEAVLSIGRQG |
Ga0182032_112242432 | 3300016357 | Soil | VVSDQFRTAVGNAGLELDYLDGPEFQKFWDIDGKRTDEAVIAIGRQG |
Ga0182039_122447432 | 3300016422 | Soil | AGQEIDYLDGPDFQKFWDIDGKRTDEAVIAIGRQG |
Ga0182038_117085512 | 3300016445 | Soil | VSDQFRTAVGNAGLELDYLDGPEFQKFWDIDGKRTDEAVIAIGRQG |
Ga0187785_103218352 | 3300017947 | Tropical Peatland | GQDLAYLDGPDFQKFWDVDGARTDEAVRQIGRVQG |
Ga0190266_107492451 | 3300017965 | Soil | DQFKTTLVNIGQELEYLDGPDFQKFWDIDGTRTDEAVISIGKQG |
Ga0187787_102354132 | 3300018029 | Tropical Peatland | MNNLGQEVAYLDGPDFQKFWDIDGKRVDEAVKGIGRVQG |
Ga0184624_101670352 | 3300018073 | Groundwater Sediment | IGQELEYLDGPDFQKFWDIDGARTDEAVILIGKQG |
Ga0190265_119259682 | 3300018422 | Soil | HAEAFTTALTNAGQELAYLDMPEFQAFFDQDGKRVDETVRSIGRQG |
Ga0066669_103559024 | 3300018482 | Grasslands Soil | TTLANVGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0066669_123308861 | 3300018482 | Grasslands Soil | GFQTALANAAQEPAYLDGPDFQKFWDIDGQRTDEAVISIGRQG |
Ga0210407_103271901 | 3300020579 | Soil | NVGQELDYLDGPDFQRFWEIDGKRTDEAVMAIGRQG |
Ga0210407_114701741 | 3300020579 | Soil | PFKSTLANVGQELDYLDGPDFQRFWEIDGKRTDEAVMAIGRQG |
Ga0210406_108163451 | 3300021168 | Soil | DQFKATLANVGQELDYLDGPDFQRFWEIDGKRTDEAVMAIGRQG |
Ga0213876_105652592 | 3300021384 | Plant Roots | KAVQADQFKAALTNAGQELAYLDGPDFQAFWDVDGKRTDEAVIAIGRQG |
Ga0208080_10764191 | 3300025553 | Arctic Peat Soil | NAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGKQG |
Ga0209584_104144461 | 3300025878 | Arctic Peat Soil | FQTVLANAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGKQG |
Ga0209585_100409834 | 3300025891 | Arctic Peat Soil | AAHSEAFTTVLANAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGKQG |
Ga0207710_105001981 | 3300025900 | Switchgrass Rhizosphere | IGQELEYLDGPDFQKFWDLDGKRTDEAVISIGKQG |
Ga0207707_114798791 | 3300025912 | Corn Rhizosphere | VGQELAYLDGPDFQKFWDIDGKRTDEAVISIGRQG |
Ga0207664_112191161 | 3300025929 | Agricultural Soil | LVNIGLELAYLDGPDFQKFWDIDGRRTDEAVIAIGRQG |
Ga0207698_114910682 | 3300026142 | Corn Rhizosphere | LTNVGQELAYLDGPDFQKFWDIDGKRTDEAVIAIGRQG |
Ga0209840_11148291 | 3300026223 | Soil | SEAFLAVLNNAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGKQG |
Ga0209647_12024041 | 3300026319 | Grasslands Soil | ANVGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0209473_11203692 | 3300026330 | Soil | AAIGKAIQSTGFQTALANAAQEPAYLDGPDFQKFWDIDGQRTDEAVISIGRQG |
Ga0208989_103108472 | 3300027738 | Forest Soil | VLANAGQELAYLDGPDFQKFWDIDGKRTDEAVIAIGRQG |
Ga0209068_106498342 | 3300027894 | Watersheds | DHFKAALANAGQELDYLDGPDFQKFWDIDGKRTDEAVKFIGKQG |
Ga0209048_110670231 | 3300027902 | Freshwater Lake Sediment | LANAGQELAYLDGPDFQKFWDIDGKRTDEAVISIGKQG |
Ga0207428_109598341 | 3300027907 | Populus Rhizosphere | YQTALTNAGLELAYLDGPDFQKFWDVDGARTDEAVIAIGRQG |
Ga0307323_100210163 | 3300028787 | Soil | IGQELEYLDGPDFQKFWDIDGTRTDEAVISIGKQG |
Ga0307292_100277541 | 3300028811 | Soil | DQFKTTLINIGQELEYLDGPDFQKFWDIDGTRTDEAVISIGKQG |
Ga0307277_100803352 | 3300028881 | Soil | TLINIGQELEYLDGPDFQKFWDIDGTRTDEAVISIGKQG |
Ga0170824_1043349621 | 3300031231 | Forest Soil | DQFKTTLANVGQELDYLDGPDFQRFWEIDGKRTDEAVMAIGRQG |
