| Basic Information | |
|---|---|
| Family ID | F075087 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MTNSINILLMVLAVNACVLAVAFVALYRLNKAVDQFDR |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.60 % |
| % of genes near scaffold ends (potentially truncated) | 10.08 % |
| % of genes from short scaffolds (< 2000 bps) | 78.99 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.395 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (21.849 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.185 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF01557 | FAA_hydrolase | 1.68 |
| PF06823 | DUF1236 | 0.84 |
| PF07690 | MFS_1 | 0.84 |
| PF05050 | Methyltransf_21 | 0.84 |
| PF00557 | Peptidase_M24 | 0.84 |
| PF00355 | Rieske | 0.84 |
| PF06202 | GDE_C | 0.84 |
| PF00903 | Glyoxalase | 0.84 |
| PF03942 | DTW | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG3148 | tRNA U47 aminocarboxypropyltransferaseTapT/TuaA/ YfiP, DTW domain | Translation, ribosomal structure and biogenesis [J] | 0.84 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.39 % |
| Unclassified | root | N/A | 12.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10084298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100715512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 880 | Open in IMG/M |
| 3300004633|Ga0066395_10135441 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300005332|Ga0066388_101170522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1311 | Open in IMG/M |
| 3300005531|Ga0070738_10006120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12797 | Open in IMG/M |
| 3300005533|Ga0070734_10114436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 1578 | Open in IMG/M |
| 3300005552|Ga0066701_10427476 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300005764|Ga0066903_100003512 | All Organisms → cellular organisms → Bacteria | 12855 | Open in IMG/M |
| 3300005764|Ga0066903_100089589 | All Organisms → cellular organisms → Bacteria | 4078 | Open in IMG/M |
| 3300005764|Ga0066903_100445417 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
| 3300005764|Ga0066903_100510006 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
| 3300005764|Ga0066903_100656758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1835 | Open in IMG/M |
| 3300005764|Ga0066903_101927513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
| 3300005764|Ga0066903_104535695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300006041|Ga0075023_100072573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1133 | Open in IMG/M |
| 3300006047|Ga0075024_100022179 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
| 3300006047|Ga0075024_100548734 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300006050|Ga0075028_100182693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1124 | Open in IMG/M |
| 3300006057|Ga0075026_100087219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1530 | Open in IMG/M |
| 3300006178|Ga0075367_10657601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300007255|Ga0099791_10003841 | All Organisms → cellular organisms → Bacteria | 6136 | Open in IMG/M |
| 3300007258|Ga0099793_10065263 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300007788|Ga0099795_10073346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1296 | Open in IMG/M |
| 3300009038|Ga0099829_10025919 | All Organisms → cellular organisms → Bacteria | 4109 | Open in IMG/M |
