Metagenome / Metatranscriptome Family F075087

Overview

Basic Information

• Family ID: F075087
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 119
• Average Sequence Length: 38 residues
• Representative Sequence: MTNSINILLMVLAVNACVLAVAFVALYRLNKAVDQFDR
• Number of Associated Samples: 82
• Number of Associated Scaffolds: 119

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 91.60 %
• % of genes near scaffold ends (potentially truncated): 10.08 %
• % of genes from short scaffolds (< 2000 bps): 78.99 %
• Associated GOLD sequencing projects: 75
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (87.395 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (21.849 % of family members)
• Environment Ontology (ENVO): Unclassified (42.857 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (62.185 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 54.55%
  β-sheet: 0.00%
  Coil/Unstructured: 45.45%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 119 Family Scaffolds
PF01557	FAA_hydrolase	1.68
PF06823	DUF1236	0.84
PF07690	MFS_1	0.84
PF05050	Methyltransf_21	0.84
PF00557	Peptidase_M24	0.84
PF00355	Rieske	0.84
PF06202	GDE_C	0.84
PF00903	Glyoxalase	0.84
PF03942	DTW	0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 119 Family Scaffolds
COG3148	tRNA U47 aminocarboxypropyltransferaseTapT/TuaA/ YfiP, DTW domain	Translation, ribosomal structure and biogenesis [J]	0.84
COG3408	Glycogen debranching enzyme (alpha-1,6-glucosidase)	Carbohydrate transport and metabolism [G]	0.84

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	87.39 %
Unclassified	root	N/A	12.61 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	87.39 %
Unclassified	root	N/A	12.61 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	87.39 %
Unclassified	root	N/A	12.61 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	59.66 %
Unclassified	root	N/A	12.61 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	52.10 %
Unclassified	root	N/A	12.61 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.84 %

Level 6

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	45.38 %
Unclassified	root	N/A	12.61 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.68 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.84 %

Level 7

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	45.38 %
Unclassified	root	N/A	12.61 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.84 %
Alteromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae	0.84 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000597|AF_2010_repII_A1DRAFT_10084298	All Organisms → cellular organisms → Bacteria → Proteobacteria	794
3300002245|JGIcombinedJ26739_100715512	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	880
3300004633|Ga0066395_10135441	All Organisms → cellular organisms → Bacteria	1232
3300005332|Ga0066388_101170522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1311
3300005531|Ga0070738_10006120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	12797
3300005533|Ga0070734_10114436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae	1578
3300005552|Ga0066701_10427476	All Organisms → cellular organisms → Bacteria	821
3300005764|Ga0066903_100003512	All Organisms → cellular organisms → Bacteria	12855
3300005764|Ga0066903_100089589	All Organisms → cellular organisms → Bacteria	4078
3300005764|Ga0066903_100445417	All Organisms → cellular organisms → Bacteria	2160
3300005764|Ga0066903_100510006	All Organisms → cellular organisms → Bacteria	2042
3300005764|Ga0066903_100656758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1835
3300005764|Ga0066903_101927513	All Organisms → cellular organisms → Bacteria → Proteobacteria	1133
3300005764|Ga0066903_104535695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	740
3300006041|Ga0075023_100072573	All Organisms → cellular organisms → Bacteria → Proteobacteria	1133
3300006047|Ga0075024_100022179	All Organisms → cellular organisms → Bacteria	2569
