| Basic Information | |
|---|---|
| Family ID | F075080 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTQAAVEANIRVNGETEPLLVATLAALLEEKAVDTAQRGIA |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.22 % |
| % of genes near scaffold ends (potentially truncated) | 98.32 % |
| % of genes from short scaffolds (< 2000 bps) | 93.28 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.908 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.454 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.454 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.815 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.09% β-sheet: 20.29% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF01266 | DAO | 95.80 |
| PF00793 | DAHP_synth_1 | 3.36 |
| PF05690 | ThiG | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0214 | Pyridoxal 5'-phosphate synthase subunit PdxS | Coenzyme transport and metabolism [H] | 0.84 |
| COG2022 | Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis) | Coenzyme transport and metabolism [H] | 0.84 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.91 % |
| Unclassified | root | N/A | 31.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10092179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Azorhizobium → Azorhizobium doebereinerae | 751 | Open in IMG/M |
| 3300000955|JGI1027J12803_105878316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae | 588 | Open in IMG/M |
| 3300002459|JGI24751J29686_10001354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5155 | Open in IMG/M |
| 3300004479|Ga0062595_102249048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300004479|Ga0062595_102249049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300005093|Ga0062594_102540700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300005366|Ga0070659_101686974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300005367|Ga0070667_101217986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 705 | Open in IMG/M |
| 3300005548|Ga0070665_100044207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4473 | Open in IMG/M |
| 3300005563|Ga0068855_101551295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 679 | Open in IMG/M |
| 3300005568|Ga0066703_10640373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
| 3300005713|Ga0066905_100295036 | Not Available | 1270 | Open in IMG/M |
| 3300005764|Ga0066903_101328655 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300005764|Ga0066903_102402243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1019 | Open in IMG/M |
| 3300005764|Ga0066903_104265367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300005764|Ga0066903_104287455 | Not Available | 762 | Open in IMG/M |
| 3300006028|Ga0070717_10447318 | Not Available | 1164 | Open in IMG/M |
| 3300006038|Ga0075365_10979362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
| 3300006058|Ga0075432_10136384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
| 3300006186|Ga0075369_10458183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300006847|Ga0075431_100317503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1571 | Open in IMG/M |
| 3300006953|Ga0074063_10026161 | Not Available | 1118 | Open in IMG/M |
| 3300007076|Ga0075435_101790389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300009100|Ga0075418_12309086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300009156|Ga0111538_13284046 | Not Available | 563 | Open in IMG/M |
