NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075105

Metagenome / Metatranscriptome Family F075105

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075105
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 39 residues
Representative Sequence MADTTHPLADTRAKSEPGFVRAIGLFDGTMIVVGSMIG
Number of Associated Samples 104
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.64 %
% of genes near scaffold ends (potentially truncated) 98.32 %
% of genes from short scaffolds (< 2000 bps) 88.24 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.479 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(18.487 % of family members)
Environment Ontology (ENVO) Unclassified
(24.370 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.420 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 24.24%    Coil/Unstructured: 75.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF02581TMP-TENI 74.79
PF02786CPSase_L_D2 13.45
PF02785Biotin_carb_C 7.56
PF00364Biotin_lipoyl 1.68
PF05137PilN 0.84
PF11741AMIN 0.84
PF01321Creatinase_N 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0352Thiamine monophosphate synthaseCoenzyme transport and metabolism [H] 74.79
COG3166Type IV pilus assembly protein PilNCell motility [N] 1.68
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.48 %
UnclassifiedrootN/A2.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_100459605All Organisms → cellular organisms → Bacteria → Acidobacteria1245Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101748810All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300002245|JGIcombinedJ26739_100161155All Organisms → cellular organisms → Bacteria2120Open in IMG/M
3300004091|Ga0062387_100081855All Organisms → cellular organisms → Bacteria1675Open in IMG/M
3300004091|Ga0062387_101027534All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300004139|Ga0058897_10933567All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300005174|Ga0066680_10772333All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300005184|Ga0066671_10165873All Organisms → cellular organisms → Bacteria1301Open in IMG/M
3300005187|Ga0066675_10016993All Organisms → cellular organisms → Bacteria4015Open in IMG/M
3300005434|Ga0070709_11795772All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae502Open in IMG/M
3300005437|Ga0070710_10593579All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300005451|Ga0066681_10424651All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae816Open in IMG/M
3300005542|Ga0070732_10371166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae862Open in IMG/M
3300005568|Ga0066703_10852620All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005602|Ga0070762_10364219All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter924Open in IMG/M
3300005718|Ga0068866_10433478All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300005764|Ga0066903_104113513All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300005764|Ga0066903_105860219All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300006059|Ga0075017_101050276All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300006176|Ga0070765_101318131All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300006800|Ga0066660_10730954All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300006871|Ga0075434_101475419All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300006893|Ga0073928_10453107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae928Open in IMG/M
3300006893|Ga0073928_10592607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia784Open in IMG/M
3300006914|Ga0075436_100127516All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1783Open in IMG/M
3300006954|Ga0079219_12162893All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300009012|Ga0066710_102175195All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300009089|Ga0099828_11759857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae545Open in IMG/M
