| Basic Information | |
|---|---|
| Family ID | F074973 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRHMVLNS |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 48.74 % |
| % of genes near scaffold ends (potentially truncated) | 98.32 % |
| % of genes from short scaffolds (< 2000 bps) | 84.87 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.664 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (15.126 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.303 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (76.471 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.39% β-sheet: 0.00% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00462 | Glutaredoxin | 12.61 |
| PF00733 | Asn_synthase | 6.72 |
| PF14090 | HTH_39 | 5.04 |
| PF01555 | N6_N4_Mtase | 3.36 |
| PF09834 | DUF2061 | 2.52 |
| PF11753 | DUF3310 | 0.84 |
| PF00296 | Bac_luciferase | 0.84 |
| PF09837 | DUF2064 | 0.84 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 3.36 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 3.36 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 3.36 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.66 % |
| All Organisms | root | All Organisms | 40.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10066985 | Not Available | 1681 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10060387 | Not Available | 1597 | Open in IMG/M |
| 3300000949|BBAY94_10145458 | Not Available | 644 | Open in IMG/M |
| 3300001344|JGI20152J14361_10109188 | All Organisms → Viruses | 539 | Open in IMG/M |
| 3300004790|Ga0007758_10018634 | Not Available | 510 | Open in IMG/M |
| 3300004810|Ga0007757_11491009 | Not Available | 613 | Open in IMG/M |
| 3300006329|Ga0068486_1099974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 545 | Open in IMG/M |
| 3300006350|Ga0099954_1030386 | Not Available | 1060 | Open in IMG/M |
| 3300006351|Ga0099953_1082153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 603 | Open in IMG/M |
| 3300006735|Ga0098038_1018381 | All Organisms → Viruses → Predicted Viral | 2677 | Open in IMG/M |
| 3300006735|Ga0098038_1085051 | Not Available | 1105 | Open in IMG/M |
| 3300006737|Ga0098037_1059483 | Not Available | 1364 | Open in IMG/M |
| 3300006802|Ga0070749_10016155 | All Organisms → Viruses → Predicted Viral | 4756 | Open in IMG/M |
| 3300006802|Ga0070749_10110819 | All Organisms → Viruses | 1617 | Open in IMG/M |
| 3300006802|Ga0070749_10298477 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 904 | Open in IMG/M |
| 3300006802|Ga0070749_10527734 | Not Available | 641 | Open in IMG/M |
| 3300006868|Ga0075481_10254583 | Not Available | 618 | Open in IMG/M |
| 3300006869|Ga0075477_10042192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2054 | Open in IMG/M |
| 3300006920|Ga0070748_1262909 | All Organisms → Viruses | 619 | Open in IMG/M |
| 3300007345|Ga0070752_1341564 | Not Available | 563 | Open in IMG/M |
| 3300007960|Ga0099850_1075729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1407 | Open in IMG/M |
| 3300009000|Ga0102960_1358001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300009001|Ga0102963_1149989 | Not Available | 940 | Open in IMG/M |
| 3300009074|Ga0115549_1251720 | Not Available | 559 | Open in IMG/M |
| 3300009193|Ga0115551_1453477 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 548 | Open in IMG/M |
| 3300009435|Ga0115546_1027513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2326 | Open in IMG/M |
| 3300009435|Ga0115546_1261321 | Not Available | 592 | Open in IMG/M |
| 3300009449|Ga0115558_1193623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 841 | Open in IMG/M |
| 3300009512|Ga0115003_10808257 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | 545 | Open in IMG/M |
| 3300010160|Ga0114967_10346120 | Not Available | 752 | Open in IMG/M |
| 3300010300|Ga0129351_1065681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1476 | Open in IMG/M |
| 3300010300|Ga0129351_1065998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1472 | Open in IMG/M |
| 3300010368|Ga0129324_10188768 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | 842 | Open in IMG/M |
| 3300012919|Ga0160422_10735131 | Not Available | 631 | Open in IMG/M |
| 3300012954|Ga0163111_11670491 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 634 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10533084 | Not Available | 640 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10569037 | Not Available | 719 | Open in IMG/M |
| 3300017697|Ga0180120_10187816 | Not Available | 861 | Open in IMG/M |
| 3300017723|Ga0181362_1065456 | Not Available | 742 | Open in IMG/M |
| 3300017726|Ga0181381_1058931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 834 | Open in IMG/M |
| 3300017727|Ga0181401_1017519 | All Organisms → Viruses → Predicted Viral | 2178 | Open in IMG/M |
| 3300017738|Ga0181428_1162357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 522 | Open in IMG/M |
| 3300017759|Ga0181414_1177892 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 553 | Open in IMG/M |
| 3300017760|Ga0181408_1131386 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 647 | Open in IMG/M |
| 3300017767|Ga0181406_1070589 | Not Available | 1068 | Open in IMG/M |
| 3300017773|Ga0181386_1078757 | Not Available | 1039 | Open in IMG/M |
| 3300017776|Ga0181394_1257302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300017782|Ga0181380_1022957 | All Organisms → Viruses → Predicted Viral | 2313 | Open in IMG/M |
| 3300017784|Ga0181348_1143283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300017949|Ga0181584_10064413 | Not Available | 2560 | Open in IMG/M |
| 3300017949|Ga0181584_10641958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300017967|Ga0181590_10061959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 2973 | Open in IMG/M |
| 3300017969|Ga0181585_10454548 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 866 | Open in IMG/M |
| 3300018416|Ga0181553_10721893 | Not Available | 520 | Open in IMG/M |
| 3300018418|Ga0181567_10048836 | All Organisms → Viruses → Predicted Viral | 2969 | Open in IMG/M |
| 3300018420|Ga0181563_10335148 | Not Available | 876 | Open in IMG/M |
| 3300018421|Ga0181592_10878163 | Not Available | 585 | Open in IMG/M |
| 3300018421|Ga0181592_11071808 | Not Available | 516 | Open in IMG/M |
| 3300018428|Ga0181568_10473129 | Not Available | 1001 | Open in IMG/M |
| 3300018428|Ga0181568_10620767 | Not Available | 851 | Open in IMG/M |
| 3300019784|Ga0181359_1136229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
| 3300019937|Ga0194022_1003173 | All Organisms → Viruses → Predicted Viral | 2123 | Open in IMG/M |
| 3300020267|Ga0211648_1096801 | Not Available | 546 | Open in IMG/M |
| 3300020270|Ga0211671_1100632 | Not Available | 530 | Open in IMG/M |
| 3300020296|Ga0211474_1023870 | Not Available | 1037 | Open in IMG/M |
| 3300020403|Ga0211532_10102151 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
| 3300020416|Ga0211644_10093256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1220 | Open in IMG/M |
| 3300020428|Ga0211521_10209496 | Not Available | 888 | Open in IMG/M |
| 3300020430|Ga0211622_10230757 | Not Available | 793 | Open in IMG/M |
| 3300020437|Ga0211539_10222814 | Not Available | 776 | Open in IMG/M |
| 3300020442|Ga0211559_10350946 | Not Available | 684 | Open in IMG/M |
| 3300020468|Ga0211475_10055603 | Not Available | 2137 | Open in IMG/M |
| 3300020469|Ga0211577_10089293 | Not Available | 2157 | Open in IMG/M |
| 3300020475|Ga0211541_10133804 | Not Available | 1223 | Open in IMG/M |
| 3300020578|Ga0194129_10316180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300021084|Ga0206678_10147829 | Not Available | 1190 | Open in IMG/M |
| 3300021092|Ga0194122_10045317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 2697 | Open in IMG/M |
| 3300021356|Ga0213858_10466624 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | 586 | Open in IMG/M |
| 3300021375|Ga0213869_10137306 | Not Available | 1154 | Open in IMG/M |
| 3300021424|Ga0194117_10132949 | Not Available | 1287 | Open in IMG/M |
| 3300021957|Ga0222717_10208567 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | 1155 | Open in IMG/M |
| 3300021957|Ga0222717_10439456 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | 714 | Open in IMG/M |
| 3300021958|Ga0222718_10592853 | Not Available | 521 | Open in IMG/M |
| 3300021959|Ga0222716_10619848 | Not Available | 587 | Open in IMG/M |
| 3300021960|Ga0222715_10244878 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | 1046 | Open in IMG/M |
| 3300021960|Ga0222715_10379094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 779 | Open in IMG/M |
| 3300021964|Ga0222719_10198191 | Not Available | 1375 | Open in IMG/M |
| 3300022065|Ga0212024_1083570 | Not Available | 568 | Open in IMG/M |
| 3300022843|Ga0222631_1034891 | Not Available | 674 | Open in IMG/M |
| 3300023105|Ga0255782_10290122 | Not Available | 770 | Open in IMG/M |
| 3300023172|Ga0255766_10118869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1560 | Open in IMG/M |
| 3300023180|Ga0255768_10377074 | Not Available | 762 | Open in IMG/M |
| 3300023568|Ga0228696_1006639 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
| 3300023696|Ga0228687_1046959 | Not Available | 513 | Open in IMG/M |
| 3300024344|Ga0209992_10275796 | Not Available | 692 | Open in IMG/M |
| 3300025086|Ga0208157_1098858 | Not Available | 704 | Open in IMG/M |
| 3300025674|Ga0208162_1112490 | Not Available | 793 | Open in IMG/M |
| 3300025759|Ga0208899_1053689 | All Organisms → Viruses → Predicted Viral | 1710 | Open in IMG/M |
| 3300025771|Ga0208427_1089653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1076 | Open in IMG/M |
| 3300025803|Ga0208425_1121805 | Not Available | 596 | Open in IMG/M |
| 3300025815|Ga0208785_1029713 | Not Available | 1687 | Open in IMG/M |
| 3300025840|Ga0208917_1045348 | Not Available | 1760 | Open in IMG/M |
| 3300025889|Ga0208644_1010183 | Not Available | 6472 | Open in IMG/M |
| 3300025890|Ga0209631_10188215 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | 1074 | Open in IMG/M |
| 3300026187|Ga0209929_1008839 | Not Available | 3318 | Open in IMG/M |
| 3300026491|Ga0228641_1052337 | Not Available | 986 | Open in IMG/M |
| 3300026491|Ga0228641_1113964 | Not Available | 569 | Open in IMG/M |
| 3300027608|Ga0208974_1172565 | Not Available | 536 | Open in IMG/M |
| 3300027791|Ga0209830_10004893 | Not Available | 9584 | Open in IMG/M |
| 3300028133|Ga0228609_1088316 | Not Available | 807 | Open in IMG/M |
| 3300031696|Ga0307995_1006986 | Not Available | 5761 | Open in IMG/M |
| 3300031757|Ga0315328_10103713 | Not Available | 1637 | Open in IMG/M |
| 3300031773|Ga0315332_10937812 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 517 | Open in IMG/M |
| 3300031886|Ga0315318_10216058 | Not Available | 1094 | Open in IMG/M |
| 3300032073|Ga0315315_10139225 | Not Available | 2263 | Open in IMG/M |
| 3300034061|Ga0334987_0169515 | Not Available | 1573 | Open in IMG/M |
| 3300034092|Ga0335010_0643746 | Not Available | 530 | Open in IMG/M |
| 3300034284|Ga0335013_0805042 | Not Available | 525 | Open in IMG/M |
| 3300034375|Ga0348336_196788 | Not Available | 542 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.13% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 11.76% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.08% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.56% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.88% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.88% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.04% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.20% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.20% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.36% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.52% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.52% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.68% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.68% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.84% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.84% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.84% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.84% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.84% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.84% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.84% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.84% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004810 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006329 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300019937 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MG | Environmental | Open in IMG/M |
| 3300020267 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108) | Environmental | Open in IMG/M |
| 3300020270 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX555928-ERR599042) | Environmental | Open in IMG/M |
| 3300020296 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022843 | Saline water microbial communities from Ace Lake, Antarctica - #5 | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300023568 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023696 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026491 | Seawater microbial communities from Monterey Bay, California, United States - 52D | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300028133 | Seawater microbial communities from Monterey Bay, California, United States - 10D | Environmental | Open in IMG/M |
| 3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100669851 | 3300000101 | Marine | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRQMVLTSLR |
| DelMOSpr2010_100603871 | 3300000116 | Marine | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRHMVLNSL |
| BBAY94_101454584 | 3300000949 | Macroalgal Surface | MILVDLNQVLISNLMAQIRGKADVKPNKEMIRHMVLTSLRGF |
| JGI20152J14361_101091882 | 3300001344 | Pelagic Marine | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRQMVLTSL |
| Ga0007758_100186341 | 3300004790 | Freshwater Lake | MILVDLNQILISNLMAQTRGKSDIKPNKEMIRHMVINSLRG |
| Ga0007757_114910091 | 3300004810 | Freshwater Lake | MILVDLNQVLISNLMAQTRGKSDIKPNKEMIRHMVINSLRG |
| Ga0068486_10999743 | 3300006329 | Marine | MILVDFNQVLISNLMAQVRGKGDVKPNKEMIRFMV |
| Ga0099954_10303861 | 3300006350 | Marine | MILVDLNQVLISNLMAQVRGKADVKPNKEMIRFMVLNS |
| Ga0099953_10821533 | 3300006351 | Marine | MILVDLNQVLISNLMAQTRGQPDITNANEDMIRHMV |
| Ga0098038_10183811 | 3300006735 | Marine | MILVDLNQVLISNLMAQTRGKADVTPNKEMIRHMVLNSLRG |
| Ga0098038_10850514 | 3300006735 | Marine | MILVDLNQILISNLMAQVRGKGDVKPNKHMIRHMVL |
| Ga0098037_10594831 | 3300006737 | Marine | MILVDLNQVLISNLMAQTRGKAEEMPDKDVIRHMVINSI |
| Ga0070749_100161551 | 3300006802 | Aqueous | MSILVDLNQVLISNVMAQTRGQEEANLDMIRHMVINSIRGYNL |
| Ga0070749_101108191 | 3300006802 | Aqueous | MILVDLNQVLISNVMAQTRGQEEANLDMIRHMVINSIRGYNL |
| Ga0070749_102984774 | 3300006802 | Aqueous | MILVDLNQVLISNLMAQTRGKSDVKPNKDMIRHMVL |
| Ga0070749_105277341 | 3300006802 | Aqueous | MILVDLNQVLISNLMAQTRGQIDDLPDKNMLRHMV |
| Ga0075481_102545831 | 3300006868 | Aqueous | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRHMVLN |
| Ga0075477_100421926 | 3300006869 | Aqueous | MILVDLNQVLISNLMAQTRGQIDDLPDKNMLRHMVLN |
| Ga0070748_12629091 | 3300006920 | Aqueous | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRQMV |
| Ga0070752_13415641 | 3300007345 | Aqueous | MILVDLNQVLISNFMVQTRGAPDVKPNKEMIRHMVVNSLRGF |
| Ga0099850_10757293 | 3300007960 | Aqueous | MILVDLNQVLISNLMAHTRGQLDEIPDKDMLRHMVLNSIRG |
| Ga0102960_13580012 | 3300009000 | Pond Water | MILVDLNQVLISNLMAQTRGQFDDLPDKDMLRHMVLNSIR |
| Ga0102963_11499891 | 3300009001 | Pond Water | MILVDLNQVLISNLMAQTRGQPDVTNANEEMIRHMVMN |
| Ga0115549_12517201 | 3300009074 | Pelagic Marine | MILVDLNQVLISNLMVQTRGQGDVKPNEEMIRHMVMNSLRG |
| Ga0115551_14534773 | 3300009193 | Pelagic Marine | MILVDLNQVLISNLMVQTRGKAEVKPNMEMVRSMVLNSLRGFNL |
| Ga0115546_10275136 | 3300009435 | Pelagic Marine | MILVDLNQVLISNLMAQTRGQFDDLPDKDMLRHMVL |
| Ga0115546_12613211 | 3300009435 | Pelagic Marine | MILVDLNQVLISNLMAQTRGQLNGLPDKDMLRHMVLNS |
| Ga0115558_11936232 | 3300009449 | Pelagic Marine | MILVDLNQVLISNLMAQTRGQFDDLPDKDMLRHMVLN |
| Ga0115003_108082571 | 3300009512 | Marine | MILVDLNQVLISNLFAHTRGQVDEMPDKDMLRHMVLN |
| Ga0114967_103461203 | 3300010160 | Freshwater Lake | MILVDIKQVVITNLMEQTRGKSDIKPNKEMIRHMVINSL |
| Ga0129351_10656814 | 3300010300 | Freshwater To Marine Saline Gradient | MILVDLNQVLISNLMAHTRGQLDEIPDKDMLRHMVLNSIRGYNL |
| Ga0129351_10659984 | 3300010300 | Freshwater To Marine Saline Gradient | MILIDLNQVLISNLMAHTRGQLDEIPDKDMLRHMVLNSIRGYNL |
| Ga0129324_101887683 | 3300010368 | Freshwater To Marine Saline Gradient | MILVDLNQVLISNLMAHTRGQLDEIPDKDMLRHMVLNSIR |
| Ga0160422_107351311 | 3300012919 | Seawater | MILVDLNQVLISNLMAQTRGQPDKTTANEDMIRHMVINS |
| Ga0163111_116704913 | 3300012954 | Surface Seawater | MILVDLNQVLISNLMAQTRGQPDKTTANEDMIRHMVI |
| (restricted) Ga0172367_105330843 | 3300013126 | Freshwater | MILIDLNQVLISNLMAQTRGKAENLPNKEMVRHMVIN |
| (restricted) Ga0172363_105690371 | 3300013130 | Sediment | MILVDLNQVLISNLMAQTRGKSDVKPNKEMVRHMV |
| Ga0180120_101878164 | 3300017697 | Freshwater To Marine Saline Gradient | MILVDLNQVLISNLMAQTRGQLEELPDKNMLRHMVLNS |
| Ga0181362_10654561 | 3300017723 | Freshwater Lake | MILVDLNQVLISNLMAQTRGKSDSKPNKEMKRHMVINS |
| Ga0181381_10589313 | 3300017726 | Seawater | MILVDLNQVLISNLMAQTRGQFDELPDKNMLRHMVLN |
| Ga0181401_10175197 | 3300017727 | Seawater | MILVDLNQVLISNYMAQTRGHKAPNIDMFRHMVLNSIR |
| Ga0181428_11623573 | 3300017738 | Seawater | MILVDLNQVLISNLMAQTRGEVTADVEMIRHMVMN |
| Ga0181414_11778924 | 3300017759 | Seawater | MILVDLNQVLISNLMVQTRGKAEVKPNMEMVRSMVLNS |
| Ga0181408_11313861 | 3300017760 | Seawater | MILVDLNQVLISNRMEQEKGKEDVKPKKERFRLWY |
| Ga0181406_10705891 | 3300017767 | Seawater | MILVDLNQVLISNLMAQTRGKADVTPNKNMILHMVLNSL |
| Ga0181386_10787574 | 3300017773 | Seawater | MILVDLNQVLISNLMAQTRGQGDVKPNEEMIRHMVM |
| Ga0181394_12573022 | 3300017776 | Seawater | MILVDLNQVLISNLMAQTRGAPIEPDKEMVRHMVINA |
| Ga0181380_10229579 | 3300017782 | Seawater | MILVDLNQVLISNLMAQVRGKADVKPNKEMIRFMVLNSLR |
| Ga0181348_11432831 | 3300017784 | Freshwater Lake | MILVDLNQVLISNLMAQTRGKSDIKPNREMIRHML |
| Ga0181584_100644137 | 3300017949 | Salt Marsh | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRHMVL |
| Ga0181584_106419583 | 3300017949 | Salt Marsh | MILVDLNQVLISNLMVQTRGQADVKPNKEMIRHMVV |
| Ga0181590_100619591 | 3300017967 | Salt Marsh | MILVDLNQVLISNLMVQTRGQADVKPNKEMIRHMVVNSLRG |
| Ga0181585_104545481 | 3300017969 | Salt Marsh | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRHMVLNS |
| Ga0181553_107218932 | 3300018416 | Salt Marsh | MILVDLNQVLISNLMAQTRGQFDDLPDKNMLRHMV |
| Ga0181567_1004883611 | 3300018418 | Salt Marsh | MILVDLNQVLISNLMAQIRGKADVKPNKEMIRHMVLNSL |
| Ga0181563_103351481 | 3300018420 | Salt Marsh | MILVDLNQVLISNLMAQTRGQPDKTNANEEMIRHMVMNSLR |
| Ga0181592_108781631 | 3300018421 | Salt Marsh | MILVDLNQVLISNFMVQTRGAPDVKPNKEMIRHMVVN |
| Ga0181592_110718081 | 3300018421 | Salt Marsh | MILVDLNQVLISNLMAQVRGKSDVKPNKEMIRHMV |
| Ga0181568_104731294 | 3300018428 | Salt Marsh | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRHMVLTSLRGFNV |
| Ga0181568_106207674 | 3300018428 | Salt Marsh | MILVDLNQVLISNLMAQVRGKSDVKPNKEMIRHMVL |
| Ga0181359_11362292 | 3300019784 | Freshwater Lake | MILVDLNQVLISNLMAQTRGKSDIKPNREMIRHMVINSLR |
| Ga0194022_10031731 | 3300019937 | Freshwater | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRHMV |
| Ga0211648_10968012 | 3300020267 | Marine | MILVDLNQVLISNYMAQTRGQKPPNIDMFRHMVLNS |
| Ga0211671_11006321 | 3300020270 | Marine | MILVDLNQVLISNLMAQVRGKADVKPNKEMIRFMVLNSLRG |
| Ga0211474_10238701 | 3300020296 | Marine | MILVDLNQVLISNYMAQTRGQKAPNIDMFRHMVLN |
| Ga0211532_101021514 | 3300020403 | Marine | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRHMVLTSLRGFNA |
| Ga0211644_100932561 | 3300020416 | Marine | MILVDLNQVLISNYMAQTRGQKPPNIDMFRHMVLNSI |
| Ga0211521_102094961 | 3300020428 | Marine | MILVDLNQVLISNLMAQVRGKADVKPNKEMIRFMVLNSL |
| Ga0211622_102307571 | 3300020430 | Marine | MILVDLNQVLISNFMAQTRGKGEPNIDIFRHMVLNSIRG |
| Ga0211539_102228143 | 3300020437 | Marine | MILVDLNQVLISNFMAQTRGKSEPNIDIFRHMVLNSI |
| Ga0211559_103509461 | 3300020442 | Marine | MILVDLNQVLISNLMAQIRGKADVKPNKEMIRHMVLN |
| Ga0211475_100556031 | 3300020468 | Marine | MILVDLNQVLISNLMAQVRGKADVKPNKEMIRFMVLNSLRGINV |
| Ga0211577_100892931 | 3300020469 | Marine | MILVDLNQILISNLMAQVRGKGDVKPNKDMIRHMVLNSL |
| Ga0211541_101338046 | 3300020475 | Marine | MILVDLNQVLISNLMAQVRGKADVKPNKEMIRFMVLNSLRGI |
| Ga0194129_103161802 | 3300020578 | Freshwater Lake | MILVDLNQVLISNLMAQTRGMIDGIPNKDMIRHMV |
| Ga0206678_101478291 | 3300021084 | Seawater | MILVDLNQVLISNLMAQVRGKGDVKPNREMIRYMVLNS |
| Ga0194122_100453171 | 3300021092 | Freshwater Lake | MILVDLNQVLISNLMAQTRGKAENLPNKEMVRYMVINS |
| Ga0213858_104666241 | 3300021356 | Seawater | MILVDLNQVLISNLMAQTRGQIDDLPDKNMLRHMVLNS |
| Ga0213869_101373061 | 3300021375 | Seawater | MILVDLNQVLISNLMAQVRGKGDVKPNKDMIRLMV |
| Ga0194117_101329495 | 3300021424 | Freshwater Lake | MILVDLNQVLISNLMAQTRGKSDVKPNKEMVRHMVINSIRGF |
| Ga0222717_102085671 | 3300021957 | Estuarine Water | MILVDLNQVLISNLMAQTRGQFDDLPDKDMLRHMVLNS |
| Ga0222717_104394561 | 3300021957 | Estuarine Water | MILVDLNQVLISNLMAHTRGQLDEIPDKDMLRHMVLNSIRGY |
| Ga0222718_105928533 | 3300021958 | Estuarine Water | MILVDLKQVLISNLMAQVRGKGDVTPNKDMIRHMVL |
| Ga0222716_106198481 | 3300021959 | Estuarine Water | MILVDLNQVLISNFMVQTRGAPDVKPNKEMIRHMVVNSLRGFN |
| Ga0222715_102448781 | 3300021960 | Estuarine Water | MILVDLNQVLISNLMAHTRGQLDEIPDKDMLRHMVLN |
| Ga0222715_103790941 | 3300021960 | Estuarine Water | VVEEKIYMILVDLNQVLISNLMAHTRGQLDEIPDKD |
| Ga0222719_101981911 | 3300021964 | Estuarine Water | MILVDLNQVLISNFMVQTRGAPDVKPNKEMIRHMVFNSLRGF |
| Ga0212024_10835703 | 3300022065 | Aqueous | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRQMVLTSLRGFNAKFKQ |
| Ga0222631_10348911 | 3300022843 | Saline Water | MILVDLNQILISNLMAQVRGKGDVKPNKDMIRHMVL |
| Ga0255782_102901224 | 3300023105 | Salt Marsh | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRHMVLTS |
| Ga0255766_101188694 | 3300023172 | Salt Marsh | MILVDLNQVLISNLMAQTRGQIDDLPDKNMLRHMVL |
| Ga0255768_103770741 | 3300023180 | Salt Marsh | MILVDLNQVLISNLMAQTRGKSDVKPNKEMIRHMV |
| Ga0228696_10066396 | 3300023568 | Seawater | MILVDLNQVLISNLMVQTRGKAEVKPNMEMVRSMVLNSL |
| Ga0228687_10469591 | 3300023696 | Seawater | MILVDLNQVLISNLMAQTRGQGDVKPNEEMIRHMVMNSLT |
| Ga0209992_102757961 | 3300024344 | Deep Subsurface | MILVDLNQILISNLMAQVRGKGDVKPNKDMIRHMVLNS |
| Ga0208157_10988584 | 3300025086 | Marine | MILVDLNQVLISNLMAQVRGKGDVKPNKEMIRHMVLTSLRG |
| Ga0208162_11124903 | 3300025674 | Aqueous | MSILVDLNQVLISNVMAQTRGQEEANLDMIRHMVINSIRGYNLK |
| Ga0208899_10536895 | 3300025759 | Aqueous | MILVDLNQVLISNFMVQTRGAPDVKPNKEMIRHMVVNSLRGFNVK |
| Ga0208427_10896531 | 3300025771 | Aqueous | MILVDLNQVLISNLMAQTRGQIDDLPDKDMLRHMV |
| Ga0208425_11218053 | 3300025803 | Aqueous | MILVDLNQVLISNLMAQTRGQFDDLPDKNMLRHMVLNSI |
| Ga0208785_10297135 | 3300025815 | Aqueous | MILVDLNQVLISNLMAQTRGQLEELPDKNMLRHMVLN |
| Ga0208917_10453481 | 3300025840 | Aqueous | MILVDLNQVLISNVMAQTRGQEEANLDMIRHMVINSIRGYNLK |
| Ga0208644_10101831 | 3300025889 | Aqueous | MILVDLNQVLISNVMAQTRGQEEANLDMIRHMVINSIRGY |
| Ga0209631_101882151 | 3300025890 | Pelagic Marine | MILVDLNQVLISNLMAHTRGQLDEMPDKDMLRHMVL |
| Ga0209929_100883911 | 3300026187 | Pond Water | MILVDLNQVLISNLMVQTRGQGDVKPNEEMIRHMVMN |
| Ga0228641_10523376 | 3300026491 | Seawater | MILVDLNQVLISNLMVQTRGKAEVKPNMEMVRSMVLNSLR |
| Ga0228641_11139641 | 3300026491 | Seawater | MILVDLNQVLISNLMAQTRGQGDVKPNEEMIRHMVMNSL |
| Ga0208974_11725653 | 3300027608 | Freshwater Lentic | MILVDLNQVLISNLMAQTRGKSDIKPNKEMIRHMVINS |
| Ga0209830_100048931 | 3300027791 | Marine | MILVDLNQVLISNLMVQTRGKADVKPNLEMVRQMVL |
| Ga0228609_10883161 | 3300028133 | Seawater | MILVDLNQVLISNYMAQTRGQKAPNIDMFRHMVLNSI |
| Ga0307995_10069861 | 3300031696 | Marine | MILVDLNQVLISNLMVQTRGKADVKPNLEMVRQMVLNSLRGFNLK |
| Ga0315328_101037131 | 3300031757 | Seawater | MILVDLNQVLISNLMAQVRGKGDVKPNREMIRYMVLNSLRG |
| Ga0315332_109378123 | 3300031773 | Seawater | MILVDLNQVLISNLMVQTRGKPEVKPNLDMVRQMVLNSLRGFNIK |
| Ga0315318_102160581 | 3300031886 | Seawater | MILVDLNQVLISNLMVQTRGKPEVKPNLDMVRQMVLNSLRG |
| Ga0315315_101392251 | 3300032073 | Seawater | MILVDLNQVLISNLMAQTRGKADVTPNKNMILHMVLNSLRG |
| Ga0334987_0169515_1468_1572 | 3300034061 | Freshwater | MILVDLNQVLISNLMAQTRGKSDIKPNKEMIRHMV |
| Ga0335010_0643746_2_109 | 3300034092 | Freshwater | MILIDLNQVLISNLMAQTRGKAENLPDKEMVRHMVI |
| Ga0335013_0805042_2_112 | 3300034284 | Freshwater | MILVDLNQVLISNLMAQTRGKSDIKPNKEMIRHMVIN |
| Ga0348336_196788_428_541 | 3300034375 | Aqueous | MILVDLNQVLISNFMVQTRGAPDVKPNKEMIRHMVVNS |
| ⦗Top⦘ |