3300006047|Ga0075024_100548734	All Organisms → cellular organisms → Bacteria	613
3300006050|Ga0075028_100182693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1124
3300006057|Ga0075026_100087219	All Organisms → cellular organisms → Bacteria → Proteobacteria	1530
3300006178|Ga0075367_10657601	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	666
3300007255|Ga0099791_10003841	All Organisms → cellular organisms → Bacteria	6136
3300007258|Ga0099793_10065263	All Organisms → cellular organisms → Bacteria	1635
3300007788|Ga0099795_10073346	All Organisms → cellular organisms → Bacteria → Proteobacteria	1296
3300009038|Ga0099829_10025919	All Organisms → cellular organisms → Bacteria	4109
3300009038|Ga0099829_10087995	All Organisms → cellular organisms → Bacteria → Proteobacteria	2393
3300009038|Ga0099829_11453156	Not Available	566
3300009089|Ga0099828_10493807	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1104
3300009090|Ga0099827_11413617	Not Available	606
3300009143|Ga0099792_10048366	All Organisms → cellular organisms → Bacteria	2062
3300009143|Ga0099792_11135354	Not Available	528
3300009523|Ga0116221_1094814	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1324
3300009792|Ga0126374_10079571	All Organisms → cellular organisms → Bacteria	1787
3300009792|Ga0126374_10134993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1469
3300009792|Ga0126374_10880946	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	692
3300009792|Ga0126374_11534457	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	548
3300009792|Ga0126374_11824173	Not Available	509
3300009826|Ga0123355_10323683	All Organisms → cellular organisms → Bacteria	2074
3300010043|Ga0126380_10431146	All Organisms → cellular organisms → Bacteria	990
3300010043|Ga0126380_10522776	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	916
3300010043|Ga0126380_11339283	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	625
3300010046|Ga0126384_10007080	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6885
3300010046|Ga0126384_11054237	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	743
3300010048|Ga0126373_10797860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1006
3300010358|Ga0126370_10166255	All Organisms → cellular organisms → Bacteria	1627
3300010358|Ga0126370_10458921	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1065
3300010359|Ga0126376_11681135	All Organisms → cellular organisms → Bacteria	669
3300010360|Ga0126372_11236616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	773
3300010360|Ga0126372_12220523	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	598
3300010361|Ga0126378_10012920	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6936
3300010362|Ga0126377_10240088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1759
3300010376|Ga0126381_100399977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1913
3300010376|Ga0126381_101174576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1109
3300010398|Ga0126383_12282241	Not Available	627
3300012096|Ga0137389_10430049	Not Available	1129
3300012189|Ga0137388_10070465	All Organisms → cellular organisms → Bacteria → Proteobacteria	2911
3300012189|Ga0137388_10461414	All Organisms → cellular organisms → Bacteria	1179
3300012202|Ga0137363_10303056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1312
3300012362|Ga0137361_11643692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	563
3300012677|Ga0153928_1056816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	758
3300012925|Ga0137419_10461174	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1003
3300012948|Ga0126375_10457268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	940
3300012971|Ga0126369_10276897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1666
3300012971|Ga0126369_12028924	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	663
3300016357|Ga0182032_11245336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	641
