| Basic Information | |
|---|---|
| Family ID | F074848 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.56 % |
| % of genes near scaffold ends (potentially truncated) | 34.45 % |
| % of genes from short scaffolds (< 2000 bps) | 81.51 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.479 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.126 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 80.39% β-sheet: 0.00% Coil/Unstructured: 19.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF00815 | Histidinol_dh | 57.14 |
| PF00144 | Beta-lactamase | 23.53 |
| PF02511 | Thy1 | 10.92 |
| PF00977 | His_biosynth | 3.36 |
| PF17164 | DUF5122 | 0.84 |
| PF00701 | DHDPS | 0.84 |
| PF03793 | PASTA | 0.84 |
| PF00005 | ABC_tran | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 57.14 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 23.53 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 23.53 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 23.53 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 10.92 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.48 % |
| Unclassified | root | N/A | 2.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908032|Perma_A_C_ConsensusfromContig108737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101898637 | All Organisms → cellular organisms → Bacteria | 2268 | Open in IMG/M |
| 3300004156|Ga0062589_101227962 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300004463|Ga0063356_100886307 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300005158|Ga0066816_1005897 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300005166|Ga0066674_10003431 | All Organisms → cellular organisms → Bacteria | 5967 | Open in IMG/M |
| 3300005171|Ga0066677_10055635 | All Organisms → cellular organisms → Bacteria | 1991 | Open in IMG/M |
| 3300005172|Ga0066683_10320830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 963 | Open in IMG/M |
| 3300005177|Ga0066690_10101928 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300005179|Ga0066684_10216860 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300005181|Ga0066678_10102797 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300005332|Ga0066388_100548275 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
| 3300005332|Ga0066388_100756287 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300005332|Ga0066388_104083108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 744 | Open in IMG/M |
| 3300005332|Ga0066388_107240169 | Not Available | 557 | Open in IMG/M |
| 3300005341|Ga0070691_10918748 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005345|Ga0070692_10620076 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005356|Ga0070674_100063788 | All Organisms → cellular organisms → Bacteria | 2580 | Open in IMG/M |
| 3300005445|Ga0070708_100382275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1327 | Open in IMG/M |
| 3300005450|Ga0066682_10949274 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005518|Ga0070699_101357924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
| 3300005518|Ga0070699_102036383 | Not Available | 525 | Open in IMG/M |
| 3300005536|Ga0070697_100277445 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300005558|Ga0066698_10039792 | All Organisms → cellular organisms → Bacteria | 2914 | Open in IMG/M |
| 3300005568|Ga0066703_10829410 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005574|Ga0066694_10542141 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005586|Ga0066691_10290845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 963 | Open in IMG/M |
| 3300005614|Ga0068856_101594054 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005615|Ga0070702_100939751 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005713|Ga0066905_100506175 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300005719|Ga0068861_100092830 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300005764|Ga0066903_100028940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6199 | Open in IMG/M |
| 3300005764|Ga0066903_100117733 | All Organisms → cellular organisms → Bacteria | 3677 | Open in IMG/M |
| 3300006031|Ga0066651_10555186 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006046|Ga0066652_100002982 | All Organisms → cellular organisms → Bacteria | 9462 | Open in IMG/M |
| 3300006046|Ga0066652_100484344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1146 | Open in IMG/M |
| 3300006575|Ga0074053_11990308 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300006579|Ga0074054_10509322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300006580|Ga0074049_12477400 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300006603|Ga0074064_11077763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1189 | Open in IMG/M |
| 3300006794|Ga0066658_10096348 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300006797|Ga0066659_10306494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1214 | Open in IMG/M |
| 3300006852|Ga0075433_10007282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8770 | Open in IMG/M |
| 3300006854|Ga0075425_101325555 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300006904|Ga0075424_100034415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5255 | Open in IMG/M |
| 3300006953|Ga0074063_12428611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300009012|Ga0066710_101029580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1271 | Open in IMG/M |
| 3300009012|Ga0066710_101492014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1044 | Open in IMG/M |
| 3300009092|Ga0105250_10626522 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009137|Ga0066709_100398330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1909 | Open in IMG/M |
| 3300009137|Ga0066709_102677499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300009137|Ga0066709_103077930 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300009147|Ga0114129_12216024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 661 | Open in IMG/M |
| 3300009148|Ga0105243_10009144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7566 | Open in IMG/M |