| 3300009038|Ga0099829_10087995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2393 | Open in IMG/M |
| 3300009038|Ga0099829_11453156 | Not Available | 566 | Open in IMG/M |
| 3300009089|Ga0099828_10493807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1104 | Open in IMG/M |
| 3300009090|Ga0099827_11413617 | Not Available | 606 | Open in IMG/M |
| 3300009143|Ga0099792_10048366 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300009143|Ga0099792_11135354 | Not Available | 528 | Open in IMG/M |
| 3300009523|Ga0116221_1094814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1324 | Open in IMG/M |
| 3300009792|Ga0126374_10079571 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300009792|Ga0126374_10134993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1469 | Open in IMG/M |
| 3300009792|Ga0126374_10880946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300009792|Ga0126374_11534457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300009792|Ga0126374_11824173 | Not Available | 509 | Open in IMG/M |
| 3300009826|Ga0123355_10323683 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300010043|Ga0126380_10431146 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300010043|Ga0126380_10522776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300010043|Ga0126380_11339283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300010046|Ga0126384_10007080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6885 | Open in IMG/M |
| 3300010046|Ga0126384_11054237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300010048|Ga0126373_10797860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1006 | Open in IMG/M |
| 3300010358|Ga0126370_10166255 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| 3300010358|Ga0126370_10458921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1065 | Open in IMG/M |
| 3300010359|Ga0126376_11681135 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300010360|Ga0126372_11236616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300010360|Ga0126372_12220523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300010361|Ga0126378_10012920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6936 | Open in IMG/M |
| 3300010362|Ga0126377_10240088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1759 | Open in IMG/M |
| 3300010376|Ga0126381_100399977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1913 | Open in IMG/M |
| 3300010376|Ga0126381_101174576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1109 | Open in IMG/M |
| 3300010398|Ga0126383_12282241 | Not Available | 627 | Open in IMG/M |
| 3300012096|Ga0137389_10430049 | Not Available | 1129 | Open in IMG/M |
| 3300012189|Ga0137388_10070465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2911 | Open in IMG/M |
| 3300012189|Ga0137388_10461414 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300012202|Ga0137363_10303056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1312 | Open in IMG/M |
| 3300012362|Ga0137361_11643692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300012677|Ga0153928_1056816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300012925|Ga0137419_10461174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1003 | Open in IMG/M |
| 3300012948|Ga0126375_10457268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 940 | Open in IMG/M |
| 3300012971|Ga0126369_10276897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1666 | Open in IMG/M |
