 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F075015 |
| Family Type | Metagenome |
| Number of Sequences | 119 |
| Average Sequence Length | 54 residues |
| Representative Sequence | MADKLSDKEIERRKQQAALKAAQPKPHENFLQAKGGGKHGPKPPKARMQRHQGR |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 93.75 % |
| % of genes near scaffold ends (potentially truncated) | 3.36 % |
| % of genes from short scaffolds (< 2000 bps) | 20.17 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (89.076 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (10.924 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.269 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (86.555 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.93% β-sheet: 0.00% Coil/Unstructured: 67.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF08281 | Sigma70_r4_2 | 5.88 |
| PF13411 | MerR_1 | 3.36 |
| PF01844 | HNH | 2.52 |
| PF13414 | TPR_11 | 1.68 |
| PF00593 | TonB_dep_Rec | 1.68 |
| PF01872 | RibD_C | 1.68 |
| PF00072 | Response_reg | 0.84 |
| PF07883 | Cupin_2 | 0.84 |
| PF13432 | TPR_16 | 0.84 |
| PF12686 | DUF3800 | 0.84 |
| PF00515 | TPR_1 | 0.84 |
| PF02798 | GST_N | 0.84 |
| PF02518 | HATPase_c | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.68 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 89.08 % |
| All Organisms | root | All Organisms | 10.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004463|Ga0063356_101227507 | Not Available | 1091 | Open in IMG/M |
| 3300005327|Ga0070658_10034629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4063 | Open in IMG/M |
| 3300005335|Ga0070666_10544766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300005338|Ga0068868_102302889 | Not Available | 514 | Open in IMG/M |
| 3300005347|Ga0070668_101075071 | Not Available | 725 | Open in IMG/M |
| 3300005354|Ga0070675_100143297 | Not Available | 2044 | Open in IMG/M |
| 3300005354|Ga0070675_101900117 | Not Available | 549 | Open in IMG/M |
| 3300005356|Ga0070674_100147502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1772 | Open in IMG/M |
| 3300005367|Ga0070667_100120594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 2281 | Open in IMG/M |
| 3300005456|Ga0070678_100668484 | Not Available | 933 | Open in IMG/M |
| 3300005456|Ga0070678_101459282 | Not Available | 640 | Open in IMG/M |
| 3300005459|Ga0068867_101612782 | Not Available | 607 | Open in IMG/M |
| 3300005535|Ga0070684_100618178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1008 | Open in IMG/M |
| 3300005719|Ga0068861_102038426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300009148|Ga0105243_10487107 | Not Available | 1165 | Open in IMG/M |