| 3300009162|Ga0075423_10838846 | Not Available | 973 | Open in IMG/M |
| 3300009174|Ga0105241_11221355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300009792|Ga0126374_10002335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5929 | Open in IMG/M |
| 3300009792|Ga0126374_11745957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300010043|Ga0126380_10966831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300010358|Ga0126370_11711396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300010359|Ga0126376_13175210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300010361|Ga0126378_11490625 | Not Available | 767 | Open in IMG/M |
| 3300010362|Ga0126377_11206527 | Not Available | 827 | Open in IMG/M |
| 3300010397|Ga0134124_12421125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300010398|Ga0126383_10934752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → unclassified Xanthobacter → Xanthobacter sp. 17-67-6 | 954 | Open in IMG/M |
| 3300012205|Ga0137362_11602727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300012359|Ga0137385_10073340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3043 | Open in IMG/M |
| 3300012363|Ga0137390_11672989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300012532|Ga0137373_10227953 | Not Available | 1516 | Open in IMG/M |
| 3300012924|Ga0137413_10347342 | Not Available | 1052 | Open in IMG/M |
| 3300012971|Ga0126369_11041341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → unclassified Xanthobacter → Xanthobacter sp. 17-67-6 | 907 | Open in IMG/M |
| 3300013105|Ga0157369_11915950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300015242|Ga0137412_10271787 | Not Available | 1336 | Open in IMG/M |
| 3300015258|Ga0180093_1097633 | Not Available | 717 | Open in IMG/M |
| 3300016270|Ga0182036_10549234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → unclassified Xanthobacter → Xanthobacter sp. 17-67-6 | 921 | Open in IMG/M |
| 3300016294|Ga0182041_12344258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300016422|Ga0182039_10203443 | Not Available | 1581 | Open in IMG/M |
| 3300016422|Ga0182039_10878039 | Not Available | 800 | Open in IMG/M |
| 3300017975|Ga0187782_10976350 | Not Available | 658 | Open in IMG/M |
| 3300018086|Ga0187769_10042538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3131 | Open in IMG/M |
| 3300018469|Ga0190270_11323277 | Not Available | 764 | Open in IMG/M |
| 3300018476|Ga0190274_11600097 | Not Available | 744 | Open in IMG/M |
| 3300020005|Ga0193697_1142793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300021178|Ga0210408_11472618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300021420|Ga0210394_11615263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300024288|Ga0179589_10495601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300025919|Ga0207657_10943863 | Not Available | 663 | Open in IMG/M |
| 3300026095|Ga0207676_10305777 | Not Available | 1453 | Open in IMG/M |
| 3300026121|Ga0207683_11440684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300026320|Ga0209131_1197867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → unclassified Xanthobacter → Xanthobacter sp. 17-67-6 | 938 | Open in IMG/M |
| 3300026359|Ga0257163_1087156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300026498|Ga0257156_1054496 | Not Available | 824 | Open in IMG/M |
| 3300026508|Ga0257161_1109785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300027662|Ga0208565_1095140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → unclassified Xanthobacter → Xanthobacter sp. 17-67-6 | 901 | Open in IMG/M |
| 3300028713|Ga0307303_10090367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300028744|Ga0307318_10335350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300028754|Ga0307297_10225010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300028755|Ga0307316_10130656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → unclassified Xanthobacter → Xanthobacter sp. 17-67-6 | 888 | Open in IMG/M |
| 3300028803|Ga0307281_10215299 | Not Available | 696 | Open in IMG/M |
| 3300028807|Ga0307305_10509665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300028876|Ga0307286_10142960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → unclassified Xanthobacter → Xanthobacter sp. 17-67-6 | 854 | Open in IMG/M |
| 3300028878|Ga0307278_10520858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300030904|Ga0308198_1055168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300031094|Ga0308199_1094869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300031099|Ga0308181_1137735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300031152|Ga0307501_10020360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1252 | Open in IMG/M |
| 3300031543|Ga0318516_10206656 | Not Available | 1134 | Open in IMG/M |
| 3300031544|Ga0318534_10676314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300031561|Ga0318528_10021754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3073 | Open in IMG/M |
| 3300031564|Ga0318573_10269861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → unclassified Xanthobacter → Xanthobacter sp. 17-67-6 | 908 | Open in IMG/M |
| 3300031564|Ga0318573_10294523 | Not Available | 868 | Open in IMG/M |
| 3300031572|Ga0318515_10034311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2495 | Open in IMG/M |
| 3300031640|Ga0318555_10323081 | Not Available | 835 | Open in IMG/M |
| 3300031720|Ga0307469_11240419 | Not Available | 706 | Open in IMG/M |
| 3300031723|Ga0318493_10501980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300031723|Ga0318493_10604527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300031736|Ga0318501_10338162 | Not Available | 807 | Open in IMG/M |
| 3300031747|Ga0318502_10129861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1422 | Open in IMG/M |
| 3300031748|Ga0318492_10205161 | Not Available | 1009 | Open in IMG/M |
| 3300031768|Ga0318509_10190985 | Not Available | 1137 | Open in IMG/M |
| 3300031769|Ga0318526_10311532 | Not Available | 644 | Open in IMG/M |
| 3300031770|Ga0318521_10252539 | Not Available | 1029 | Open in IMG/M |
| 3300031771|Ga0318546_10503903 | Not Available | 849 | Open in IMG/M |
| 3300031781|Ga0318547_10104868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1620 | Open in IMG/M |
| 3300031792|Ga0318529_10296606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 753 | Open in IMG/M |