3300009137|Ga0066709_102711423All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300009792|Ga0126374_11155459All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300010046|Ga0126384_10521409All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1028Open in IMG/M
3300010048|Ga0126373_10286321All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1637Open in IMG/M
3300010048|Ga0126373_11761422All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300010320|Ga0134109_10473319All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300010323|Ga0134086_10153214All Organisms → cellular organisms → Bacteria → Acidobacteria842Open in IMG/M
3300010325|Ga0134064_10288503All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300010326|Ga0134065_10516530All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300010339|Ga0074046_10471719All Organisms → cellular organisms → Bacteria → Acidobacteria751Open in IMG/M
3300010343|Ga0074044_10990394All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300010379|Ga0136449_100143527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4711Open in IMG/M
3300011269|Ga0137392_10047146All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3226Open in IMG/M
3300011269|Ga0137392_10785768All Organisms → cellular organisms → Bacteria → Acidobacteria786Open in IMG/M
3300011270|Ga0137391_10785840All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300012189|Ga0137388_10532047All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1092Open in IMG/M
3300012189|Ga0137388_10641942All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter987Open in IMG/M
3300012203|Ga0137399_10306831All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1312Open in IMG/M
3300012203|Ga0137399_10901261All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300012205|Ga0137362_11265338All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300012209|Ga0137379_11185741All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300012357|Ga0137384_11046785All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300012361|Ga0137360_10002802All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10415Open in IMG/M
3300012362|Ga0137361_10669656All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter949Open in IMG/M
3300012363|Ga0137390_11334358All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300012917|Ga0137395_10520081All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300012918|Ga0137396_10576421All Organisms → cellular organisms → Bacteria → Acidobacteria833Open in IMG/M
3300012925|Ga0137419_10116759All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1876Open in IMG/M
3300012927|Ga0137416_10406671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1154Open in IMG/M
3300012964|Ga0153916_11196281All Organisms → cellular organisms → Bacteria → Acidobacteria839Open in IMG/M
3300013306|Ga0163162_11338881All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300013832|Ga0120132_1017617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1239Open in IMG/M
3300014150|Ga0134081_10147874Not Available770Open in IMG/M
3300014150|Ga0134081_10392769All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300014157|Ga0134078_10039836All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1583Open in IMG/M
3300015054|Ga0137420_1395610Not Available4255Open in IMG/M
3300015241|Ga0137418_10020866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6055Open in IMG/M
3300015245|Ga0137409_10655054All Organisms → cellular organisms → Bacteria → Acidobacteria882Open in IMG/M
3300015373|Ga0132257_102090177All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300016294|Ga0182041_10974173All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300017934|Ga0187803_10175800All Organisms → cellular organisms → Bacteria → Acidobacteria843Open in IMG/M