| 3300009176|Ga0105242_10088669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 2599 | Open in IMG/M |
| 3300009551|Ga0105238_10156539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2253 | Open in IMG/M |
| 3300009553|Ga0105249_12634341 | Not Available | 575 | Open in IMG/M |
| 3300011119|Ga0105246_11114759 | Not Available | 721 | Open in IMG/M |
| 3300012907|Ga0157283_10216387 | Not Available | 614 | Open in IMG/M |
| 3300013297|Ga0157378_10376173 | Not Available | 1394 | Open in IMG/M |
| 3300014968|Ga0157379_10005311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11065 | Open in IMG/M |
| 3300014969|Ga0157376_10720256 | Not Available | 1004 | Open in IMG/M |
| 3300015371|Ga0132258_10991974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2122 | Open in IMG/M |
| 3300025904|Ga0207647_10301839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 912 | Open in IMG/M |
| 3300025926|Ga0207659_10370659 | Not Available | 1192 | Open in IMG/M |
| 3300025931|Ga0207644_11202372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 637 | Open in IMG/M |
| 3300025934|Ga0207686_10231111 | Not Available | 1341 | Open in IMG/M |
| 3300025935|Ga0207709_10352922 | Not Available | 1111 | Open in IMG/M |
| 3300025972|Ga0207668_10628136 | Not Available | 938 | Open in IMG/M |
| 3300028379|Ga0268266_10037395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4136 | Open in IMG/M |
| 3300028379|Ga0268266_10448581 | Not Available | 1226 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 10.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 10.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.88% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.04% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.04% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 3.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.68% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.68% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.84% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.84% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.84% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Host-Associated | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| rootH2_102120877 | 3300003320 | Sugarcane Root And Bulk Soil | MADKLSDKEIERRKQQAAQSAAAPKSHEAMLAKGGKQGHKQMASKGRDFRHQGR* |
| Ga0062593_1026291541 | 3300004114 | Soil | MTDKLSDKEIERRKKQAELNAGAPKPHENFLQAGGKGKPGGPKSPKGRMFRHQGR* |
| Ga0063356_1012275074 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAEKLSDKEIERRKKQAELNAAAPKPHANFMQEKGGKGGPKPPKARMQRHQGR* |
| Ga0070658_100346298 | 3300005327 | Corn Rhizosphere | MADKLSDKEIERRKQQAALKAAQPKPHENFVQSKGGKSGPKPPKARMQRHQGR* |