| 3300031792|Ga0318529_10340393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300031794|Ga0318503_10164707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300031796|Ga0318576_10448190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300031798|Ga0318523_10499430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300031799|Ga0318565_10267905 | Not Available | 830 | Open in IMG/M |
| 3300031835|Ga0318517_10538346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300031835|Ga0318517_10586678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031846|Ga0318512_10717780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300031880|Ga0318544_10373148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300031944|Ga0310884_11072476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300031945|Ga0310913_10554495 | Not Available | 815 | Open in IMG/M |
| 3300031981|Ga0318531_10105442 | Not Available | 1244 | Open in IMG/M |
| 3300031981|Ga0318531_10291148 | Not Available | 738 | Open in IMG/M |
| 3300032001|Ga0306922_11602677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300032009|Ga0318563_10654997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300032012|Ga0310902_11009803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300032042|Ga0318545_10373788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300032054|Ga0318570_10290071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300032055|Ga0318575_10661836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300032063|Ga0318504_10500269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300032064|Ga0318510_10253590 | Not Available | 723 | Open in IMG/M |
| 3300033550|Ga0247829_10165822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1732 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.68% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100921792 | 3300000597 | Forest Soil | MTQAAIGANIRVNGENEPLVVATLAALLEEKAVDTGQRGIAVAINGAIVP |
| JGI1027J12803_1058783161 | 3300000955 | Soil | MSEAAAEANIRVNGEPEPLMVATLAALLEEKAVDTRQRGIAVAINGA |
| JGI24751J29686_100013541 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQTLAEANIRVNGQDEPLVAATLAALLEEKALDTGQRGIAVAVNGAIVP |
| Ga0062595_1022490482 | 3300004479 | Soil | MSEAAAEANIRVNGEPEPLMVATLAALLEEKAVDTRQRGIAVAINGAIVPR |
| Ga0062595_1022490492 | 3300004479 | Soil | MSEATAEANIRVNGQPEPLMVATLAALLEEKAVDTRQRGIAVAINGAIVPR |
| Ga0062594_1025407001 | 3300005093 | Soil | MSEAAAEANIRVNGEPEPLMVATLAALLEEKAVDTRQRGIAVAINGAIVPRAA |
| Ga0070659_1016869741 | 3300005366 | Corn Rhizosphere | MKESAMTQTLAEANIRVNGQDEPLVAATLAALLEEKAVDTGQRG |
| Ga0070667_1012179862 | 3300005367 | Switchgrass Rhizosphere | MTHAAAEANIRVNGQDEPLITATLAALLEEKAVDTGQRGIA |
| Ga0070665_1000442075 | 3300005548 | Switchgrass Rhizosphere | MTQTLAEANIRVNGQDEPLVAATLAALLEEKALDTGQRGIAVAVN |
| Ga0068855_1015512951 | 3300005563 | Corn Rhizosphere | MTQTLAEANIRVNGQDEPLVAATLAALLEEKAVDTGQRG |
| Ga0066703_106403732 | 3300005568 | Soil | MTQAAVETNIRVNGETEPLVVATLAALLEEKAVDIGQRGIAVALNGAI |
| Ga0066905_1002950362 | 3300005713 | Tropical Forest Soil | MSEATVEANIRVNGQPEPLMVATLAALLEEKAVDT |
| Ga0066903_1013286551 | 3300005764 | Tropical Forest Soil | MSEATAEANIRINGQPEPLIVATLAALLEEKAVDTRQRGIAVAV |
| Ga0066903_1024022432 | 3300005764 | Tropical Forest Soil | MTPAAIETNIRVNGESEPLAVATLAALLEEKAVDTAQRGIA |
| Ga0066903_1042653672 | 3300005764 | Tropical Forest Soil | MSEAAAEANIRVNGEPEPLMVATLAALLQEKAVDTRQRGIAVAING |
| Ga0066903_1042874551 | 3300005764 | Tropical Forest Soil | MSEATAEANIRINGQPEPLIVATLAALLEEKAVDTRQRG |