3300017822|Ga0187802_10271082	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	659
3300017932|Ga0187814_10051880	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1510
3300017932|Ga0187814_10086992	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1149
3300017955|Ga0187817_10381069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	900
3300017970|Ga0187783_10071435	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2554
3300017970|Ga0187783_10299451	All Organisms → cellular organisms → Bacteria	1173
3300017970|Ga0187783_10314678	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1141
3300017970|Ga0187783_11137239	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	562
3300017972|Ga0187781_10833198	All Organisms → cellular organisms → Bacteria	670
3300018058|Ga0187766_10551952	Not Available	781
3300018058|Ga0187766_11438882	Not Available	507
3300018060|Ga0187765_10160408	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1275
3300018060|Ga0187765_11092015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	553
3300018089|Ga0187774_10666767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	683
3300020140|Ga0179590_1161750	All Organisms → cellular organisms → Bacteria	613
3300020581|Ga0210399_11088541	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	640
3300020582|Ga0210395_10388953	All Organisms → cellular organisms → Bacteria → Proteobacteria	1049
3300021170|Ga0210400_10635661	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	879
3300021178|Ga0210408_11161416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	591
3300021401|Ga0210393_11154817	Not Available	624
3300021476|Ga0187846_10282066	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	688
3300021476|Ga0187846_10366388	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	593
3300021560|Ga0126371_10127284	All Organisms → cellular organisms → Bacteria	2580
3300021560|Ga0126371_13101009	Not Available	562
3300022528|Ga0242669_1039079	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	774
3300022722|Ga0242657_1189751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	563
3300024288|Ga0179589_10053491	All Organisms → cellular organisms → Bacteria	1528
3300026341|Ga0257151_1000010	All Organisms → cellular organisms → Bacteria	7731
3300026446|Ga0257178_1031180	All Organisms → cellular organisms → Bacteria	663
3300026475|Ga0257147_1075147	All Organisms → cellular organisms → Bacteria	520
3300026481|Ga0257155_1010983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1213
3300026515|Ga0257158_1000882	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3465
3300026515|Ga0257158_1135003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	500
3300026551|Ga0209648_10079904	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2732
3300026551|Ga0209648_10268129	Not Available	1250
3300027655|Ga0209388_1001633	All Organisms → cellular organisms → Bacteria	5307
3300027826|Ga0209060_10013999	All Organisms → cellular organisms → Bacteria	4479
3300027826|Ga0209060_10087415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1464
3300027846|Ga0209180_10072772	All Organisms → cellular organisms → Bacteria	1930
3300027846|Ga0209180_10503576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	678
3300027862|Ga0209701_10311398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	901
3300027874|Ga0209465_10038920	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2258
3300027874|Ga0209465_10207582	All Organisms → cellular organisms → Bacteria	978
3300027894|Ga0209068_10348718	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	838
3300027903|Ga0209488_10076795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2482
3300027903|Ga0209488_10235542	All Organisms → cellular organisms → Bacteria	1375
3300027903|Ga0209488_11021586	Not Available	571
3300027915|Ga0209069_10469341	Not Available	703
3300028047|Ga0209526_10031899	All Organisms → cellular organisms → Bacteria	3702