3300018007|Ga0187805_10441945All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300018085|Ga0187772_10830133All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300018090|Ga0187770_10816832Not Available746Open in IMG/M
3300018090|Ga0187770_11614451All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300018482|Ga0066669_11994123All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300019883|Ga0193725_1103750All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300020034|Ga0193753_10187493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae958Open in IMG/M
3300020060|Ga0193717_1051953All Organisms → cellular organisms → Bacteria → Acidobacteria1447Open in IMG/M
3300020579|Ga0210407_10197339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1563Open in IMG/M
3300020579|Ga0210407_10654165All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300020579|Ga0210407_11456206All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300020583|Ga0210401_11340409All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300021181|Ga0210388_11232474All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300021401|Ga0210393_10725405All Organisms → cellular organisms → Bacteria → Acidobacteria810Open in IMG/M
3300021406|Ga0210386_10543686All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1004Open in IMG/M
3300021477|Ga0210398_10672807All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300021478|Ga0210402_10303425All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1478Open in IMG/M
3300025898|Ga0207692_10696971All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300025939|Ga0207665_10093478All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2088Open in IMG/M
3300026306|Ga0209468_1177552All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300026313|Ga0209761_1012133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5586Open in IMG/M
3300027562|Ga0209735_1017840All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1434Open in IMG/M
3300027633|Ga0208988_1158676All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300027846|Ga0209180_10007334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5610Open in IMG/M
3300027855|Ga0209693_10602514All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300030916|Ga0075386_11824907All Organisms → cellular organisms → Bacteria → Acidobacteria1211Open in IMG/M
3300031057|Ga0170834_103304076All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300031668|Ga0318542_10025871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2477Open in IMG/M
3300031668|Ga0318542_10749493All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300031715|Ga0307476_11049759All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300031718|Ga0307474_10080457All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2423Open in IMG/M
3300031736|Ga0318501_10388337All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300031753|Ga0307477_10899417All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300031754|Ga0307475_10206616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1570Open in IMG/M
3300031820|Ga0307473_10174856All Organisms → cellular organisms → Bacteria → Acidobacteria1249Open in IMG/M
3300031835|Ga0318517_10401597All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300031879|Ga0306919_11453267All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300031910|Ga0306923_10178437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2426Open in IMG/M
3300031945|Ga0310913_10300584All Organisms → cellular organisms → Bacteria → Acidobacteria1132Open in IMG/M