| Ga0070717_104473182 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQVAAEAKIRVNGQDEPLVVATVASLLEEKAVDTGQRGIAVA |
| Ga0075365_109793622 | 3300006038 | Populus Endosphere | MTHAAAEANIRVNGQDEPLITATLAALLEEKAVDTG |
| Ga0075432_101363842 | 3300006058 | Populus Rhizosphere | MTQTLAEANIRVNGQDEPLVAATLAALLEEKAVDTGQRGIAV |
| Ga0075369_104581832 | 3300006186 | Populus Endosphere | MAQAAAQASIRVNGQDEPLAAATLSALLEEKAVDTGQRGI |
| Ga0075431_1003175032 | 3300006847 | Populus Rhizosphere | MTPTAAAASIKVNGQDEPLAAVTLAALLEEKAVDTGQRGIA |
| Ga0074063_100261611 | 3300006953 | Soil | MTQATVQTDIRINGQNEPLGVATLAALLEEKAVDT |
| Ga0075435_1017903891 | 3300007076 | Populus Rhizosphere | MNDAAVATSIRVNGQDEPLGVATLTELLAEKEVDTGQRG |
| Ga0075418_123090861 | 3300009100 | Populus Rhizosphere | MIPTAAAASIRVNGQDEPLAAATLAALLEEKAVDTGQRGIA |
| Ga0111538_132840462 | 3300009156 | Populus Rhizosphere | MTQAILNAQIRINGQDEPLRAGTLAGLLDQKAVDTA |
| Ga0075423_108388461 | 3300009162 | Populus Rhizosphere | MRRTLMSEATAEVNIRINGQPEPLIVATLAALLEEKAVDTRQR |
| Ga0105241_112213551 | 3300009174 | Corn Rhizosphere | MTQALAEANIRVNGQDEPLVAATLAALLEEKAVDTGQRGIAV |
| Ga0126374_100023358 | 3300009792 | Tropical Forest Soil | MNEAAPAANIRVNGETEPLMVATLAALLEEKAVDTSQRGIAVAVN |
| Ga0126374_117459571 | 3300009792 | Tropical Forest Soil | MSEATVEANIRVNGQPEPLMVATLAALLEEKAVDTRQRGIAV |
| Ga0126380_109668312 | 3300010043 | Tropical Forest Soil | MSEAAAEANIRVNGEPEPLMVATLAALLQEKAVDTRQRGIAVAINGA |
| Ga0126370_117113962 | 3300010358 | Tropical Forest Soil | MNEAAVQARIRVNGQDEPLAADTLAALLAEKAVDTGQR |
| Ga0126376_131752101 | 3300010359 | Tropical Forest Soil | MTQAAIEANIRVNGEDEPLTVATLAALLKEKAVDTGQRGIAVAING |
| Ga0126378_114906251 | 3300010361 | Tropical Forest Soil | MRIRESFMMQTLVAPRIKVNGEDEPLVAATLAALLAEKAVDTGR |
| Ga0126377_112065271 | 3300010362 | Tropical Forest Soil | MTDAHIRINGQDEILSVATLAALLEEKAVDTAQRGIAVALNGEV |
| Ga0134125_120365312 | 3300010371 | Terrestrial Soil | MAEPLIQVNGKSEPLAAATLEVLLAEKAVDTGQRGIAVAVNGA |
| Ga0134124_124211252 | 3300010397 | Terrestrial Soil | MSEAAAEANIRVNGEPEPLMVATLAALLEEKAVDTCQRGIAVAI |
| Ga0126383_109347521 | 3300010398 | Tropical Forest Soil | MSEATVEANIRVNGQPEPLMVATLAALLEEKAVDTRQRGIAVAVNG |
| Ga0137362_116027271 | 3300012205 | Vadose Zone Soil | MSQQVVAASIRINGMDEELSVSTLAALLEEKAVDTAQRG |
| Ga0137385_100733401 | 3300012359 | Vadose Zone Soil | MSESATRASIRVNGESEPLVASTLAALLEEKALDLGQRGIAVALNG |
| Ga0137390_116729891 | 3300012363 | Vadose Zone Soil | MTQAVVETNIRVNGQDEPLGVATLAALLEEKAVDTGQRGI |
| Ga0137373_102279531 | 3300012532 | Vadose Zone Soil | MNDTTAPTIHVNGQSEMLAVATLAALLEEKEIDARGIAVALNGSVV |
| Ga0137413_103473421 | 3300012924 | Vadose Zone Soil | MKEITMTYAAAEASIRVNGQDEPLIAGTLATLLEEKAVDTGQRGI |
| Ga0126369_110413411 | 3300012971 | Tropical Forest Soil | MKETAMTQAAVQTNIRVNGQDEPLGVATVAALLEEKAVDTGQRG |
| Ga0157369_119159502 | 3300013105 | Corn Rhizosphere | MKESAMTQTLAEANIRVNGQDEPLVAATLAALLEE |
| Ga0137412_102717872 | 3300015242 | Vadose Zone Soil | MKEITMTYAAAEASIRVNGQDEPLIAGTLATLLEEKAVDTGQRGIAVAVN |
| Ga0180093_10976331 | 3300015258 | Soil | MKETAMTQALAEANIRVNGQDEPLVEATLAALLEEKAVDTGQ |
| Ga0182036_105492341 | 3300016270 | Soil | MTQAAIGANIRVNGENEPLVVATLAALLEEKAVDTGQR |
| Ga0182041_123442582 | 3300016294 | Soil | MTQAAIEANIRVNGENEPLAVATLAALLKEKAVDTGLRGIAVAVNGAIVPRA |
| Ga0182039_102034432 | 3300016422 | Soil | MMETAMAQTASQIWVNGQDELLGVATLAALLQEKAVDTGKRGIAVAVNGAIVPRA |
| Ga0182039_108780392 | 3300016422 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLDEKAVDT |
| Ga0187782_109763501 | 3300017975 | Tropical Peatland | MTQASIRVNGQIEPLLAATLASLLAEKEVDIGQRGIAVALNG |
| Ga0187769_100425381 | 3300018086 | Tropical Peatland | MSQATICVNGESEPLGAATLDALIADKAVDTAQRGIAVALN |
| Ga0190270_113232772 | 3300018469 | Soil | MTYAAAEASIRVNGQDEPLIAGTLAALLEEKAVDT |
| Ga0190274_116000971 | 3300018476 | Soil | MTQATLNAQIRVNGQDEPLQAATLGALLDEKAVDVAQKGIAVALNG |
| Ga0193697_11427932 | 3300020005 | Soil | MTQALAEANIRVNGQDEPLVAATLAALLEEKAVDTGQRGIAVAVNGA |
| Ga0210408_114726181 | 3300021178 | Soil | MSEAAAAANIRVNGETEPLTVATLAALLDEKALDT |
| Ga0210394_116152631 | 3300021420 | Soil | MTSSHTTPAAADASIRINGADEPLVAATLAALLEEKA |
| Ga0179589_104956012 | 3300024288 | Vadose Zone Soil | MSEAATAANIRVNGETEPLMVATLAALLEEKALDTSQR |
| Ga0207657_109438632 | 3300025919 | Corn Rhizosphere | MTQATLTAQIRVNGQDEPLGAATLAGLLDEKAVDTG |
| Ga0207676_103057771 | 3300026095 | Switchgrass Rhizosphere | MTQTLAEANIRVNGQDEPLVAATLAALLEEKAHDTGQRGIAV |
| Ga0207683_114406841 | 3300026121 | Miscanthus Rhizosphere | MTHAAAEANIRVNGQDEPLITATLAALLEEKAVDTGQR |
| Ga0209131_11978671 | 3300026320 | Grasslands Soil | MTQAAVEANIRVNGETEPLVVATLAALLEEKAVDIGQRG |
| Ga0257163_10871561 | 3300026359 | Soil | MKETATTQAAVQTNIRVNGLDEPLGVATLAALLEEKA |
| Ga0257156_10544962 | 3300026498 | Soil | MSEAATAANIRVNGETEPLMVATLAALLEEKALDPSQRGIAVAVNGV |
| Ga0257161_11097851 | 3300026508 | Soil | MTQAAVETNIRVNGETEPLLVATLAALLEEKAVDIG |
| Ga0208565_10951402 | 3300027662 | Peatlands Soil | MTQTLIRVNGESEPLAATTLEALLTNKAVDTGQRGIAV |
| Ga0307303_100903672 | 3300028713 | Soil | MTYAAAEASIRVNGQDEPLIAGTLAALLEEKAVDTGQRGIAVAVNGAI |
| Ga0307318_103353501 | 3300028744 | Soil | MTGAAVQANIRVNGQDEPLDVATLAALLAEKAVDTGQRGIA |
| Ga0307297_102250102 | 3300028754 | Soil | MTQALAEANIRVNGQDEPLVAATLAALLEEKAVDTGQRGI |
| Ga0307316_101306562 | 3300028755 | Soil | MTQTVAEANIRVNGQDEPLVAATLAALLEEKAVDTGQRGIAVAVNGAIV |
| Ga0307281_102152991 | 3300028803 | Soil | MTEAAVAASIRVNGVEEPLVVATLAALLDEKAVDTA |
| Ga0307305_105096652 | 3300028807 | Soil | MSEAAAEANIRVNGEPEPLMVATLAALLEEKAVDTS |
| Ga0307286_101429601 | 3300028876 | Soil | MTQTVAEANIRVNGQDEPLVAATLAALLEEKAVDTGQRGIAVAVNGAI |
| Ga0307278_105208582 | 3300028878 | Soil | MTQAATAAIIRVNGQDEPLAAATLAALLEEKAVDTGQRGIA |
| Ga0308198_10551681 | 3300030904 | Soil | MTYAAAEASIRVNGQDEPLIVGTLTALLEEKAVDTGQRGIAVAVNGAI |
| Ga0308199_10948691 | 3300031094 | Soil | MTQALAEANIRVNGQDEPLVAATLAALLEEKAVDT |
| Ga0308181_11377352 | 3300031099 | Soil | MTYAAAEASIRVNGQDEPLIAGTLATLLEDKAVDTGQRG |
| Ga0307501_100203601 | 3300031152 | Soil | MTYAAAEASIRVNGQDEPLIAGTLATLLEEKAVDTGQRGIAVAVNGAIV |
| Ga0318516_102066561 | 3300031543 | Soil | MTQAAVETNIRVNGETEPLLVTTLAALLEEKAVDI |
| Ga0318534_106763142 | 3300031544 | Soil | MTQAAVETNIRVNGKTEPLAVATLAALLEEKAVDIGQRG |
| Ga0318528_100217541 | 3300031561 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLDEKAVDTA |
| Ga0318573_102698612 | 3300031564 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLEEKAVDTAQRGIAVA |
| Ga0318573_102945232 | 3300031564 | Soil | MTQAAVETNIRVNGETEPLLVTTLAALLEEKAVDIGQRGIAVALNGAI |
| Ga0318515_100343113 | 3300031572 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLEEKAVDTAQRGIAVAVNG |
| Ga0318555_103230812 | 3300031640 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLEEKAVDTAQRGIAVAVN |
| Ga0307469_112404191 | 3300031720 | Hardwood Forest Soil | MSQGHIRINGQDEILSVPTLAALLEEKAVDTGQRGIAV |
| Ga0318493_105019802 | 3300031723 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLDEKAVDTAQRG |
| Ga0318493_106045272 | 3300031723 | Soil | MTQAAIEANIRVNGEDEPLTVATLAALLEEKAVDTGQRGIAVAINGA |
| Ga0318501_103381622 | 3300031736 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLDEKAVDSA |
| Ga0318502_101298611 | 3300031747 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLEEKAVDTAQRGIAVAVNGAIV |
| Ga0318492_102051612 | 3300031748 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLDEKAVDTAQ |
| Ga0318509_101909851 | 3300031768 | Soil | MAQATAQANIRVNGEIQPLVVATLAALLEEKAVDTGQRGIAVAVNGAIV |
| Ga0318526_103115321 | 3300031769 | Soil | MTQAPSIRINGEDEPLVAATLAALLEDKAIDTAQRGIAV |
| Ga0318521_102525391 | 3300031770 | Soil | MAQATAQANIRVNGEIQPLVVATLAALLEEKAVDTGQRGS |
| Ga0318546_105039031 | 3300031771 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLEEKAVDTAQRGIA |
| Ga0318547_101048681 | 3300031781 | Soil | MAQATAEANIRVNGEIQPLVVATLAALLEEKAVDTGQRGIAVAVNGAI |
| Ga0318529_102966061 | 3300031792 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLEEKAVDTAQRGFAVAVN |
| Ga0318529_103403931 | 3300031792 | Soil | MTQAAVETNIRVNGETEPLLVATLAALLEEKAVDIGQRGIAVALNGA |
| Ga0318503_101647071 | 3300031794 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLEEKAVDTA |
| Ga0318576_104481902 | 3300031796 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLDEKAVDTAHRG |
| Ga0318523_104994301 | 3300031798 | Soil | MTQAEVPTSIRVNGRDERLAVVTLAALLQEKAVDTGRRGIAVALN |
| Ga0318565_102679051 | 3300031799 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLDEKAVDTAQRGIAVAVNGAI |
| Ga0318517_105383462 | 3300031835 | Soil | MTQAAIGANIRVNGENEPLVVATLAALLEEKAVDTGQRGIAVAINGG |
| Ga0318517_105866782 | 3300031835 | Soil | MTQAPSIRINGQDEPLAAATLAALLEDKAIDTAQRGIA |
| Ga0318512_107177802 | 3300031846 | Soil | MTQAPSIRINGQDEPLAAATLAALLEDKAIDTAQRGI |
| Ga0318544_103731482 | 3300031880 | Soil | MTQAAIGANIRVNGENEPLVVATLAALLEEKAVDTGQRGI |
| Ga0310884_110724762 | 3300031944 | Soil | MTQTLAEANIRVNGQDEPLVAATLAALLEEKALDT |
| Ga0310913_105544951 | 3300031945 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLDEKAVDTAQR |
| Ga0318531_101054421 | 3300031981 | Soil | MTQAAVETNIRVNGETEPLLVATLAALLEEKAVDIGQRGTMAPL |
| Ga0318531_102911481 | 3300031981 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLDEKAVDTAQRGIA |
| Ga0306922_116026771 | 3300032001 | Soil | MTQAAIEANIRVNGENEPLAVATLAALLKEKAVDTGQRGIA |
| Ga0318563_106549971 | 3300032009 | Soil | MTQTAAAPASIRVNGQDEPLSVATLLALLEEKAVDTGQRGIAVALNG |
| Ga0310902_110098031 | 3300032012 | Soil | MTHAAAEANIRVNGQDEPLIAATLAALLEEKAVDT |
| Ga0318545_103737882 | 3300032042 | Soil | MTQAPSIRINGEDEPLVAATLAALLEDKAIDTAQRGIAVALN |
| Ga0318570_102900711 | 3300032054 | Soil | MTQAAVETNIRVNGETEPLLVATLAALLEEKAVDIGQRGIAVALN |
| Ga0318575_106618361 | 3300032055 | Soil | MTQAAVETNIRVNGETEPLAVATLAALLEEKAVDV |
| Ga0318504_105002692 | 3300032063 | Soil | MTQAAQIRVNGQDELLGVATLAALFEEKAIDTGQRGIAVAVNG |
| Ga0318510_102535901 | 3300032064 | Soil | MTQAAVEANIRVNGETEPLLVATLAALLDEKAVDSAQ |
| Ga0247829_101658223 | 3300033550 | Soil | MTHAAAEANIRVNGQDEPLIAATLAALLEEKAVDTGQRGIAVAVNGAIV |
| ⦗Top⦘ |