3300031573|Ga0310915_11205359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	523
3300031715|Ga0307476_11050507	Not Available	599
3300031720|Ga0307469_10012157	All Organisms → cellular organisms → Bacteria	4292
3300031823|Ga0307478_11278626	Not Available	610
3300031890|Ga0306925_10440195	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1394
3300032261|Ga0306920_102105705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	787

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	97.48%
Host-Associated	Host-Associated	2.52%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	88.24%
Aquatic	Environmental → Aquatic	9.24%
Arthropoda	Host-Associated → Arthropoda	0.84%
Plants	Host-Associated → Plants	0.84%
Fungi	Host-Associated → Fungi	0.84%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	86.55%
Sediment	Environmental → Aquatic → Sediment	5.88%
Freshwater	Environmental → Aquatic → Freshwater	3.36%
Cave	Environmental → Terrestrial → Cave	1.68%
Digestive System	Host-Associated → Arthropoda → Digestive System	0.84%
Roots	Host-Associated → Plants → Roots	0.84%
Mycelium	Host-Associated → Fungi → Mycelium	0.84%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	67.23%
Loam	Environmental → Terrestrial → Soil → Loam	10.92%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.40%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.88%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.36%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	1.68%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	0.84%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.84%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.84%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	47.06%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	17.65%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	10.92%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.40%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.88%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	3.36%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.52%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	1.68%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	0.84%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.84%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.84%

Habitat

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	21.85%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	21.01%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.76%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	9.24%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	8.40%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	5.88%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	3.36%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	3.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.52%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.52%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.68%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.68%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	1.68%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	0.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.84%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.84%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	0.84%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.84%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.84%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000597	Forest soil microbial communities from Amazon forest - 2010 replicate II A1	Environmental
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental
3300009523	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG	Environmental
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental
3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Host-Associated
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental
3300012677	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaG	Host-Associated