Ga0318534_102191941 | 3300031544 | Soil | VAIGKAAQSDQFMTTLANVGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0318573_104849742 | 3300031564 | Soil | FKTALANAGQELAYLDGPDFQKFWDIDGQRTDEAVISIGRQG |
Ga0318515_101368381 | 3300031572 | Soil | FMTTLANVGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0318515_107060691 | 3300031572 | Soil | TALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0318574_104785492 | 3300031680 | Soil | QFMTTLANVGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0318560_104044041 | 3300031682 | Soil | FNTALANAGQEPAYLDGPDFQKFWNIDGQRTDEAVMSIGRQG |
Ga0318502_101916422 | 3300031747 | Soil | ANAGQDPAYLDGPDFQKFWDIDGQRTDEAVIWIGRQG |
Ga0318502_103669851 | 3300031747 | Soil | AVQSNEFQTALTNVGLELAYLDGPDFQKFCDVDGKRTDEAVIAIGRQG |
Ga0318494_102681683 | 3300031751 | Soil | VGNAGLELDYLDGPEFQKFWDIDGRRTDEAVIAIGRQG |
Ga0318537_100159514 | 3300031763 | Soil | NAGQDPAYLDGPDFQKFWDIDGQRTDEAVIWIGRQG |
Ga0318554_102567572 | 3300031765 | Soil | FKTALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0318521_102673151 | 3300031770 | Soil | EVQTALTNVGLELAYLDGPDFQKFCDVDGKRTDEAVIAIGRQG |
Ga0318552_106648652 | 3300031782 | Soil | KAVQSDQFNTALANAGQEPAYLDGPDFQKFWNIDGQRTDEAVMSIGRQG |
Ga0318565_103839722 | 3300031799 | Soil | AIGKAVQSDQFNTALANAGQEPAYLDGPDFQKFWNIDGQRTDEAVMSIGRQG |
Ga0318497_102442052 | 3300031805 | Soil | FRTALANTGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0318568_102842191 | 3300031819 | Soil | VGLELAYLDGPDFQKFCDVDGKRTDEAVIAIGRQG |
Ga0318511_105517491 | 3300031845 | Soil | FQTALTNVGLELAYLDGPDFQKFWDVDGKRTDEAVIAIGRQG |
Ga0306925_107268302 | 3300031890 | Soil | HRQGGATALANAGQELAYLDGPDFQKFWDIDGQRTDEAVISIGRQG |
Ga0318536_103032092 | 3300031893 | Soil | KAAQSDQFMTTLANVGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0310916_105366061 | 3300031942 | Soil | VQSQQFRTALVNAGQELDYLDGPDFQKFWDIDGKRTDEAVISIGRQG |
Ga0310913_103354702 | 3300031945 | Soil | STEFQIALANAGQDPAYLDGPDFQKFWDIDGQRTDEAVIWIGRQG |
Ga0306922_100526891 | 3300032001 | Soil | EIVTTLRAAIGKAVQSNEFQTALTNVGLELAYLDGPDFQKFCDVDGKRTDEAVIAIGRQG |
Ga0318563_104960911 | 3300032009 | Soil | KTALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0318570_101604152 | 3300032054 | Soil | VQSDQFRTALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0318524_100779431 | 3300032067 | Soil | QFKTALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0318524_102889361 | 3300032067 | Soil | EQFKTALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0306924_106995731 | 3300032076 | Soil | RTAVGNAGLELDYLDGPEFQKFWDIDGKRTDEAVIAIGRQG |
Ga0318525_103626031 | 3300032089 | Soil | FRTALANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQG |
Ga0318525_106351372 | 3300032089 | Soil | TEFQIALANAGQDPAYLDGPDFQKFWDIDGQRTDEAVIWIGRQG |
Ga0318519_106088861 | 3300033290 | Soil | TALTNVGLELAYLDGPDFQKFCDVDGKRTDEAVIAIGRQG |
Ga0316624_121391772 | 3300033486 | Soil | GEAFTTVLANAGQELAYLDGPDFQKFWDIDGRRTDEAVISIGRQR |
Ga0314868_006535_1_120 | 3300033758 | Peatland | LANTGQELAYLDGPDFQKFWDIDGERTDEAVKLIGRVQG |
Ga0364927_0044561_3_125 | 3300034148 | Sediment | TAALANAGQELAYLDGPDFQKFWDVDGKRTDEAVIAIGRQ |
⦗Top⦘ |