| Ga0070658_104347391 | 3300005327 | Corn Rhizosphere | MADKLSDKEIERRKKQAEQNAAPPKPHENLAQAKGKQGHAQMTAKGRNFRHQGR* |
| Ga0070676_110744622 | 3300005328 | Miscanthus Rhizosphere | MADKLSDKEIERRKQQAALKAAAPKPHENFVQAKPGKGPKPPKARMQRHQGR* |
| Ga0070683_1001693763 | 3300005329 | Corn Rhizosphere | MADKLSDKEIERRKKQAEQNAAPPKPHENLAQAKGKHGHAQMTAKGRNFRHQGR* |
| Ga0070683_1007463763 | 3300005329 | Corn Rhizosphere | MADKLSDKEIERRKQQAAQNAAAPKPHENMLQTKGGKHAGPKSPKGRMFRHQGR* |
| Ga0068869_1001041474 | 3300005334 | Miscanthus Rhizosphere | LADKLSDKEIERRKKQAAQSAPKPHENLAQAKGKQGHAQMASKGRNFRHQGR* |
| Ga0070666_105447662 | 3300005335 | Switchgrass Rhizosphere | MADKLSDKEIERRKQQAALKAATPKPHENFVLARPGKGPKPPKARMQRHQGR* |
| Ga0070682_1013508291 | 3300005337 | Corn Rhizosphere | MADKLSEKEIERRRQQAALKAAGPKPHENFVQSKGGKPGPKPPKARMQRHQGR* |
| Ga0068868_1023028891 | 3300005338 | Miscanthus Rhizosphere | MADKLSDKEIERRKQQAALKAATPKPHENFVQARPGKAPKPPKARMQRH |
| Ga0070668_1010750711 | 3300005347 | Switchgrass Rhizosphere | MTDKLSDKEIERRKQQAAQSAPKPHENLAQAKGKPGHGQIAAKGRNFRHQGR* |
| Ga0070675_1001432974 | 3300005354 | Miscanthus Rhizosphere | MADKLSDKEIERRKKQAELNAAAAKPHENFLATKGGGKHGPKPPKARMQRHQGR* |
| Ga0070675_1019001171 | 3300005354 | Miscanthus Rhizosphere | MAEKLSDKEIERRKKQAALNAAAPKPHENFAPGKGGGKHGPKPPKAR |
| Ga0070674_1001475023 | 3300005356 | Miscanthus Rhizosphere | MAEKLSDKEIERRKKQAALNAAAPKPHENFAAGKGGGKHGPKPPKARMQRHQGR* |
| Ga0070673_1010410651 | 3300005364 | Switchgrass Rhizosphere | VHFTMADKLSDKEIERRKQQAALKAAQPKPHENFVQSKGGKSGPKPPKARMQRHQGR* |
| Ga0070688_1002440804 | 3300005365 | Switchgrass Rhizosphere | MTDKLSDKEIERRKKQAEMNAAAPKPHENLAQAKGKHGHNQLASKGRNFRHQGR* |
| Ga0070667_1001205946 | 3300005367 | Switchgrass Rhizosphere | MPDKLSDKEIERRKQQAALKAATPKPHENFVQAKPGKGPKPPKARMQRHQGR* |
| Ga0070663_1019215402 | 3300005455 | Corn Rhizosphere | DKLSDKEIERRKKQAELNAGAPKPHENFLQAGGKGKPGGPKSPKGRMFRHQGR* |
| Ga0070678_1006684843 | 3300005456 | Miscanthus Rhizosphere | MADKLSDKEIERRKKQAELNAAAPKPHANFTQEKGGKGGPKPPKARMQRHQGR* |
| Ga0070678_1012646563 | 3300005456 | Miscanthus Rhizosphere | MADKLSDKEIERRKQQAALKAAQPKPHENFLAAKGGGKHGPKPPKARMQRHQGR* |
| Ga0070678_1014592821 | 3300005456 | Miscanthus Rhizosphere | MADKLSDKEIERRKQQAAQNAAAPKPHENMPQTKGGKHGGPKSPKGRMFRHQ |
| Ga0070681_114739662 | 3300005458 | Corn Rhizosphere | MADKLSDKEIERRKKQAEQNAAPPKPHETLAQAKGKHGHAQMTAKGRNFRHQGR* |
| Ga0068867_1016127822 | 3300005459 | Miscanthus Rhizosphere | MADKLSDKEIERRKQQAAQNAAAPKPHENMPQTKGGKHGGPKSPKGRMFRHQGR* |
| Ga0077121_105319452 | 3300005511 | Arabidopsis Rhizosphere | MAEKLSDKEIERRKKQAEMNAAAPKPHENFQQFGGKGKSGPKQAKARIQRHQGR* |
| Ga0070684_1006181781 | 3300005535 | Corn Rhizosphere | MTDKLSDKEIERRKKQAEMNAAAPKPHDAMLQAKGKQGHKQMASKGRDFRHQGR* |