3300031946|Ga0310910_10816471All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300032001|Ga0306922_11853298All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300032035|Ga0310911_10485208All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300032055|Ga0318575_10605473All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300032076|Ga0306924_11704844All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300032076|Ga0306924_11957888All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300032094|Ga0318540_10011813All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3437Open in IMG/M
3300032180|Ga0307471_101028536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter990Open in IMG/M
3300032205|Ga0307472_100761691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis879Open in IMG/M
3300032205|Ga0307472_102023975All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300032261|Ga0306920_100524261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1757Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil18.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.56%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.36%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.36%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.52%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.52%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.68%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.68%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.68%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.68%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.84%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.84%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.84%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.84%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.84%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.84%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004139Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10045960513300000364SoilMAEAISKVHGEMAKPEHGFVKAIGLFDGTMIVVGSMIGS
INPhiseqgaiiFebDRAFT_10174881013300000364SoilMADSVLPAVEQAHKDEPGFVRAIGLFDGTMIVVGSMIGSG
JGIcombinedJ26739_10016115533300002245Forest SoilMKDIAEVKTATAPNVARREGGFVRAIGLFDGTMIVVGSMIG
Ga0062387_10008185523300004091Bog Forest SoilMADLPLDIKAQTKTGERSFVQAIGLFDGTMIVVGSMIGSGIFI
Ga0062387_10102753413300004091Bog Forest SoilMADATHSPTQVTRKDEPGFVRAIGLFDGTMIVVGSMIGSG
Ga0058897_1093356743300004139Forest SoilMADTTQAIHEPIVAKQEAGFVRAIGLFDGTMIVVGSMIGS
Ga0066680_1077233313300005174SoilMADTALSAVNPPTKDEPGFVRAIGLFDGTMIVVGSMIGSGV
Ga0066671_1016587313300005184SoilMTDATQVIESRGTTTQEGGFVRAIGLFDGTMIVVGSMIGS
Ga0066675_1001699363300005187SoilMADTTHAMPQSNAKKEAGFVRAIGLFDGTMIVVGSMIGSG
Ga0070709_1179577213300005434Corn, Switchgrass And Miscanthus RhizosphereMADTTTTPITPPATTAAQPGFVRAIGLFDGTMIVVGSMIGSGIF
Ga0070710_1059357923300005437Corn, Switchgrass And Miscanthus RhizosphereMADTTSQVISEQTGRVASEDRGFVRAIGLFDGTMIVVGSMIGS
Ga0066681_1042465113300005451SoilMADATHAIPQSNAKKPTGFVRAIGLFDGTMIVVGSMIGSG
Ga0070732_1037116633300005542Surface SoilMVVTTSALPEQSAKPEHGFVRAIGLFDGTMIVVGS
Ga0066703_1085262013300005568SoilMADTTHAIPQSNAKNEPGFVRAIGLFDGTMIVVGSMIG
Ga0070762_1036421933300005602SoilMSDTAHSVPQAAAKDGPGFVRAIGLFDGTMIVVGSMIGSGIFI
Ga0068866_1043347813300005718Miscanthus RhizosphereMADTTSQVISDQTSRAASEERGFVRAIGLFDGTMIVV
Ga0066903_10411351313300005764Tropical Forest SoilMADSAVPAVATAKKQEPGFVRAIGLFDGTMIVVGSMIGSG
Ga0066903_10586021923300005764Tropical Forest SoilMAESTQAISSASAASEHGFVRAIGLFDGTMIVVGSMI
Ga0075017_10105027623300006059WatershedsMAEAISKVHGEMAKPEHGFVKAIGLFDGTMIVVGSMIGSGI
Ga0070765_10131813123300006176SoilMADITRPLQESTAKNEPGFVRAIGLFDGTMIVVGSMIGSGI
Ga0066660_1073095413300006800SoilMADTALSAVNPPAKDEPGFVRAIGLFDGTMIVVGSMIGSGV
Ga0075434_10147541923300006871Populus RhizosphereMAETALPVTTQTKKEEAGFVRAIGLFDGTMIVVGSMIGSG
Ga0073928_1045310713300006893Iron-Sulfur Acid SpringMTDMAEIKTATASSVARNEAGFVRAIGLFDGTMIVVGSM
Ga0073928_1059260713300006893Iron-Sulfur Acid SpringMADMTTTPIRESGTAVAQGPGFVRALGLFDCTMIVVGSMIGSGIFL
Ga0075436_10012751613300006914Populus RhizosphereMADTTHPFADTRAKSGPGFVRAIGLFDGTMIVVGSMIGSGIF