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental
3300017822	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2	Environmental
3300017932	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4	Environmental
3300017955	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2	Environmental
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental
3300018089	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG	Environmental
3300020140	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)	Environmental
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental
3300021476	Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300022528	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)	Environmental
3300022722	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)	Environmental
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental
3300026341	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A	Environmental
3300026446	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B	Environmental
3300026475	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A	Environmental
3300026481	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A	Environmental
3300026515	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A	Environmental
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental
3300027655	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)	Environmental
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
AF_2010_repII_A1DRAFT_100842982	3300000597	Forest Soil	MTNSLTILLWVLAVNAGVLGLAFMALYRLNKAVDRFDR*
JGIcombinedJ26739_1007155122	3300002245	Forest Soil	MSNANLNILLMVVAINVCVLGVAFFALYRLNKAVDQFDR*
Ga0066395_101354412	3300004633	Tropical Forest Soil	MTNSLNILLMVLAVNASVLAVAFAALYGLNKGVDQFDRESGLR*
Ga0066388_1011705223	3300005332	Tropical Forest Soil	VTMANINILLMVIAVNVCVLGVAFIALYRLNKAVDRFDG*
Ga0070738_100061206	3300005531	Surface Soil	MTNSMNILLMVLAVNACVLGLAFVALYRLNKAVDQFDR*
Ga0070734_101144362	3300005533	Surface Soil	MTNNIQILLMVIAVNACVLGLACLALYGLNRAVDQFDR*
Ga0066701_104274762	3300005552	Soil	MTNSINILLMVLAVNGCVLAVACFALYRLNKAVDQFDR*
Ga0066903_1000035123	3300005764	Tropical Forest Soil	MSNSVNILLMVLAVNGFVLAVVFAALYRMNKAVDRFDH*
Ga0066903_1000895894	3300005764	Tropical Forest Soil	MDNLNILLMVIAVNLCVLGIAFFALYRLNKAVDQFDR*
Ga0066903_1004454173	3300005764	Tropical Forest Soil	MTNSLNILLMVLAVNACVLGVAFVALYRLNKVVDQFDR*
Ga0066903_1005100062	3300005764	Tropical Forest Soil	MTNSLNILLMVLAVNGSVLGAAFIALYGLNRVVDKFDH*
Ga0066903_1006567582	3300005764	Tropical Forest Soil	VDNFNILLMVIAVNACVLAVAFYALYRLNKAVDKFDR*
Ga0066903_1019275132	3300005764	Tropical Forest Soil	MTDSMNILLMVLAVNACVLGVAFIALYRLNKSVDQFDR*
Ga0066903_1045356952	3300005764	Tropical Forest Soil	MTNSMNILLMVLAVNGFVLAVAFAALYRLNKTVDRYDH*
Ga0075023_1000725732	3300006041	Watersheds	MTDNINILLMVIAVNVFVLGVAFIALYRLNKAVDEVDR*
Ga0075024_1000221794	3300006047	Watersheds	MTDNINILLMVIAVNVSVLGLAFIALYRLNKAVDEVDR*
Ga0075024_1005487342	3300006047	Watersheds	MDNLNILLMVIAVNVFVLGVAFIALYRLNKAVDEVDH*
Ga0075028_1001826932	3300006050	Watersheds	MDNLNILLMVIAVNVFVLGLAYIALYRLNKAVDEVDR*
Ga0075026_1000872192	3300006057	Watersheds	MDNLNILLMVIAVNVFVLGVAFIALYRLNKAVDEVDR*
Ga0075367_106576012	3300006178	Populus Endosphere	MTNNIEILLMVIAVNGCVLGLACLALWRLNRAVDGFDR*
Ga0099791_100038413	3300007255	Vadose Zone Soil	MSNSINILLMVLAVNACVLAVACVALYRLNKAVDQFDR*
Ga0099793_100652632	3300007258	Vadose Zone Soil	MTNSINILLMVLAVNACVLAVACAALYRLNKAVDQFDR*
Ga0099795_100733462	3300007788	Vadose Zone Soil	MTNSINILLMVLAVNGCVLAVAFAALYRLNRAVDQFDR*
Ga0099829_100259193	3300009038	Vadose Zone Soil	MSNSINILLMVLAVNACVLTVACAALYRLNKAVDQFDR*
Ga0099829_100879953	3300009038	Vadose Zone Soil	MNNSINILLMVLAVNACVLAVAFIALYRLNKAVDQFDR*
Ga0099829_114531562	3300009038	Vadose Zone Soil	MSNNINILLMVLAVNAFVLAVAFIALYRLNRAVDQFDR*
Ga0099828_104938072	3300009089	Vadose Zone Soil	MSNSINILLMVLAVNAVVLAVASIALYRLNKAVDQFDR*
Ga0099827_114136172	3300009090	Vadose Zone Soil	MSNSINILLMVLAVNACVLAVACAALYRLNKAVDQFDR*