| Ga0068853_1015212603 | 3300005539 | Corn Rhizosphere | DKLSDKEIERRKKQAEMNAAAPKPHDAMLQAKGKQGHKQMASKGRDFRHQGR* |
| Ga0070693_1011259792 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DKLSDKEIERRKKQAEQNAAPPKPHENLAQAKGKHGHAQMTAKGRNFRHQGR* |
| Ga0070665_1002575924 | 3300005548 | Switchgrass Rhizosphere | MADKLSDKEIERRKQQAALKAAAPKPHEAFLNGGGKGKAGHQQPLAKGRNFRHQGR* |
| Ga0068854_1001365291 | 3300005578 | Corn Rhizosphere | KLSDKEIERRKQQAAQNAAAPKPHENMLQTKGGKHAGPKSPKGRMFRHQGR* |
| Ga0070702_1009149931 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDKLSDKEIERRKQQAALKAAQPKPHENFLAAKGGGKHGPKPPKARMQRHQGR* |
| Ga0070702_1012796482 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLADKLSDKEIERRKKQAEQNAAPPKPHENLAQAKGKQGHAQMTAKGRNFRHQGR* |
| Ga0068861_1020384262 | 3300005719 | Switchgrass Rhizosphere | MADKLSDKEIERRKQQAALKAATPKPHENFVQAKPGKGPKPPKARMQRHQGR* |
| Ga0068870_105105381 | 3300005840 | Miscanthus Rhizosphere | EIERRKKQAAQSAPKPHENLAQAKGKQGHAQMASKGRNFRHQGR* |
| Ga0068863_1024450393 | 3300005841 | Switchgrass Rhizosphere | LSDKEIERRKQQAALKAAQPKPHENFVQSKGGKSGPKPPKARMQRHQGR* |
| Ga0068858_1020615652 | 3300005842 | Switchgrass Rhizosphere | MPDKLSDKEIERRKQQAALKAATPKPHENFVQAGAKGKAGAKSPKGRIFRHQGR* |
| Ga0068858_1025949502 | 3300005842 | Switchgrass Rhizosphere | MADKLSEKEIERRKQQAALKAAGPKPHENFVQSKGGKSGPKPPKARMQRHQGR* |
| Ga0068860_1015937631 | 3300005843 | Switchgrass Rhizosphere | KLSDKEIERRKQQAALKAAAPKPHENFVQAKPGKGPKPPKARMQRHQGR* |
| Ga0068862_1018291032 | 3300005844 | Switchgrass Rhizosphere | MADKLSDKEIERRKKQAELNAATSKPHENFLGAKGGGKHGPKPPKARMQRHQGR* |
| Ga0081455_101342812 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MADKLSDKEIERRKQQAAQSSPKPHEAFLAQAKGKQGHKQMASKGRDFRHQGR* |
| Ga0066652_1012664072 | 3300006046 | Soil | MTDKLSDKEIERRKQQAALKAAQPKPHENFVQSKGGKSGPKPPKARMQRHQGR* |
| Ga0097621_1001812712 | 3300006237 | Miscanthus Rhizosphere | MADKKLSDKEIERRKQASLKAAAPKPHENFAPGKGGGGKQGPKPPKARMQRHQGR* |
| Ga0097621_1023107021 | 3300006237 | Miscanthus Rhizosphere | MADKLSDKEIERRKQQAALKAAGPKPHENFVQSKGGKSGPKPPKARM |
| Ga0068871_1011638373 | 3300006358 | Miscanthus Rhizosphere | ERRKQQAAQNAAAPKPHENMPQTKGGKHGGPKSPKGRMFRHQGR* |
| Ga0105240_111730763 | 3300009093 | Corn Rhizosphere | MSFMADKLSDKEIERRKKQAEMNASAPKGHEAFQQFGGKGKSGPKQPKARIQRHQGR* |
| Ga0105240_114212642 | 3300009093 | Corn Rhizosphere | MADKLSDKEIERRKKQAEMNASAPKGHEAFQQFGGKGKSGPKQPKARIQRHQGR* |
| Ga0105245_110916123 | 3300009098 | Miscanthus Rhizosphere | DKEIERSKKQAEQNAAPPKPHENLAQAKGKHGHAQMTAKGRNFRHQGR* |
| Ga0105247_103221711 | 3300009101 | Switchgrass Rhizosphere | MRLADKLSDKEIERRKKQAAQSAHKPHENLAQAKGKQGHAQMASK |
| Ga0105243_104871073 | 3300009148 | Miscanthus Rhizosphere | MADKLSEKEIERRRQQAALKAAGPKPHENFVQSKGGKSGPKPPKARMQRHQGR* |