Ga0079219_1216289323300006954Agricultural SoilMADTTQAIHEPVIAKQEAGFVRAIGLFDGTMIVVGSMIGSG
Ga0066710_10217519523300009012Grasslands SoilMADTIHPLADTRAKSEQGFVRAIGLFDGTMIVVGSMIGS
Ga0099828_1175985713300009089Vadose Zone SoilMADTTRAIPQSNAKNEAGFVRAIGLFDGTMIVVGSMIG
Ga0066709_10271142313300009137Grasslands SoilMRLQAEDWRMAEAAHPIPQGSAKSEDGFVRAIGLFDGTMIVVG
Ga0126374_1115545923300009792Tropical Forest SoilMAEASIVTPAQGHKTEHEFVRAIGLFDGTMIVVGSMIG
Ga0126384_1052140913300010046Tropical Forest SoilMAETALPVTAQNRNEEAGFVRAIGLFDGTMIVVGSMI
Ga0126373_1028632113300010048Tropical Forest SoilMADAINVSTLPASKPKHEFVKAIGLFDGTMIVAGSMIG
Ga0126373_1176142213300010048Tropical Forest SoilMAETALPVTAQNRKEEAGFVRAIGLFDGTMIVVGSMIG
Ga0134109_1047331923300010320Grasslands SoilMADTTHPLADTGAKSEPGFVRAIGLFDGTMIVVGSM
Ga0134086_1015321413300010323Grasslands SoilMAESTPAIPSAGATSEHGFVRAIGLFDGTMIVVGSMIGSGIF
Ga0134064_1028850313300010325Grasslands SoilVADTTQAVSSASAASEPGFVRAIGLFDGTMIVVGSMIGS
Ga0134065_1051653013300010326Grasslands SoilMADTTHAIPQSNAKNEPGFVRAIGMFDGTMIVVGSMIGS
Ga0074046_1047171913300010339Bog Forest SoilMVDTSHPLPQRTTKNEPGFVRAIGLFDGTMIVVGSMIGS
Ga0074044_1099039413300010343Bog Forest SoilMPESSTVHSTPDAKTEHGFVRAIGLFDGTMIVVGSMIGSGI
Ga0136449_10014352733300010379Peatlands SoilMTDTTRTLPPGSTKSDPGFVRAIGLFDGTMIVVGSMIGS*
Ga0137392_1004714653300011269Vadose Zone SoilMAETAHPAVILSKKDEPGFVRAIGLFDGTMIVVGSMI
Ga0137392_1078576823300011269Vadose Zone SoilMADSALPAVKPAKKDEPGFIRAIGLFDGTMIVVGSMIG
Ga0137391_1078584013300011270Vadose Zone SoilMADTTHPLADTRAKSEPGFVRAIGLFDGTMIVVGSM
Ga0137388_1053204713300012189Vadose Zone SoilMADTTQAIHEPVAVKQEGGFVRAIGLFDGTMIVVGSMIGS
Ga0137388_1064194213300012189Vadose Zone SoilMVDTTHPVAESRAKSEPGFVRAIGLFDGTMIVVGS
Ga0137399_1030683133300012203Vadose Zone SoilMADTTHAIPQSNPKNEPGFVRAIGLFDGTMIVVGS
Ga0137399_1090126123300012203Vadose Zone SoilMADTRQPLAASSTKNEPGFVRALGLFDGTMIVVGSMIGSGIY
Ga0137362_1126533813300012205Vadose Zone SoilMRLRAEDWRMAEAAHPIPQGSAKSEHGFVRAIGLFDGTM
Ga0137379_1118574113300012209Vadose Zone SoilMRLRAEDWRMAEAAHPIPQGSAKSEHGFVRAIGLFDGT
Ga0137384_1104678513300012357Vadose Zone SoilMRLRAEDWRMAEAAHPIPQGSAKSEHGFVRAIGLFDGTMIVVGSMI
Ga0137360_1000280213300012361Vadose Zone SoilMADTTHPLSQAPVKSEPGFVRAIGLFDGTMIVVGSMI
Ga0137361_1066965633300012362Vadose Zone SoilMADTTQAIHEPVVAKQEAGFVRAIGLFDGTMIVVGSMI
Ga0137390_1133435813300012363Vadose Zone SoilMADTTHAVPQCNAKNEPGFVRAIGLFDGTMIVVGSMIGSGIF
Ga0137395_1052008123300012917Vadose Zone SoilMADTTPAIPQSKTKNEPGFVRAIGLFDGTMIVVGSMIGSGIF
Ga0137396_1057642113300012918Vadose Zone SoilMADTAHPLSTTSAKKEPGFVRALGLFDGTMIVVGSMIGSGI
Ga0137419_1011675913300012925Vadose Zone SoilMADTAHPLADTRAKSEAGFVRAIGLFDGTMIVVGSMIGS
Ga0137416_1040667133300012927Vadose Zone SoilMVETTHPLADTRAKSEPGFVRAIGLFDGTMIVVGSMIGSG
Ga0153916_1119628113300012964Freshwater WetlandsMADTGQTVSPAVGGEDGGFVRAIGLFDGTMIVVGSMI
Ga0163162_1133888123300013306Switchgrass RhizosphereMAETALPVTPQNQKEEAGFVRAIGLFDGTMIVVGSMIGS
Ga0120132_101761713300013832PermafrostMADRPTPATTPVIANVARSEGGFVRAIGLFDGTMMVAGSMIGSGI
Ga0134081_1014787413300014150Grasslands SoilMADATHAIPQSNAKKPTGFVRAIGLFDGTMIVVGSMIGS
Ga0134081_1039276923300014150Grasslands SoilMVDTTHPLGDTRTKSEPGFVRAIGLFDGTMIVVGSMI
Ga0134078_1003983613300014157Grasslands SoilMADTTHPLADTRTKSEPGFVRAIGLFDGTMIVVGSM
Ga0137420_1395610103300015054Vadose Zone SoilMADATQTIQQPVAAKQEAGFVRAIGLLTDTMIVVGSMIG
Ga0137418_1002086613300015241Vadose Zone SoilMADTTHPLADTRAKSEPGFVRAIGLFDGTMIVVGSMIG
Ga0137409_1065505413300015245Vadose Zone SoilMSDTAHPLSTTSTKKEPGFVRALGLFDGTMIVVGSMIGS
Ga0132257_10209017713300015373Arabidopsis RhizosphereMAETALPVTAQNRKEETGFVRAIGLFDGTMMVVGS
Ga0182041_1097417323300016294SoilMAETALPVAAPQKKEETGFVRAIGLFDGTMIVVGSMIGSG
Ga0187803_1017580023300017934Freshwater SedimentMADTTQPLPQAPVKSEPGFVRAIGLFDGTMIVVGSMIGSG
Ga0187805_1044194513300018007Freshwater SedimentMAESSSLSSTQAVKTEHQFVRAIGLFDGTMIVVGSMIG
Ga0187772_1083013313300018085Tropical PeatlandMAETTSVVSTQVPQTEHGFVRAIGLFDGTMIVVGSMIG