| 3300012971|Ga0126369_12028924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300016357|Ga0182032_11245336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300017822|Ga0187802_10271082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300017932|Ga0187814_10051880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1510 | Open in IMG/M |
| 3300017932|Ga0187814_10086992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1149 | Open in IMG/M |
| 3300017955|Ga0187817_10381069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 900 | Open in IMG/M |
| 3300017970|Ga0187783_10071435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2554 | Open in IMG/M |
| 3300017970|Ga0187783_10299451 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300017970|Ga0187783_10314678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1141 | Open in IMG/M |
| 3300017970|Ga0187783_11137239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300017972|Ga0187781_10833198 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300018058|Ga0187766_10551952 | Not Available | 781 | Open in IMG/M |
| 3300018058|Ga0187766_11438882 | Not Available | 507 | Open in IMG/M |
| 3300018060|Ga0187765_10160408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1275 | Open in IMG/M |
| 3300018060|Ga0187765_11092015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300018089|Ga0187774_10666767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300020140|Ga0179590_1161750 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300020581|Ga0210399_11088541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300020582|Ga0210395_10388953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
| 3300021170|Ga0210400_10635661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
| 3300021178|Ga0210408_11161416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300021401|Ga0210393_11154817 | Not Available | 624 | Open in IMG/M |
| 3300021476|Ga0187846_10282066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300021476|Ga0187846_10366388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300021560|Ga0126371_10127284 | All Organisms → cellular organisms → Bacteria | 2580 | Open in IMG/M |
| 3300021560|Ga0126371_13101009 | Not Available | 562 | Open in IMG/M |
| 3300022528|Ga0242669_1039079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300022722|Ga0242657_1189751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300024288|Ga0179589_10053491 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300026341|Ga0257151_1000010 | All Organisms → cellular organisms → Bacteria | 7731 | Open in IMG/M |
| 3300026446|Ga0257178_1031180 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300026475|Ga0257147_1075147 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026481|Ga0257155_1010983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1213 | Open in IMG/M |
| 3300026515|Ga0257158_1000882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3465 | Open in IMG/M |
| 3300026515|Ga0257158_1135003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300026551|Ga0209648_10079904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2732 | Open in IMG/M |
| 3300026551|Ga0209648_10268129 | Not Available | 1250 | Open in IMG/M |
| 3300027655|Ga0209388_1001633 | All Organisms → cellular organisms → Bacteria | 5307 | Open in IMG/M |
| 3300027826|Ga0209060_10013999 | All Organisms → cellular organisms → Bacteria | 4479 | Open in IMG/M |