| Ga0111538_128588841 | 3300009156 | Populus Rhizosphere | MADKLSDKEIERRKKQAELNAAASKPHENFLATKGGGKHGPKPPKARMQRHQGR* |
| Ga0105241_100920192 | 3300009174 | Corn Rhizosphere | MRLADKLSDKEIERRKKQAAQSAPKPHENLAQAKGKQGHAQMASKGRNFRHQGR* |
| Ga0105241_104659261 | 3300009174 | Corn Rhizosphere | YFNEFRPNKEVYFTMSDKLSDKEIERRKQQAALKAAQPKPHENFLAAKGGGKHGPKPPKARMQRHQGR* |
| Ga0105242_100886693 | 3300009176 | Miscanthus Rhizosphere | MADKLSEKEIERRKQQAALKAAGPKPHENFVQSKGGKSGPKPLKARMQRHQGR* |
| Ga0105237_100748615 | 3300009545 | Corn Rhizosphere | LADKLSDKEIERRKQQAAQNAAAPKPHEAMLQAKGSKQGHKQMASKGRDFRHQGR* |
| Ga0105238_101159631 | 3300009551 | Corn Rhizosphere | QDAFMADKLSDKEIERRKQQAAQNAAAPKPHENMLQTKGGKHAGPKSPKGRMFRHQGR* |
| Ga0105238_101565392 | 3300009551 | Corn Rhizosphere | MADKLSDKEIERRKKQAEMNASAPKGHEAFQQFGGKGKSGPKPAKARMQRHQGR* |
| Ga0105238_103021021 | 3300009551 | Corn Rhizosphere | PGGVFRMADKLSDKEIERRKQQAALKAAQPKPHENFVQSKGGKSGPKPPKARMQRHQGR* |
| Ga0105238_119288551 | 3300009551 | Corn Rhizosphere | MADKLSDKEIERRKQQAALKAAAPKPHEAFLQAGGKGKAGHQQPLAKG |
| Ga0105249_121302863 | 3300009553 | Switchgrass Rhizosphere | MTDKLSDKEIERRKKQAELNAGEPKPHENFLQAGGKGKPGGPKSPKG |
| Ga0105249_126343412 | 3300009553 | Switchgrass Rhizosphere | MADKLSDKEIERRKQQAALKAATPKPHENFVQAGAKGKAGAKSPKGRIFRHQGR* |
| Ga0116249_102844754 | 3300010357 | Anaerobic Digestor Sludge | MADKLSDQEIERRKKQAALAASAPKPHENFQGKGGGGGKHGPKTPKARIQRHQGR* |
| Ga0126377_135744652 | 3300010362 | Tropical Forest Soil | MADKLSDKEIERRKQASLKAQAAKPHEAFVQPGGKGKGGHPQQIAKGRNFRHQGR* |
| Ga0105246_111147591 | 3300011119 | Miscanthus Rhizosphere | MADKLSEKEIERRKQQAALKAAGPKPHENFVQSKGGKSGPKPPKARMQRHQG |
| Ga0150985_1013536041 | 3300012212 | Avena Fatua Rhizosphere | MTDKLSDKEIERRKQQAALAAAPKPHEAQLSKNAGKHGPKPPKARMQRHQGR* |
| Ga0157283_102163871 | 3300012907 | Soil | MADKLSDKEIQRRKKQAELNAAAAKPHENFLATKGGGKHGPKPPKARMQRHQGR* |
| Ga0157298_104348051 | 3300012913 | Soil | DGHQADAQTLSAQQGGVFTMADKLSDKEIERRKKQAELNAAAPKPHANFTQEKGGKGGPKPPKARMQRHQGR* |
| Ga0137413_110545812 | 3300012924 | Vadose Zone Soil | MADKLSDKEIERRKQQAALKAAAPKPHEAFLQSKGGGKNGPKPLKARM |
| Ga0154020_110247393 | 3300012956 | Active Sludge | MADKLSDKEIERRKKQAELNAAAPKAHGNFVQDKGGKGGSKQPKARIQRHQGR* |
| Ga0157373_105849581 | 3300013100 | Corn Rhizosphere | TKQDAFMADKLSDKEIERRKQQAAQNAAAPKPHENMLQTKGGKHAGPKSPKGRMFRHQGR |
| Ga0157371_109444972 | 3300013102 | Corn Rhizosphere | DKEIERRKKQAEQNAAPPKPHENLAQAKGKHGHAQMTAKGRNFRHQGR* |
| Ga0157374_113973791 | 3300013296 | Miscanthus Rhizosphere | SMADKLSDKEIERRKQQAAQNAAAPKPHENMPQTKGGKHGGPKSPKGRMFRHQGR* |
| Ga0157378_103761733 | 3300013297 | Miscanthus Rhizosphere | VNFTMADKLSDKEIERRKQQAALKAAQPKPHENFVQAKGGKSGPKPPKARMQRHQGR* |