Ga0099792_100483663	3300009143	Vadose Zone Soil	MSNSINILLMVLAVNAFVLAVAFIALYRLNKAVDRFDR*
Ga0099792_111353542	3300009143	Vadose Zone Soil	MTNSINILLMVLAVNAVVLAVASVALYRLNKAVDRFDR*
Ga0116221_10948142	3300009523	Peatlands Soil	MQGFQILLLVIAVASCVLGVAFLGAYRLNKAVDQCDR*
Ga0126374_100795713	3300009792	Tropical Forest Soil	MTNSLNILLMVLAVNGVVLAVAFAALYRLNKAVDQFDR*
Ga0126374_101349932	3300009792	Tropical Forest Soil	MNILLMVLAVNGFVLAVAFAALYRLNKTVDRYDH*
Ga0126374_108809462	3300009792	Tropical Forest Soil	MTNSLNILLMVLAVNAGVLGVAFVALYRLNKAVDQFDR*
Ga0126374_115344572	3300009792	Tropical Forest Soil	MTNSINILLMVLAVNASVLAVAVIALYRLNKAVDQFDR*
Ga0126374_118241731	3300009792	Tropical Forest Soil	MANINILLMVIAVNVCVLGVAFIALYRLNKAVDRFDG*
Ga0123355_103236832	3300009826	Termite Gut	MTNSMNILLMVLAVNACVLTAAVFGLYFLNKSVEQSDR*
Ga0126380_104311462	3300010043	Tropical Forest Soil	MTNSLNILLMVLAVNACVLSVAFVALYRLNKAVDQFDR*
Ga0126380_105227762	3300010043	Tropical Forest Soil	MANINILLMVIAVNVCVLGVAFMALYRLNKAVDRFDG*
Ga0126380_113392831	3300010043	Tropical Forest Soil	MTNSLNILLMVLAVNGIVLAVAFAALYRLNGAVDQFDR*
Ga0126384_100070806	3300010046	Tropical Forest Soil	MTNSLNILLMVLAVNGCVLGAAFIALYGLNRVVDKFDH*
Ga0126384_110542372	3300010046	Tropical Forest Soil	MTNSLNILLMVLAVNGVVLAVAFAALYRLNRAVDQFDR*
Ga0126373_107978601	3300010048	Tropical Forest Soil	MTNSINILLMVLAVNACVLGVAFIALYRLNKAVDRFDR*
Ga0126370_101662553	3300010358	Tropical Forest Soil	MTNSINILLMVLVVNACVLGVAFIALYRLNKAVDRFDR*
Ga0126370_104589212	3300010358	Tropical Forest Soil	VDNFNILLMVIAVNACVLAVAFSALYRLNKAVDKFDR*
Ga0126376_116811352	3300010359	Tropical Forest Soil	SQEWCPMTNSLNILLMVLAVNGVVLAVAFAALYRLNKAVDQFDR*
Ga0126372_112366162	3300010360	Tropical Forest Soil	MTNSLNILLMVLAVNACVLGVAFVALYRLNRAVDQFDR*
Ga0126372_122205232	3300010360	Tropical Forest Soil	MTNSLNILLMVLAVNAVVLAVAFAALYRLNKAVDQFDR*
Ga0126378_100129202	3300010361	Tropical Forest Soil	MTNSMNILLMVLAVNGLVLAVAFAALYRLNKTVDRYDH*
Ga0126377_102400883	3300010362	Tropical Forest Soil	MTNSINILLIVLAVNASVLAVAVFALYRLNKAVDQFDR*
Ga0126381_1003999771	3300010376	Tropical Forest Soil	MTNNIEILLMVVAVSACVLSLAFIALYRLNKAVDEFDR*
Ga0126381_1011745762	3300010376	Tropical Forest Soil	MTNNIEILLMVIAVNAGVLGLAGLALWRLNRAVDGLDRSPD*
Ga0126383_122822412	3300010398	Tropical Forest Soil	MTNSINILLWVLAVNASVLGVAFIALYGLNKAVDQFDR*
Ga0137389_104300492	3300012096	Vadose Zone Soil	MNNSINILLMVLAVNAGVLAVGFIALYRLNKAVDRFDR*
Ga0137388_100704654	3300012189	Vadose Zone Soil	MTNSINILLMVLAVNAVVLAVASIALYRLNKAVDQFDR*
Ga0137388_104614143	3300012189	Vadose Zone Soil	MSNSINILLMVLAVNAGVLAVGFIALYRLNTAVDRFDR*
Ga0137363_103030562	3300012202	Vadose Zone Soil	MTNSINILLMVLAVNACVLAVACVALYRLNKAVDQFDR*
Ga0137361_116436921	3300012362	Vadose Zone Soil	MSNSINILLMVLAVNACVLAIACAALYRLNKAVDQFDR*
Ga0153928_10568161	3300012677	Attine Ant Fungus Gardens	MATNSIEILLAVIAVNAVVLAIAAFGLYRLNKAVDAFDH*
Ga0137419_104611741	3300012925	Vadose Zone Soil	SNSINILLMVLAVNGCVLAVAFAALYRLNRAVDQFDR*
Ga0126375_104572682	3300012948	Tropical Forest Soil	MENFNILLMVIAVNLCVLGIAFFALYRLNKAVDQFDR*
Ga0126369_102768971	3300012971	Tropical Forest Soil	MTNSINILLMVLSINACVLGVAFVALYRLNKAVDQFDR*
Ga0126369_120289242	3300012971	Tropical Forest Soil	MTNSVQILLLVLAVNAFVLGVASFALYRLNKAVDQFDH*
Ga0182032_112453362	3300016357	Soil	MENFNILLMVIAVNLCVLGIAFFALYRLNKAVEEFDH
Ga0187802_102710821	3300017822	Freshwater Sediment	MTNSMNILLMVLAVNACVLGLAFVALYRLNKAVDQFDR
Ga0187814_100518802	3300017932	Freshwater Sediment	MTNSVEILLMVIVVNAVVLTVAGFALYRLNKAVDAFDR
Ga0187814_100869922	3300017932	Freshwater Sediment	MTNSMNILLMVLAVNACVLALAFVALYRLNKAVDQFDR
Ga0187817_103810692	3300017955	Freshwater Sediment	MTNSMNILLMVLAVNACVLALAFVARYRLDKAVDQFDR
Ga0187783_100714353	3300017970	Tropical Peatland	MTNSVNILLMVLAVNACVLGVAVVALYCLNRAVDQFDNKAVDQFDR
Ga0187783_102994512	3300017970	Tropical Peatland	MTNSMNILLMVLAVNACVLGVAFAALYGLNKAVDQFDR
Ga0187783_103146782	3300017970	Tropical Peatland	MTNSINILLMVLAVNACVLAVAFVALYRLNKAVDQFDR