| 3300027826|Ga0209060_10087415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1464 | Open in IMG/M |
| 3300027846|Ga0209180_10072772 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
| 3300027846|Ga0209180_10503576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300027862|Ga0209701_10311398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300027874|Ga0209465_10038920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2258 | Open in IMG/M |
| 3300027874|Ga0209465_10207582 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300027894|Ga0209068_10348718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 838 | Open in IMG/M |
| 3300027903|Ga0209488_10076795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2482 | Open in IMG/M |
| 3300027903|Ga0209488_10235542 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300027903|Ga0209488_11021586 | Not Available | 571 | Open in IMG/M |
| 3300027915|Ga0209069_10469341 | Not Available | 703 | Open in IMG/M |
| 3300028047|Ga0209526_10031899 | All Organisms → cellular organisms → Bacteria | 3702 | Open in IMG/M |
| 3300031573|Ga0310915_11205359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300031715|Ga0307476_11050507 | Not Available | 599 | Open in IMG/M |
| 3300031720|Ga0307469_10012157 | All Organisms → cellular organisms → Bacteria | 4292 | Open in IMG/M |
| 3300031823|Ga0307478_11278626 | Not Available | 610 | Open in IMG/M |
| 3300031890|Ga0306925_10440195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1394 | Open in IMG/M |
| 3300032261|Ga0306920_102105705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 21.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.24% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.40% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.36% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.68% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.68% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.84% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.84% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.84% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012677 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaG | Host-Associated | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026341 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100842982 | 3300000597 | Forest Soil | MTNSLTILLWVLAVNAGVLGLAFMALYRLNKAVDRFDR* |
| JGIcombinedJ26739_1007155122 | 3300002245 | Forest Soil | MSNANLNILLMVVAINVCVLGVAFFALYRLNKAVDQFDR* |
| Ga0066395_101354412 | 3300004633 | Tropical Forest Soil | MTNSLNILLMVLAVNASVLAVAFAALYGLNKGVDQFDRESGLR* |
| Ga0066388_1011705223 | 3300005332 | Tropical Forest Soil | VTMANINILLMVIAVNVCVLGVAFIALYRLNKAVDRFDG* |
| Ga0070738_100061206 | 3300005531 | Surface Soil | MTNSMNILLMVLAVNACVLGLAFVALYRLNKAVDQFDR* |
| Ga0070734_101144362 | 3300005533 | Surface Soil | MTNNIQILLMVIAVNACVLGLACLALYGLNRAVDQFDR* |
| Ga0066701_104274762 | 3300005552 | Soil | MTNSINILLMVLAVNGCVLAVACFALYRLNKAVDQFDR* |
| Ga0066903_1000035123 | 3300005764 | Tropical Forest Soil | MSNSVNILLMVLAVNGFVLAVVFAALYRMNKAVDRFDH* |
| Ga0066903_1000895894 | 3300005764 | Tropical Forest Soil | MDNLNILLMVIAVNLCVLGIAFFALYRLNKAVDQFDR* |
| Ga0066903_1004454173 | 3300005764 | Tropical Forest Soil | MTNSLNILLMVLAVNACVLGVAFVALYRLNKVVDQFDR* |
| Ga0066903_1005100062 | 3300005764 | Tropical Forest Soil | MTNSLNILLMVLAVNGSVLGAAFIALYGLNRVVDKFDH* |
| Ga0066903_1006567582 | 3300005764 | Tropical Forest Soil | VDNFNILLMVIAVNACVLAVAFYALYRLNKAVDKFDR* |