| Ga0163162_100336817 | 3300013306 | Switchgrass Rhizosphere | MADKLSDKEIERRKQQAALKAAAPKPHEAFLQAGGKGKAGHQQPLAKGRNFRHQGR* |
| Ga0163162_109309332 | 3300013306 | Switchgrass Rhizosphere | LTDKLSDKEIERRKKQAAQNAAASKPHENLAQAKGKQGHAQMASKGRNFRHQGR* |
| Ga0163162_122021912 | 3300013306 | Switchgrass Rhizosphere | MCFAMTDKLSDKEIERRKQQAALKAAAPKPHENFVQAKPGKGPKPPKARMQ |
| Ga0157379_1000531110 | 3300014968 | Switchgrass Rhizosphere | MADKLSDKEIERRKQQAALKAAAPKPHEAFLQANGKGKAGHQQPLAKGRNFRHQGR* |
| Ga0157376_107202562 | 3300014969 | Miscanthus Rhizosphere | VYFTMSDKLSDKEIERRKQQAALKAAQPKPHENFLAAKGGGKHGPKPPKARMQRHQGR* |
| Ga0137409_108682771 | 3300015245 | Vadose Zone Soil | MADKLSDKEIERRKQQAALKAAQPKPHENFVQGKGGKSGPKPPKARMQRHQGR* |
| Ga0132258_109919743 | 3300015371 | Arabidopsis Rhizosphere | MTDKLSDKEIERRKKQAELNAAAPKPHENFLQAGGKGKPGGPKSPKGRMFRHQGR* |
| Ga0132255_1044819121 | 3300015374 | Arabidopsis Rhizosphere | MADKLSDKEIERRKQQAALKAAQPKPHENFLQAKGGGKHGPKPPKARMQRHQGR* |
| Ga0182035_116309792 | 3300016341 | Soil | MVEAPGHRSRRLADKLSDKEIERRKQQAALNAASPKPHENLAQAKGKPGHKQMMSKGRDFRHQGR |
| Ga0163161_115437602 | 3300017792 | Switchgrass Rhizosphere | MADKLSDKEIERRKKQAEQNAAPPKPHENLAQAKGKHGHAQMTAKGRNFRHQGR |
| Ga0173479_107290971 | 3300019362 | Soil | MADKLSDKEIERRKQQAALKAAAPKPHENFVQAKPGKGPKPPKARMQRHQGR |
| Ga0193753_100763066 | 3300020034 | Soil | MADKLSDKEIERRKKQAVLNAAPPKPHENFAQAKGGKSGPKPPKNRMQRHQGR |
| Ga0163151_104001202 | 3300020057 | Freshwater Microbial Mat | MADKLSDKEIERRKQQAALKAAAPKPHENFVQAKGGKSGPKPPKNRMQRHQGR |
| Ga0179589_104394712 | 3300024288 | Vadose Zone Soil | MADKLSDKEIERRKQQAALKAAQPKPHESFVQAKGKSGPKPPKARMQRHQGR |
| Ga0207680_101424756 | 3300025903 | Switchgrass Rhizosphere | MADKLSDKEIERRKQQAALKAAQPKPHENFVQSKGGKSGPKPPKARMQRHQGR |
| Ga0207647_103018391 | 3300025904 | Corn Rhizosphere | MTDKLSDKEIERRKKQAEMNAAAPKPHDAMLQAKGKQGHKQMASKGRDFRHQGR |
| Ga0207643_102619174 | 3300025908 | Miscanthus Rhizosphere | RSMRLADKLSDKEIERRKKQAAQSAPKPHENLAQAKGKQGHAQMASKGRNFRHQGR |
| Ga0207654_106276881 | 3300025911 | Corn Rhizosphere | MADKLSDKEIERRKQQAAQNAAAPKPHENMLQTKGGKHAGPKSPKGRMFRHQGR |
| Ga0207707_114020482 | 3300025912 | Corn Rhizosphere | MADKLSDKEIERRKKQAEQNAAPPKPHETLAQAKGKHGHAQMTAKGRNFRHQGR |
| Ga0207695_110992823 | 3300025913 | Corn Rhizosphere | MADKLSDKEIERRKKQAEMNASAPKGHEAFQQFGGKGKSGPKQPKARIQRHQGR |
| Ga0207694_100219464 | 3300025924 | Corn Rhizosphere | MRLADKLSDKEIERRKKQAAQSAPKPHENLAQAKGKQGHAQMASKGRNFRHQGR |
| Ga0207694_111183013 | 3300025924 | Corn Rhizosphere | MADKLSDKEIERRKQQAALKAAGPKPHENFVQSKAGKSGPKPPKARMQRHQGR |
| Ga0207650_118635822 | 3300025925 | Switchgrass Rhizosphere | MADKLSDKEIERRKKQAAQSAPKPHENLAQAKGKQGHAQMASKGRNFRHQGR |