Ga0187783_111372391	3300017970	Tropical Peatland	MTNNIEILLMVIAVNASVLGLACIALYGLNRAVDGFDR
Ga0187781_108331981	3300017972	Tropical Peatland	SVIMTNSINILLMVLAVNACVLAVAFVALYRLNKAVDQFDR
Ga0187766_105519522	3300018058	Tropical Peatland	MTNSLNILLMVLAVNGVVLAVAFAALYRLNSAVDQFDR
Ga0187766_114388822	3300018058	Tropical Peatland	MTNSMNILLMVLAVNACVLGLAVIALYRLNKAVDQFDR
Ga0187765_101604081	3300018060	Tropical Peatland	MTNSINILLMVLAVNGSVLAIAVLALYRLNKAVDQFDR
Ga0187765_110920152	3300018060	Tropical Peatland	MTNSMNILLMVLAVNACVLGLAVIALYRLNRAVDQFDR
Ga0187774_106667672	3300018089	Tropical Peatland	MTNSVNILLMVLAVNACVLSLACVALYRLNKAVDQFDR
Ga0179590_11617502	3300020140	Vadose Zone Soil	MSNSINILLMVLAVNACVLAVACAALYRLNKAVDQFDR
Ga0210399_110885412	3300020581	Soil	MSNSINILLMVLAVNACVLGIGFIALYRLNKGVDQFDR
Ga0210395_103889532	3300020582	Soil	MTNSINILLMVLSINACVLGVAFVALYRLNKAVDQFDR
Ga0210400_106356612	3300021170	Soil	MSNSINILLMVLAVNACVLGIGFTALYRLNKGVDQFDR
Ga0210408_111614162	3300021178	Soil	MSNNIEILLMVIAVNVCVLGVAFIALYRLNKAADQFDR
Ga0210393_111548171	3300021401	Soil	MTNSVEILLAVIAVNVVVLAIAAFGLYRLNKAVDAFDH
Ga0187846_102820662	3300021476	Biofilm	MTNSMNILLMVLAVNACVLGVAFVALYGLNKAVDQVDR
Ga0187846_103663882	3300021476	Biofilm	MSNSLNILLMVLAVNGVVLAVAFGALYRLNRAVDQ
Ga0126371_101272842	3300021560	Tropical Forest Soil	MSNSVNILLMVLAVNGFVLAVVFAALYRMNKAVDRFDH
Ga0126371_131010092	3300021560	Tropical Forest Soil	MTNSMNILLMVLAVNGFVLAVAFAALYRLNKTVDRYDH
Ga0242669_10390792	3300022528	Soil	MTNSVEILLMVVAVNAVVLAVAAFGLYRLNKAVDAFDH
Ga0242657_11897511	3300022722	Soil	MTNSLNILLMVLAVNGIVLAVAFAALYRLNRAVDQFDR
Ga0179589_100534912	3300024288	Vadose Zone Soil	MTNSINILLMVLAVNGCVLAVAFAALYRLNRAVDQFDR
Ga0257151_10000106	3300026341	Soil	MSNNIEILLMVIAVNVCVLGVAFIALYRLNRAADQFDR
Ga0257178_10311802	3300026446	Soil	QERAPMSNSINILLMVLAVNACVLAVACAALYRLNKAVDQFDR
Ga0257147_10751471	3300026475	Soil	ICSQEGCPMSNSINILLMVLAVNACVLAVACAALYRLNKAVDQFDR
Ga0257155_10109832	3300026481	Soil	MANNLNILLMVIAVNVCVLGVAFFALYRLNKAVDQFDR
Ga0257158_10008824	3300026515	Soil	RASMANNLNILLMVIAVNVCVLGVAFFALYRLNKAVDQFDR
Ga0257158_11350032	3300026515	Soil	MANINILLMVIAVNVCVLGIAFVALYRLNKAVDQFDR
Ga0209648_100799041	3300026551	Grasslands Soil	MSNSVNILLMVLAVNACVLAVACAALYRLNKAVDQFDR
Ga0209648_102681292	3300026551	Grasslands Soil	MSNSINILLMVLAVNACVLAVACVALYRLNRAVDQFDR
Ga0209388_10016333	3300027655	Vadose Zone Soil	MSNSINILLMVLAVNACVLAVACVALYRLNKAVDQFDR
Ga0209060_100139993	3300027826	Surface Soil	MTNSVNILLMVLAVNACVLAAAFVALYRLNKAVDQFDR
Ga0209060_100874152	3300027826	Surface Soil	MTNNIQILLMVIAVNACVLGLACLALYGLNRAVDQFDR
Ga0209180_100727722	3300027846	Vadose Zone Soil	MSNSINILLMVLAVNACVLTVACAALYRLNKAVDQFDR
Ga0209180_105035762	3300027846	Vadose Zone Soil	MNNSINILLMVLAVNACVLAVAFIALYRLNKAVDQFDR
Ga0209701_103113981	3300027862	Vadose Zone Soil	MSNSINILLMVLAVNACVLAVACAALYRLNKAVDQFD
Ga0209465_100389201	3300027874	Tropical Forest Soil	MTNSLNILLMVLAVNGCVLGAAFIALYGLNRDVDKFDH
Ga0209465_102075821	3300027874	Tropical Forest Soil	APMTNSLNILLMVLAVNASVLAVAFAALYGLNKGVDQFDRESGLR
Ga0209068_103487182	3300027894	Watersheds	MENISILAMVIAVNVCVLGVAVLALYRLNKAVDQFDR
Ga0209488_100767952	3300027903	Vadose Zone Soil	MSNSINILLMVLAVNAFVLAVAFIALYRLNKAVDRFDR
Ga0209488_102355422	3300027903	Vadose Zone Soil	MTNSINILLMVLAVNAVVLAVASVALYRLNKAVDRFDR
Ga0209488_110215862	3300027903	Vadose Zone Soil	MNNSINILLMVLAVNAGVLAVGFIALYRLNKAVDRFDR
Ga0209069_104693412	3300027915	Watersheds	MDNLNILLMVIAVNVFVLGVAFIALYRLNKAVDEVDH
Ga0209526_100318994	3300028047	Forest Soil	MANNLNILLMVIAVNVCVLGIAFIALYRLNKAVDQFDR
Ga0310915_112053591	3300031573	Soil	MDNLSILLMVIAVNLCVLGIAFFALYRLNKAVDQFDR
Ga0307476_110505072	3300031715	Hardwood Forest Soil	SINILLMVLTVNACVLGVAFVALYRLNKAVDQFDR
Ga0307469_100121572	3300031720	Hardwood Forest Soil	MANINILLMVIAVNVCVLGVAFIALYRLNKAVDRFDG
Ga0307478_112786262	3300031823	Hardwood Forest Soil	MTNSINILLMVLTVNACVLGVAFVALYRLNKAVDQFDR
Ga0306925_104401951	3300031890	Soil	MENFNILLMVIAVNLCVLGIAFFALYRLNKAVDQFDR
Ga0306920_1021057051	3300032261	Soil	MTNSLNILLMVLAVNACVLAIAFTALYRLNKAVDQFDR