| Ga0066903_1019275132 | 3300005764 | Tropical Forest Soil | MTDSMNILLMVLAVNACVLGVAFIALYRLNKSVDQFDR* |
| Ga0066903_1045356952 | 3300005764 | Tropical Forest Soil | MTNSMNILLMVLAVNGFVLAVAFAALYRLNKTVDRYDH* |
| Ga0075023_1000725732 | 3300006041 | Watersheds | MTDNINILLMVIAVNVFVLGVAFIALYRLNKAVDEVDR* |
| Ga0075024_1000221794 | 3300006047 | Watersheds | MTDNINILLMVIAVNVSVLGLAFIALYRLNKAVDEVDR* |
| Ga0075024_1005487342 | 3300006047 | Watersheds | MDNLNILLMVIAVNVFVLGVAFIALYRLNKAVDEVDH* |
| Ga0075028_1001826932 | 3300006050 | Watersheds | MDNLNILLMVIAVNVFVLGLAYIALYRLNKAVDEVDR* |
| Ga0075026_1000872192 | 3300006057 | Watersheds | MDNLNILLMVIAVNVFVLGVAFIALYRLNKAVDEVDR* |
| Ga0075367_106576012 | 3300006178 | Populus Endosphere | MTNNIEILLMVIAVNGCVLGLACLALWRLNRAVDGFDR* |
| Ga0099791_100038413 | 3300007255 | Vadose Zone Soil | MSNSINILLMVLAVNACVLAVACVALYRLNKAVDQFDR* |
| Ga0099793_100652632 | 3300007258 | Vadose Zone Soil | MTNSINILLMVLAVNACVLAVACAALYRLNKAVDQFDR* |
| Ga0099795_100733462 | 3300007788 | Vadose Zone Soil | MTNSINILLMVLAVNGCVLAVAFAALYRLNRAVDQFDR* |
| Ga0099829_100259193 | 3300009038 | Vadose Zone Soil | MSNSINILLMVLAVNACVLTVACAALYRLNKAVDQFDR* |
| Ga0099829_100879953 | 3300009038 | Vadose Zone Soil | MNNSINILLMVLAVNACVLAVAFIALYRLNKAVDQFDR* |
| Ga0099829_114531562 | 3300009038 | Vadose Zone Soil | MSNNINILLMVLAVNAFVLAVAFIALYRLNRAVDQFDR* |
| Ga0099828_104938072 | 3300009089 | Vadose Zone Soil | MSNSINILLMVLAVNAVVLAVASIALYRLNKAVDQFDR* |
| Ga0099827_114136172 | 3300009090 | Vadose Zone Soil | MSNSINILLMVLAVNACVLAVACAALYRLNKAVDQFDR* |
| Ga0099792_100483663 | 3300009143 | Vadose Zone Soil | MSNSINILLMVLAVNAFVLAVAFIALYRLNKAVDRFDR* |
| Ga0099792_111353542 | 3300009143 | Vadose Zone Soil | MTNSINILLMVLAVNAVVLAVASVALYRLNKAVDRFDR* |
| Ga0116221_10948142 | 3300009523 | Peatlands Soil | MQGFQILLLVIAVASCVLGVAFLGAYRLNKAVDQCDR* |
| Ga0126374_100795713 | 3300009792 | Tropical Forest Soil | MTNSLNILLMVLAVNGVVLAVAFAALYRLNKAVDQFDR* |
| Ga0126374_101349932 | 3300009792 | Tropical Forest Soil | MNILLMVLAVNGFVLAVAFAALYRLNKTVDRYDH* |
| Ga0126374_108809462 | 3300009792 | Tropical Forest Soil | MTNSLNILLMVLAVNAGVLGVAFVALYRLNKAVDQFDR* |
| Ga0126374_115344572 | 3300009792 | Tropical Forest Soil | MTNSINILLMVLAVNASVLAVAVIALYRLNKAVDQFDR* |
| Ga0126374_118241731 | 3300009792 | Tropical Forest Soil | MANINILLMVIAVNVCVLGVAFIALYRLNKAVDRFDG* |
| Ga0123355_103236832 | 3300009826 | Termite Gut | MTNSMNILLMVLAVNACVLTAAVFGLYFLNKSVEQSDR* |
| Ga0126380_104311462 | 3300010043 | Tropical Forest Soil | MTNSLNILLMVLAVNACVLSVAFVALYRLNKAVDQFDR* |
| Ga0126380_105227762 | 3300010043 | Tropical Forest Soil | MANINILLMVIAVNVCVLGVAFMALYRLNKAVDRFDG* |
| Ga0126380_113392831 | 3300010043 | Tropical Forest Soil | MTNSLNILLMVLAVNGIVLAVAFAALYRLNGAVDQFDR* |
| Ga0126384_100070806 | 3300010046 | Tropical Forest Soil | MTNSLNILLMVLAVNGCVLGAAFIALYGLNRVVDKFDH* |
| Ga0126384_110542372 | 3300010046 | Tropical Forest Soil | MTNSLNILLMVLAVNGVVLAVAFAALYRLNRAVDQFDR* |
| Ga0126373_107978601 | 3300010048 | Tropical Forest Soil | MTNSINILLMVLAVNACVLGVAFIALYRLNKAVDRFDR* |
| Ga0126370_101662553 | 3300010358 | Tropical Forest Soil | MTNSINILLMVLVVNACVLGVAFIALYRLNKAVDRFDR* |
| Ga0126370_104589212 | 3300010358 | Tropical Forest Soil | VDNFNILLMVIAVNACVLAVAFSALYRLNKAVDKFDR* |
| Ga0126376_116811352 | 3300010359 | Tropical Forest Soil | SQEWCPMTNSLNILLMVLAVNGVVLAVAFAALYRLNKAVDQFDR* |
| Ga0126372_112366162 | 3300010360 | Tropical Forest Soil | MTNSLNILLMVLAVNACVLGVAFVALYRLNRAVDQFDR* |