| Ga0207659_103706591 | 3300025926 | Miscanthus Rhizosphere | MADKLSDKEIERRKKQAELNAAASKPHENFLATKGGGKHGPKPPKARMQRHQGR |
| Ga0207664_119535031 | 3300025929 | Agricultural Soil | VSSMADKLSDKEIERRKQQAAQNAAAPKPHEAMLQAKGGKQGHKQMAAKGRDFRHQGR |
| Ga0207644_112023722 | 3300025931 | Switchgrass Rhizosphere | MADKLSDKEIERRKQQAALKAATPKPHENFVLARPGKGPKPPKARMQRHQGR |
| Ga0207686_102311113 | 3300025934 | Miscanthus Rhizosphere | MADKLSEKEIERRKQQAALKAAGPKPHENFVQSKGGKSGPKPLKARMQRHQGR |
| Ga0207709_103529223 | 3300025935 | Miscanthus Rhizosphere | MADKLSEKEIERRRQQAALKAAGPKPHENFVQSKGGKSGPKPPKARMQRHQGR |
| Ga0207709_104132444 | 3300025935 | Miscanthus Rhizosphere | MADKKLSDKEIERRKQASLKAAAPKPHENFAPGKGGGGKQGPKPPKARMQRHQGR |
| Ga0207691_108073682 | 3300025940 | Miscanthus Rhizosphere | MADKLSEKEIERRRQQAALKAAGPKPHENFLATKGGGKHGPKPPKARMQRHQGR |
| Ga0207651_119312773 | 3300025960 | Switchgrass Rhizosphere | DKLSDKEIERRKQQAAQNAAAPKPHENMPQTKGGKHGGPKSPKGRMFRHQGR |
| Ga0207712_107343743 | 3300025961 | Switchgrass Rhizosphere | MTDKLSDKEIERRKKQAEMNAAAPKPHENLAQAKGKHGHNQLASKGRNFRHQGR |
| Ga0207668_106281362 | 3300025972 | Switchgrass Rhizosphere | MTDKLSDKEIERRKQQAAQSAPKPHENLAQAKGKPGHGQIAAKGRNFRHQGR |
| Ga0207639_102245131 | 3300026041 | Corn Rhizosphere | MADKLSDKEIERRKKQAELNAAAPKPHEAMLAGNKGKQGHAQIASKGRNFRHQGR |
| Ga0207678_105610212 | 3300026067 | Corn Rhizosphere | MSDKLSDKEIERRKKQAELNAGAPKPHENFLQAGGKGKPGGPKSPKGRMFRHQGR |
| Ga0207683_117578102 | 3300026121 | Miscanthus Rhizosphere | MADKLSDKEIERRKQQAALKAAQPKPHENFLAAKGGGKHGPKPPKARMQRHQGR |
| Ga0268266_100373955 | 3300028379 | Switchgrass Rhizosphere | MPDKLSDKEIERRKQQAALKAATPKPHENFVQAKPGKGPKPPKARMQRHQGR |
| Ga0268266_104485812 | 3300028379 | Switchgrass Rhizosphere | MAEKLSDKEIERRKKQAALNAAAPKPHENFAAGKGGGKHGPKPPKARMQRHQGR |
| Ga0268266_105966942 | 3300028379 | Switchgrass Rhizosphere | MADKLSDKEIERRKQQAALKAAAPKPHEAFLNGGGKGKAGHQQPLAKGRNFRHQGR |
| Ga0268264_102580643 | 3300028381 | Switchgrass Rhizosphere | LADKLSDKEIERRKKQAAQSAPKPHENLAQAKGKQGHAQMASKGRNFRHQGR |
| Ga0268264_117795171 | 3300028381 | Switchgrass Rhizosphere | MADKLSDKEIERRKQQAALKAATPKPHENFVQAKPGKGPKPPKARMQRHQGR |
| Ga0307517_102307981 | 3300028786 | Ectomycorrhiza | MHLTMADKLSDKEIERRKQQAALKAAQPKPHENFVQAKPGKGPKQPKARIQRHQGR |
| Ga0315912_115811322 | 3300032157 | Soil | MADKLSDKEIERRKKQAEMNAAAPKPHANFLQDKGGKGGPKPPKARMQRHQGR |
| Ga0307510_105052853 | 3300033180 | Ectomycorrhiza | MADKLSDKEIERRKQQAALKAAQPKPHENFVQAKPGKGPKPPKARMQRHQGR |
| Ga0310810_106463373 | 3300033412 | Soil | MTDKLSDKEIERRKKQAELNAAAPKPHENFLQAGGKGKPGGPKSPKGRMFRHQGR |
| Ga0310811_1000922211 | 3300033475 | Soil | MTDKLSDKEIERRKKQAELNAGAPKPHENFLQAGGKGKPGGPKSPKGRMFRHQGR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |