| Basic Information | |
|---|---|
| Family ID | F074894 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 40 residues |
| Representative Sequence | EQNDLQYNSTANDFYITYEEVNNGSGQHGIVRKETETRV |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.44 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (78.151 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (42.017 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.824 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (76.471 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.87% Coil/Unstructured: 73.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 78.15 % |
| All Organisms | root | All Organisms | 21.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 42.02% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.24% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 8.40% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 7.56% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.36% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.36% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 3.36% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.36% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.52% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.68% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.68% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.84% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.84% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.84% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.84% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.84% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.84% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.84% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.84% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.84% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.84% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.84% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.84% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.84% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300008517 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016741 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019281 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022168 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
| 3300022857 | Saline water microbial communities from Ace Lake, Antarctica - #419 | Environmental | Open in IMG/M |
| 3300022867 | Saline water microbial communities from Ace Lake, Antarctica - #1 | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026123 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100502085 | 3300000115 | Marine | QFTSTGNDFYITYEEVTNGSGQHGIVRKETETRV* |
| DelMOSum2011_101073421 | 3300000115 | Marine | WERNDLQFTSTGNDFYITYEEVTNGSGQHGTVRKETETRV* |
| DelMOSpr2010_101170803 | 3300000116 | Marine | SDIKWEKNDLQYTSTSNGFYITYEEVQNGSGQHGIVRKETETRI* |
| DelMOWin2010_102046441 | 3300000117 | Marine | QFTSTGNDFYITYEEVTNGSGQHGTVRKETETRV* |
| JGI26084J50262_10862223 | 3300003427 | Marine | SDIKWEENDLQYTSTVNDFYITYEEVNNGSAKDGVVREENTVRV* |
| Ga0074648_10945964 | 3300005512 | Saline Water And Sediment | QYNSTANDFYITYEEVYNGSGQHGTVRQETQTRV* |
| Ga0074649_10281161 | 3300005613 | Saline Water And Sediment | DLQYNSTANDFYITYEEVYNGSGQHGTVRQETQTRV* |
| Ga0075474_100422491 | 3300006025 | Aqueous | LQYTSTVNDFYITYEEVYNGSGQHGTVRQETQTRV* |
| Ga0075478_102434931 | 3300006026 | Aqueous | NDLQYNSTANDFYITYEEVYNGSGQHGTVRQETQTRI* |
| Ga0075478_102571111 | 3300006026 | Aqueous | LGKSDIKWEQNDLQYSSTVNDFYITYEEVTNGSGQHGIVRQETETRI* |
| Ga0075462_100498185 | 3300006027 | Aqueous | DWEQNDLQYNSTANDFYITYEEVYNGSGQHGTVRQETQTRV* |
| Ga0075462_101611221 | 3300006027 | Aqueous | EQNDLQYNSTANDFYITYEEVNNGSGQHGIVRKETETRV* |
| Ga0099972_104442833 | 3300006467 | Marine | DIKWEENELQYTSTVNDFYITYEEVNNGSTKDGVVREENTVRV* |
| Ga0098037_10531491 | 3300006737 | Marine | DIKWEQNDMQYTSTANDFYITYEEVTNGSGQHGTVRKETETRV* |
| Ga0098037_11390213 | 3300006737 | Marine | FLGKSDIKWEQNDMQYTSTANDFYITYEEVTNGSGQHGIVRKEIETRV* |
| Ga0098055_11768424 | 3300006793 | Marine | SDINWEKNDLQFTSTGNDFYITYEEVNDGSGQHGTVREETETRV* |
| Ga0098055_11824691 | 3300006793 | Marine | DIKWEQNDMQYTSTANDFYITYEEVTNGSGQHGIVRKEIETRV* |
| Ga0070754_104580893 | 3300006810 | Aqueous | WEVNDLEYHSTTSDFYITYEEVTNGSGQHGIVRKETEARI* |
| Ga0075481_100564451 | 3300006868 | Aqueous | QWEENDLQYTSSVNDFYITYEEVNNGSGQHGIVRKETETRV* |
| Ga0075477_101301971 | 3300006869 | Aqueous | SDINWEENDLQYTSTVNSFYITYEEVTNGSGQHGIVREETQARI* |
| Ga0070746_103185543 | 3300006919 | Aqueous | WEQNDLQYNSTANDFYITYEEVTNGSGQHGIVREETETRI* |
| Ga0070746_105444441 | 3300006919 | Aqueous | DIKWEQNDLQYHGAGSDFYITYEEVTNGYGQHGIVCEETETRI* |
| Ga0075444_100606831 | 3300006947 | Marine | NRLKYTRGFYITYEELDNGKKQHGTIRKEIEPRV* |
| Ga0098046_10702931 | 3300006990 | Marine | IKWEQNDMQYTSTANDFYITYEEVTNGSGQHGIVRKEIETRV* |
| Ga0111034_11296581 | 3300008517 | Marine Sediment | LKYNGTNKFYITYEEVKNGSGQHGVVRSETEARI* |
| Ga0102963_10701941 | 3300009001 | Pond Water | KNDLQFTSTGNDFYITYEEVNDGSGQHGTVRKETETRV* |
| Ga0102963_10878261 | 3300009001 | Pond Water | NDLQYTSTVNDFYITYEEVNNGSGQHGIVREEAETRV* |
| Ga0114918_107004902 | 3300009149 | Deep Subsurface | EKNDLQYHGTGNDFYITYEEVQNGSGQYGIVRKETETRI* |
| Ga0115548_10750651 | 3300009423 | Pelagic Marine | LGKSDIKWEKNDLQFTSTGNDFYITYEEVTNGSGQHGIVRKETETRV* |
| Ga0129342_13163941 | 3300010299 | Freshwater To Marine Saline Gradient | INWEQNDLQYTSTVNGFYITYEEVTNGSGQHGIVREETETRI* |
| Ga0136656_12274411 | 3300010318 | Freshwater To Marine Saline Gradient | NDLQYTSTVNGFYITYEEVTNGSGQHGIVREETETRI* |
| Ga0133547_112590661 | 3300010883 | Marine | WEKNDLQYHGTGNDFYITYEEVQNGSGQHGIVRKETETRI* |
| Ga0129353_12152482 | 3300012525 | Aqueous | QYNSTANGFYITYEEVTNGSGQHGTVREETETRV* |
| Ga0129352_108318471 | 3300012528 | Aqueous | EENDLQYTSSVNDFYITYEEVNNGSGQHGIVREETETRV* |
| Ga0129343_12738781 | 3300012967 | Aqueous | WEENDLQYTSTVNGFYITYEEVTNGSGQHGIVREETETRV* |
| Ga0182079_14502453 | 3300016741 | Salt Marsh | NDLQYTSTVNDFYITYEEVNNGSGQHDIVRQEIETRV |
| Ga0180120_101959521 | 3300017697 | Freshwater To Marine Saline Gradient | NWEENDLQYTSTVNSFYITYEEVTNGSGQHGIVRQETETRI |
| Ga0180120_103206211 | 3300017697 | Freshwater To Marine Saline Gradient | NWEENDLQYTSTVNSFYITYEEVTNGSGQHGIVREETEARI |
| Ga0181369_11173651 | 3300017708 | Marine | SDIKWEQNDMQYTSTANDFYITYEEVTNGSGQHGIVRKETETRV |
| Ga0181583_106040683 | 3300017952 | Salt Marsh | DWEKNDLQYTSTVNDFYITYEEVYNGSGQHGTVRQETQTRV |
| Ga0181600_102521254 | 3300018036 | Salt Marsh | SDIKWERNDLQFTSTGNDFYITYEEVTNGSGQHGTVRKETETRV |
| Ga0180433_100732961 | 3300018080 | Hypersaline Lake Sediment | NDLQYNSTANDFYITYEEVYNGSGQHGTVRQETQTRV |
| Ga0180433_107671361 | 3300018080 | Hypersaline Lake Sediment | LQYNSTANDFYITYEEVTNGSGQHGIVREETETRI |
| Ga0181553_101615401 | 3300018416 | Salt Marsh | DIKWEQNDLQYNSTMNDFYITYEEVNNGSGQHGIVRKETEARI |
| Ga0181553_106281453 | 3300018416 | Salt Marsh | GKSDIKWEQNDLQFTSTGNDFYITYEEVNNGSGQHDIVRQETETRV |
| Ga0181563_102337754 | 3300018420 | Salt Marsh | NDLQYTSTISDFYITYEEVTNGSGQHGIVREETETRV |
| Ga0182077_10182964 | 3300019281 | Salt Marsh | ELNKPIIDFLGKSDIKWEQNDLQYNSTANDFYITYEEVNNGSGQHGIVRTEDQTRV |
| Ga0194024_11572791 | 3300019765 | Freshwater | KSDIKWERNDLQFTSTGNDFYITYEEVNNGSGQHDIVRQEIETRV |
| Ga0181555_13173161 | 3300020051 | Salt Marsh | KSDIQWEENSFHQLPDGHDFYITYEEVTNGSGQHGIVRKETETRV |
| Ga0181604_101465285 | 3300020191 | Salt Marsh | SDINWEQNDLQYTSSVNGFYITYEEVTNGSGQHGIVREETETRI |
| Ga0181604_104929401 | 3300020191 | Salt Marsh | ENDLQYTSTVNDFYITYEEVNNGSAKDGVVREENTVRV |
| Ga0213858_100330691 | 3300021356 | Seawater | EPNPLQFSGGYYITYEEVENGSGQHGAVREETETRV |
| Ga0213864_104591961 | 3300021379 | Seawater | IDWEQNDLQYNSTGNDFYITYEEVTNGSGQHGTVRQETETRV |
| Ga0213868_101950684 | 3300021389 | Seawater | GKSDIQWEENTFHQISDGHDFYITYEEVKNGSGQHGDVRKETEARV |
| Ga0222717_101420571 | 3300021957 | Estuarine Water | EKNDLQYTSTTNGFYITYEEVTNGSGQHGIVREETETRV |
| Ga0222717_102245251 | 3300021957 | Estuarine Water | LQYTSTVNDFYITYEEVNNGSGQHDTVRQETETRV |
| Ga0222718_100969161 | 3300021958 | Estuarine Water | DLQYTSTVNDFYITYEEVNNGSTKDGVVREENTVRV |
| Ga0222718_102707594 | 3300021958 | Estuarine Water | ENDLQYNSTANDFYITYEEVYNGSGQHGTVRQETQTRV |
| Ga0222715_101139575 | 3300021960 | Estuarine Water | DIKWEQNDLQYNSTANDFYITYEEVNNGSGQHGIVREETETRI |
| Ga0222719_102626304 | 3300021964 | Estuarine Water | WEQNDLQYNSTANDFYITYEEVYNGSGQHGTVRQETQTRI |
| Ga0222719_105850763 | 3300021964 | Estuarine Water | NDLQYNSTANDFYITYEEVNNGSGQHGIVREETETRV |
| Ga0222719_106605471 | 3300021964 | Estuarine Water | WEKNDLQYTSTANGFYITYEEVYNGSGQHGTVRQETQTRV |
| Ga0222719_107394603 | 3300021964 | Estuarine Water | EQNDLQYNSTANDFYITYEEVNNGSGQHGIVREETETRV |
| Ga0212030_10435763 | 3300022053 | Aqueous | EQNDLQFTSTGNDFYITYEEVNNGSGQHDIVRQETETRV |
| Ga0212030_10490371 | 3300022053 | Aqueous | IKWEENDLQYTSTVNGFYITYEEVTNGSGQHGIVRQETETRI |
| Ga0212025_10401991 | 3300022057 | Aqueous | IKWEQNDMQYTSTANDFYITYEEVTNGSGQHGIVRKETETRV |
| Ga0212021_10379401 | 3300022068 | Aqueous | DLQYNSTANDFYITYEEVNNGSGQHGIVRKETETRV |
| Ga0212021_10484791 | 3300022068 | Aqueous | DINWEENDLQYTSTVNSFYITYEEVTNGSGQHGIVREETEARV |
| Ga0212026_10182373 | 3300022069 | Aqueous | SDIKWEQNDLQYSSTTNDFYITYEEVNNGSGQHGIVREETETRV |
| Ga0212026_10673101 | 3300022069 | Aqueous | KSDIKWEKNDLQFTSTGNDFYITYEEVTNGSGQHGIVRKETETRV |
| Ga0196897_10012288 | 3300022158 | Aqueous | DIKWEQNDLQYSSTVNDFYITYEEVTNGSGQHGIVRQETETRI |
| Ga0196893_10266871 | 3300022159 | Aqueous | DLQYSSTTNDFYITYEEVNNGSGQHGIVREETETRV |
| Ga0212020_10692843 | 3300022167 | Aqueous | RNDLQFTSTGNDFYITYEEVTNGSGQHGIVRKETETRV |
| Ga0212020_10933661 | 3300022167 | Aqueous | FLGKSDIKWEKNDLQYHGTGNNFYITYEEVQNGSGQYGIVRKETETRI |
| Ga0212027_10287633 | 3300022168 | Aqueous | ENDLQYTSTVNDFYITYEEVNNGSGQHDTVRQETETRV |
| Ga0212031_10280971 | 3300022176 | Aqueous | IKWEENDLQYTSTVNDFYITYEEVNNGSAKDGVVREENTVRV |
| Ga0196887_10418311 | 3300022178 | Aqueous | IKWERNDLQFTSTGNDFYITYEEVTNGSGQHGTVRKETETRV |
| Ga0196891_10978162 | 3300022183 | Aqueous | EKSDIKWEQNDLQYNSTANDFYITYEEVNNGSGQHGIVREETETRV |
| Ga0196899_10128098 | 3300022187 | Aqueous | KWERNDLQFTSTGNDFYITYEEVTNGSGQHGTVRKETETRV |
| Ga0196899_10354041 | 3300022187 | Aqueous | NDLQYTSTVNDFYITYEEVYNGSGQHGTVRQETQTRV |
| Ga0196899_10713381 | 3300022187 | Aqueous | QNDLQYNSTANDFYITYEEVYNGSGQHGTVRQETQTRV |
| Ga0196905_10484861 | 3300022198 | Aqueous | EENDLQYTSTVNGFYITYEEVTNGSGQHGIVRQETETRI |
| Ga0196901_11906993 | 3300022200 | Aqueous | DINWEQNDLQYTSSVNGFYITYEEVTNGSGQHGIVREETETRV |
| Ga0222646_1192943 | 3300022822 | Saline Water | EKNDFQYHSTGSSFYITYEEVNDGSGQYGTVRKETETRI |
| Ga0222653_10361453 | 3300022857 | Saline Water | GKSDIKWEKNDLQYHGTGNDFYITYEEVQNGSGQHGIVRKETETRI |
| Ga0222653_10568301 | 3300022857 | Saline Water | DIIWEKNDFQYHSTGSSFYITYEEVNDGSGQYGTVRKETETRI |
| Ga0222629_10321973 | 3300022867 | Saline Water | IIWEQNDFQYHSTGSSFYITYEEVNDGSGQYGTVRKETETRI |
| Ga0255766_101497854 | 3300023172 | Salt Marsh | QWEENPFHQLPDGHDFYITYEEVTNGSGQHGIVRKETETRV |
| Ga0208667_10397133 | 3300025070 | Marine | IKWEQNDMQYTSTANDFYITYEEVTNGSGQHGIVRKEIETRV |
| Ga0208157_10794763 | 3300025086 | Marine | FLGKSDIKWEQNDMQYTSTANDFYITYEEVTNGSGQHGIVRKEIETRV |
| Ga0208158_10777143 | 3300025110 | Marine | GKSDIKWEQNDMQYTSTSNDFYITYEEVTNGSGQHGIVRKEIETRV |
| Ga0208303_11114541 | 3300025543 | Aqueous | NDLQYTSTVNGFYITYEEVTNGSGQHGIVREETETRI |
| Ga0209716_10458441 | 3300025626 | Pelagic Marine | WEKNDLQYTSTSNGFYITYEEVQNGSGQHGIVRKETETRI |
| Ga0208004_10725563 | 3300025630 | Aqueous | DLQYNSTMNDFYITYEEVNNGSGQHGIVREETEARI |
| Ga0208134_10276701 | 3300025652 | Aqueous | LGKSDIKWERNDLQFTSTGNDFYITYEEVTNGSGQHGTVRKETETRV |
| Ga0208428_11589493 | 3300025653 | Aqueous | DINWEENDLQYTSTVNSFYITYEEVTNGSGQHGIVREETQARI |
| Ga0208795_10927981 | 3300025655 | Aqueous | DLQYNSTANDFYITYEEVTNGSGQHGIVREETETRI |
| Ga0208899_10928951 | 3300025759 | Aqueous | KWEQNDLQYSSTTNDFYITYEEVNNGSGQHGIVREETETRV |
| Ga0208767_10822601 | 3300025769 | Aqueous | LQYNSTANDFYITYEEVYNGSGQHGTVRQETQTRV |
| Ga0208427_12455233 | 3300025771 | Aqueous | LEYHSTTSDFYITYEEVTNGSGQHGIVRKETEARI |
| Ga0208542_10400085 | 3300025818 | Aqueous | DIDWEQNDLQYNSTANDFYITYEEVYNGSGQHGTVREETQTRI |
| Ga0208542_11244473 | 3300025818 | Aqueous | GKSDIQWEENDLQYTSTVNDFYITYEEVNNGSGQHGIVRKETETRV |
| Ga0209223_102776253 | 3300025876 | Pelagic Marine | EKNDLQYQGAGSDFYITYEEVTNGSGQHGTVRKETETRI |
| Ga0208644_10337087 | 3300025889 | Aqueous | KSDIKWEQNDLEYHSTISDFYITYEEVTNGSGQYGVVREETQARI |
| Ga0209955_10479811 | 3300026123 | Water | KNDLQYTSSVNDFYITYEEVNNGSGQHGIVRKETETRV |
| Ga0209951_10342021 | 3300026138 | Pond Water | WEQNDLQYNSTANDFYITYEEVNNGSGQHGIVREETETRI |
| Ga0209929_10373151 | 3300026187 | Pond Water | DLQFTSTGNDFYITYEEVNDGSGQHGTVRKETETRV |
| (restricted) Ga0233413_100053691 | 3300027996 | Seawater | LQYTSSTGGFYITYEEVQNGSGQYGIVRKETETRI |
| Ga0265303_106071041 | 3300028600 | Sediment | MQYTSTSNDFYITYEEVTDGSGQHGTVRKETETRV |
| Ga0307375_103192144 | 3300031669 | Soil | SDIVWEQNDLQYSSTVNDFYITYEEVYNGSGQHGTVRQETQTRV |
| Ga0307375_103770844 | 3300031669 | Soil | DLQYTSSTGGFYITYEEVQNGSGQYGIVRKETETRI |
| Ga0316202_102937951 | 3300032277 | Microbial Mat | EQNDLQYTSTISDFYITYEEVNNGSGQHGIVRKETETRV |
| Ga0314858_006080_1_108 | 3300033742 | Sea-Ice Brine | REYHGTGNDFYITYEEVQNGSGQHGIVRKETETRI |
| Ga0348335_063483_2_124 | 3300034374 | Aqueous | WEENDLQYTGTVNDFYITYEEVYNGSGQHGTVRQETQTRV |
| Ga0348335_070448_3_125 | 3300034374 | Aqueous | WEQNDLQYSSTVNDFYITYEEVTNGSGQHGIVREETETRI |
| Ga0348335_182987_3_128 | 3300034374 | Aqueous | KWDQNDLQYTSTVNDFYITYEEVNNGSGQHDTVRQETETRV |
| Ga0348336_197880_1_135 | 3300034375 | Aqueous | SDINWEVNDLEYHSTSSDFYITYEEVTNGSGQHGIVRKETEARI |
| Ga0348337_073439_2_109 | 3300034418 | Aqueous | LQYNSTTSGFYITYEEVTNGSGQHGIVRKETETRV |
| Ga0348337_194486_400_513 | 3300034418 | Aqueous | NDLQYTSTVNSFYITYEEVTNGSGQHGIVREETQARI |
| ⦗Top⦘ |