| Ga0126372_122205232 | 3300010360 | Tropical Forest Soil | MTNSLNILLMVLAVNAVVLAVAFAALYRLNKAVDQFDR* |
| Ga0126378_100129202 | 3300010361 | Tropical Forest Soil | MTNSMNILLMVLAVNGLVLAVAFAALYRLNKTVDRYDH* |
| Ga0126377_102400883 | 3300010362 | Tropical Forest Soil | MTNSINILLIVLAVNASVLAVAVFALYRLNKAVDQFDR* |
| Ga0126381_1003999771 | 3300010376 | Tropical Forest Soil | MTNNIEILLMVVAVSACVLSLAFIALYRLNKAVDEFDR* |
| Ga0126381_1011745762 | 3300010376 | Tropical Forest Soil | MTNNIEILLMVIAVNAGVLGLAGLALWRLNRAVDGLDRSPD* |
| Ga0126383_122822412 | 3300010398 | Tropical Forest Soil | MTNSINILLWVLAVNASVLGVAFIALYGLNKAVDQFDR* |
| Ga0137389_104300492 | 3300012096 | Vadose Zone Soil | MNNSINILLMVLAVNAGVLAVGFIALYRLNKAVDRFDR* |
| Ga0137388_100704654 | 3300012189 | Vadose Zone Soil | MTNSINILLMVLAVNAVVLAVASIALYRLNKAVDQFDR* |
| Ga0137388_104614143 | 3300012189 | Vadose Zone Soil | MSNSINILLMVLAVNAGVLAVGFIALYRLNTAVDRFDR* |
| Ga0137363_103030562 | 3300012202 | Vadose Zone Soil | MTNSINILLMVLAVNACVLAVACVALYRLNKAVDQFDR* |
| Ga0137361_116436921 | 3300012362 | Vadose Zone Soil | MSNSINILLMVLAVNACVLAIACAALYRLNKAVDQFDR* |
| Ga0153928_10568161 | 3300012677 | Attine Ant Fungus Gardens | MATNSIEILLAVIAVNAVVLAIAAFGLYRLNKAVDAFDH* |
| Ga0137419_104611741 | 3300012925 | Vadose Zone Soil | SNSINILLMVLAVNGCVLAVAFAALYRLNRAVDQFDR* |
| Ga0126375_104572682 | 3300012948 | Tropical Forest Soil | MENFNILLMVIAVNLCVLGIAFFALYRLNKAVDQFDR* |
| Ga0126369_102768971 | 3300012971 | Tropical Forest Soil | MTNSINILLMVLSINACVLGVAFVALYRLNKAVDQFDR* |
| Ga0126369_120289242 | 3300012971 | Tropical Forest Soil | MTNSVQILLLVLAVNAFVLGVASFALYRLNKAVDQFDH* |
| Ga0182032_112453362 | 3300016357 | Soil | MENFNILLMVIAVNLCVLGIAFFALYRLNKAVEEFDH |
| Ga0187802_102710821 | 3300017822 | Freshwater Sediment | MTNSMNILLMVLAVNACVLGLAFVALYRLNKAVDQFDR |
| Ga0187814_100518802 | 3300017932 | Freshwater Sediment | MTNSVEILLMVIVVNAVVLTVAGFALYRLNKAVDAFDR |
| Ga0187814_100869922 | 3300017932 | Freshwater Sediment | MTNSMNILLMVLAVNACVLALAFVALYRLNKAVDQFDR |
| Ga0187817_103810692 | 3300017955 | Freshwater Sediment | MTNSMNILLMVLAVNACVLALAFVARYRLDKAVDQFDR |
| Ga0187783_100714353 | 3300017970 | Tropical Peatland | MTNSVNILLMVLAVNACVLGVAVVALYCLNRAVDQFDNKAVDQFDR |
| Ga0187783_102994512 | 3300017970 | Tropical Peatland | MTNSMNILLMVLAVNACVLGVAFAALYGLNKAVDQFDR |
| Ga0187783_103146782 | 3300017970 | Tropical Peatland | MTNSINILLMVLAVNACVLAVAFVALYRLNKAVDQFDR |
| Ga0187783_111372391 | 3300017970 | Tropical Peatland | MTNNIEILLMVIAVNASVLGLACIALYGLNRAVDGFDR |
| Ga0187781_108331981 | 3300017972 | Tropical Peatland | SVIMTNSINILLMVLAVNACVLAVAFVALYRLNKAVDQFDR |
| Ga0187766_105519522 | 3300018058 | Tropical Peatland | MTNSLNILLMVLAVNGVVLAVAFAALYRLNSAVDQFDR |
| Ga0187766_114388822 | 3300018058 | Tropical Peatland | MTNSMNILLMVLAVNACVLGLAVIALYRLNKAVDQFDR |
| Ga0187765_101604081 | 3300018060 | Tropical Peatland | MTNSINILLMVLAVNGSVLAIAVLALYRLNKAVDQFDR |
| Ga0187765_110920152 | 3300018060 | Tropical Peatland | MTNSMNILLMVLAVNACVLGLAVIALYRLNRAVDQFDR |
| Ga0187774_106667672 | 3300018089 | Tropical Peatland | MTNSVNILLMVLAVNACVLSLACVALYRLNKAVDQFDR |
| Ga0179590_11617502 | 3300020140 | Vadose Zone Soil | MSNSINILLMVLAVNACVLAVACAALYRLNKAVDQFDR |
| Ga0210399_110885412 | 3300020581 | Soil | MSNSINILLMVLAVNACVLGIGFIALYRLNKGVDQFDR |
| Ga0210395_103889532 | 3300020582 | Soil | MTNSINILLMVLSINACVLGVAFVALYRLNKAVDQFDR |
| Ga0210400_106356612 | 3300021170 | Soil | MSNSINILLMVLAVNACVLGIGFTALYRLNKGVDQFDR |
| Ga0210408_111614162 | 3300021178 | Soil | MSNNIEILLMVIAVNVCVLGVAFIALYRLNKAADQFDR |
| Ga0210393_111548171 | 3300021401 | Soil | MTNSVEILLAVIAVNVVVLAIAAFGLYRLNKAVDAFDH |
| Ga0187846_102820662 | 3300021476 | Biofilm | MTNSMNILLMVLAVNACVLGVAFVALYGLNKAVDQVDR |
| Ga0187846_103663882 | 3300021476 | Biofilm | MSNSLNILLMVLAVNGVVLAVAFGALYRLNRAVDQ |
| Ga0126371_101272842 | 3300021560 | Tropical Forest Soil | MSNSVNILLMVLAVNGFVLAVVFAALYRMNKAVDRFDH |
| Ga0126371_131010092 | 3300021560 | Tropical Forest Soil | MTNSMNILLMVLAVNGFVLAVAFAALYRLNKTVDRYDH |
| Ga0242669_10390792 | 3300022528 | Soil | MTNSVEILLMVVAVNAVVLAVAAFGLYRLNKAVDAFDH |
| Ga0242657_11897511 | 3300022722 | Soil | MTNSLNILLMVLAVNGIVLAVAFAALYRLNRAVDQFDR |
| Ga0179589_100534912 | 3300024288 | Vadose Zone Soil | MTNSINILLMVLAVNGCVLAVAFAALYRLNRAVDQFDR |
| Ga0257151_10000106 | 3300026341 | Soil | MSNNIEILLMVIAVNVCVLGVAFIALYRLNRAADQFDR |
| Ga0257178_10311802 | 3300026446 | Soil | QERAPMSNSINILLMVLAVNACVLAVACAALYRLNKAVDQFDR |
| Ga0257147_10751471 | 3300026475 | Soil | ICSQEGCPMSNSINILLMVLAVNACVLAVACAALYRLNKAVDQFDR |
| Ga0257155_10109832 | 3300026481 | Soil | MANNLNILLMVIAVNVCVLGVAFFALYRLNKAVDQFDR |
| Ga0257158_10008824 | 3300026515 | Soil | RASMANNLNILLMVIAVNVCVLGVAFFALYRLNKAVDQFDR |
| Ga0257158_11350032 | 3300026515 | Soil | MANINILLMVIAVNVCVLGIAFVALYRLNKAVDQFDR |
| Ga0209648_100799041 | 3300026551 | Grasslands Soil | MSNSVNILLMVLAVNACVLAVACAALYRLNKAVDQFDR |
| Ga0209648_102681292 | 3300026551 | Grasslands Soil | MSNSINILLMVLAVNACVLAVACVALYRLNRAVDQFDR |
| Ga0209388_10016333 | 3300027655 | Vadose Zone Soil | MSNSINILLMVLAVNACVLAVACVALYRLNKAVDQFDR |
| Ga0209060_100139993 | 3300027826 | Surface Soil | MTNSVNILLMVLAVNACVLAAAFVALYRLNKAVDQFDR |
| Ga0209060_100874152 | 3300027826 | Surface Soil | MTNNIQILLMVIAVNACVLGLACLALYGLNRAVDQFDR |
| Ga0209180_100727722 | 3300027846 | Vadose Zone Soil | MSNSINILLMVLAVNACVLTVACAALYRLNKAVDQFDR |
| Ga0209180_105035762 | 3300027846 | Vadose Zone Soil | MNNSINILLMVLAVNACVLAVAFIALYRLNKAVDQFDR |
| Ga0209701_103113981 | 3300027862 | Vadose Zone Soil | MSNSINILLMVLAVNACVLAVACAALYRLNKAVDQFD |
| Ga0209465_100389201 | 3300027874 | Tropical Forest Soil | MTNSLNILLMVLAVNGCVLGAAFIALYGLNRDVDKFDH |
| Ga0209465_102075821 | 3300027874 | Tropical Forest Soil | APMTNSLNILLMVLAVNASVLAVAFAALYGLNKGVDQFDRESGLR |
| Ga0209068_103487182 | 3300027894 | Watersheds | MENISILAMVIAVNVCVLGVAVLALYRLNKAVDQFDR |
| Ga0209488_100767952 | 3300027903 | Vadose Zone Soil | MSNSINILLMVLAVNAFVLAVAFIALYRLNKAVDRFDR |
| Ga0209488_102355422 | 3300027903 | Vadose Zone Soil | MTNSINILLMVLAVNAVVLAVASVALYRLNKAVDRFDR |
| Ga0209488_110215862 | 3300027903 | Vadose Zone Soil | MNNSINILLMVLAVNAGVLAVGFIALYRLNKAVDRFDR |
| Ga0209069_104693412 | 3300027915 | Watersheds | MDNLNILLMVIAVNVFVLGVAFIALYRLNKAVDEVDH |
| Ga0209526_100318994 | 3300028047 | Forest Soil | MANNLNILLMVIAVNVCVLGIAFIALYRLNKAVDQFDR |
| Ga0310915_112053591 | 3300031573 | Soil | MDNLSILLMVIAVNLCVLGIAFFALYRLNKAVDQFDR |
| Ga0307476_110505072 | 3300031715 | Hardwood Forest Soil | SINILLMVLTVNACVLGVAFVALYRLNKAVDQFDR |
| Ga0307469_100121572 | 3300031720 | Hardwood Forest Soil | MANINILLMVIAVNVCVLGVAFIALYRLNKAVDRFDG |
| Ga0307478_112786262 | 3300031823 | Hardwood Forest Soil | MTNSINILLMVLTVNACVLGVAFVALYRLNKAVDQFDR |
| Ga0306925_104401951 | 3300031890 | Soil | MENFNILLMVIAVNLCVLGIAFFALYRLNKAVDQFDR |
| Ga0306920_1021057051 | 3300032261 | Soil | MTNSLNILLMVLAVNACVLAIAFTALYRLNKAVDQFDR |
| ⦗Top⦘ |