Ga0187770_1081683213300018090Tropical PeatlandMADSTTASPPQGAKAERGFVRAIGLFDGTMIVAGSMIG
Ga0187770_1161445123300018090Tropical PeatlandMAETSSAVTAAVGKHAEHEFVRAIGLYDGTMIVVGSMIGS
Ga0066669_1199412313300018482Grasslands SoilMAESTPAIPSAGAASEHGFVRAIGLFDGTMIVVGSMIGS
Ga0193725_110375013300019883SoilMAETAPPAVILSKKDEPGFVRAIGLFDGTMIVVGSMI
Ga0193753_1018749313300020034SoilMTDMAEIKPTTATSASSLARSEGGFVRAIGLFDGTMIVVGSMI
Ga0193717_105195313300020060SoilMADTPSTRAVPGKSGEAGFVRAIGLFDGTMIVVGSM
Ga0210407_1019733913300020579SoilMAEIVRPAVLDHSQKDEPGFVRAIGLFDGTMIVVGSMIG
Ga0210407_1065416513300020579SoilMADTTHSLPQSPTKNEPGFVRAIGLFDGTMIVVGSMIGSGI
Ga0210407_1145620613300020579SoilMVDTTHPLADTSAKSGPGFVRAIGLFDGTMIVVGSMIG
Ga0210401_1134040923300020583SoilMADISHPLPPNSTRSDPGFVRAIGLFDGTMIVVGSMIGSGIF
Ga0210388_1123247413300021181SoilMADLPLEIQAQTKSGARGFVQAIGLFDGTMIVVGSMIGSG
Ga0210393_1072540513300021401SoilMADTTHSLPQTPTKNEPGFVRAIGLFDGTMIVVGSMIGSGI
Ga0210386_1054368633300021406SoilMADTTHPLPQTPAKSEPGFVRAIGLFDGTMIVVGSMNG
Ga0210398_1067280723300021477SoilMAESTTVPNTPATKSEHQFVRAIGLFDGTMIVVGSM
Ga0210402_1030342533300021478SoilMRLLSEAQRMADTTNPATQSAAKSEPGFVRAIGLFDGTMIVVGSMI
Ga0207692_1069697113300025898Corn, Switchgrass And Miscanthus RhizosphereMADTTSQVISEQTGRVASEDRGFVRAIGLFDGTMIVVGSMIGSG
Ga0207665_1009347813300025939Corn, Switchgrass And Miscanthus RhizosphereMADTALSAVNPPAKDEPGFVRAIGLFDGTMIVVGSMIG
Ga0209468_117755213300026306SoilMAESTQAISSVSAASEHGFVRAIGLFDGTMIVVGSMIGSG
Ga0209761_101213363300026313Grasslands SoilMADTTHVIPQSNAKNEPGFVRAIGLFDGTMIVVGSM
Ga0209735_101784033300027562Forest SoilMIDRAEIKPATASSVARSEGGFVRAIGLFDGTMIVVGSMIGSGI
Ga0208988_115867623300027633Forest SoilMADTTQVIHEPVAVKQEGGFVRAIGLFDGTMIVVGSM
Ga0209180_1000733413300027846Vadose Zone SoilMADTTHPLPQAPVKSEPGFVRAIGLFDGTMIVVGSM
Ga0209693_1060251413300027855SoilMAESSIAIPSQGTKSEHGFVRAIGLFDGTMIVVGSMI
Ga0075386_1182490733300030916SoilMAEAISKVHGEMAKAEHGFVKAIGLFDGTMIVVGSMIGS
Ga0170834_10330407613300031057Forest SoilMTDMAEIKTATASSVVRSEGGFVRAIGLFDGTMIVVGSMI
Ga0318542_1002587113300031668SoilMAESTQAIRSVNAASEGGFVRAIGLFDGTMIVVGSMIGSGI
Ga0318542_1074949313300031668SoilMADTISVTQEQVTKTEHGFVRAIGLFDGTMIVVGSM
Ga0307476_1104975923300031715Hardwood Forest SoilMAEASIVTPAPGHKTEREFVRAIGLFDGTMIVVGSMIG
Ga0307474_1008045743300031718Hardwood Forest SoilMAEASIVTPAPGHKTEREFVRAIGLFDGTMIVVGSMIGSGI
Ga0318501_1038833713300031736SoilMAESTQAIRSVSAASERGFVRAIGLFDGTMIVVGSMIGS
Ga0307477_1089941713300031753Hardwood Forest SoilMADTTQAIQEPVALKQEAGFVRAIGLFDGTMIVVG
Ga0307475_1020661633300031754Hardwood Forest SoilMADTTQAIHEPVVAKQEAGFVRAIGLFDGTMIVVGSM
Ga0307473_1017485633300031820Hardwood Forest SoilMVDTTQAIQEPVVAKHEAGFVRAIGLFDGTMIVVGSMIGS
Ga0318517_1040159723300031835SoilMAESTQAIRSVSAASERGFVRAIGLFDGTMIVVGSMIGSGIF
Ga0306919_1145326723300031879SoilMAETVLPVAAQQKKEETGFVRAIGLFDGTMIVVGSMIGS
Ga0306923_1017843743300031910SoilMAETALPVAAPQKKEETGFVRAIGLFDGTMIVVGS
Ga0310913_1030058413300031945SoilMAEASIVTAAQGHKTQHEFVRAIGLFDGTMIVVGSMIGS
Ga0310910_1081647123300031946SoilMAETTSAVATPVSKSEHHFVRAIGLFDGTMIVVGSMIGSGIF
Ga0306922_1185329823300032001SoilMAEAISKVHGEMAKAEHGFVKAIGLFDGTMIVVGSMIGSG
Ga0310911_1048520813300032035SoilMAEASIVAPAQDHKTGHEFVRAIGLFDGTMIVVGSMIG
Ga0318575_1060547323300032055SoilMAETTSAVATPVSKSEHHFVRAIGLFDGTMIVVGSMIGSGIFI
Ga0306924_1170484423300032076SoilMAESTQAISSVSATSERGFVRAIGLFDGTMIVVGSMIG
Ga0306924_1195788813300032076SoilMAEASIVTPVQGHKTEHQFVRAIGLFDGTMMVVGS
Ga0318540_1001181353300032094SoilMAEASIVTPAQGQKTQHEFVRAIGLFDGTMIVVGSMIG
Ga0307471_10102853613300032180Hardwood Forest SoilMADTTQPLAAGSAKNEPGVVRASGLFDGTMSVVGSMIGSG
Ga0307472_10076169133300032205Hardwood Forest SoilMADTNATTQSQTLRSEAGFVRAIGLFDGTMIVVGSMIGS
Ga0307472_10202397523300032205Hardwood Forest SoilMAESTSAQLTQDTKTEHGFVRAIGLFDGTMIVVGSMIGSGIF
Ga0306920_10052426113300032261SoilMAEASIVTAAQGHKTQHEFVRAIGLFDGTMIVVGSMIGSG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.