| 3300010154|Ga0127503_10812133 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300010325|Ga0134064_10092099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 987 | Open in IMG/M |
| 3300010375|Ga0105239_11554525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
| 3300012198|Ga0137364_10790925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
| 3300012199|Ga0137383_10282517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1216 | Open in IMG/M |
| 3300012206|Ga0137380_10234005 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300012206|Ga0137380_10675732 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300012208|Ga0137376_10157820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1954 | Open in IMG/M |
| 3300012209|Ga0137379_10338152 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300012211|Ga0137377_10013368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7007 | Open in IMG/M |
| 3300012359|Ga0137385_10356467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1251 | Open in IMG/M |
| 3300012373|Ga0134042_1014729 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012400|Ga0134048_1072310 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012957|Ga0164303_10060072 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300012960|Ga0164301_10369366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 993 | Open in IMG/M |
| 3300012985|Ga0164308_10561418 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300012988|Ga0164306_10188994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1437 | Open in IMG/M |
| 3300012989|Ga0164305_10059771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2276 | Open in IMG/M |
| 3300013764|Ga0120111_1092886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300014150|Ga0134081_10359473 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300014166|Ga0134079_10189555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 855 | Open in IMG/M |
| 3300015357|Ga0134072_10230306 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300015358|Ga0134089_10203449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
| 3300015371|Ga0132258_12714953 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300015374|Ga0132255_101525533 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300017654|Ga0134069_1124274 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300017659|Ga0134083_10160893 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300017944|Ga0187786_10083432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1041 | Open in IMG/M |
| 3300018000|Ga0184604_10115428 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300018027|Ga0184605_10006668 | All Organisms → cellular organisms → Bacteria | 4249 | Open in IMG/M |
| 3300018060|Ga0187765_11172622 | Not Available | 537 | Open in IMG/M |
| 3300018066|Ga0184617_1169662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300018431|Ga0066655_10010467 | All Organisms → cellular organisms → Bacteria | 3996 | Open in IMG/M |
| 3300018468|Ga0066662_10071400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2327 | Open in IMG/M |
| 3300018482|Ga0066669_10476962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1076 | Open in IMG/M |
| 3300018482|Ga0066669_11292614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300019255|Ga0184643_1040888 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300019356|Ga0173481_10136562 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300019875|Ga0193701_1056855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
| 3300019885|Ga0193747_1009863 | All Organisms → cellular organisms → Bacteria | 2294 | Open in IMG/M |
| 3300021080|Ga0210382_10347862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300021418|Ga0193695_1002160 | All Organisms → cellular organisms → Bacteria | 3470 | Open in IMG/M |
| 3300022195|Ga0222625_1644692 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300025910|Ga0207684_10334397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1305 | Open in IMG/M |
| 3300025923|Ga0207681_10765019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
| 3300025934|Ga0207686_10254206 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300025935|Ga0207709_10061745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2343 | Open in IMG/M |
| 3300025937|Ga0207669_10839035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
| 3300026095|Ga0207676_11967794 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300026315|Ga0209686_1217606 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026327|Ga0209266_1047838 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
| 3300028768|Ga0307280_10262442 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300028784|Ga0307282_10314487 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300028819|Ga0307296_10264456 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300028878|Ga0307278_10190207 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300028884|Ga0307308_10283101 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300028885|Ga0307304_10014614 | All Organisms → cellular organisms → Bacteria | 2552 | Open in IMG/M |
| 3300030829|Ga0308203_1043266 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300031114|Ga0308187_10296059 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300031152|Ga0307501_10017639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1310 | Open in IMG/M |
| 3300031820|Ga0307473_10343434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 957 | Open in IMG/M |
| 3300031873|Ga0315297_10029435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4017 | Open in IMG/M |
| 3300032205|Ga0307472_100202377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1511 | Open in IMG/M |
| 3300032770|Ga0335085_10315470 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300033432|Ga0326729_1022514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.04% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.36% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.52% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.84% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Perma_A_C_03129770 | 2124908032 | Soil | MTRDATFLLALVSLAAAALAVGVSGWVLFSRDHRMAKQTHDAAAAHPEVPEGT |
| INPhiseqgaiiFebDRAFT_1018986372 | 3300000364 | Soil | MDRDATFLFALILFAAAALAVGASGWVLWIRDHRLAKATDVAPDAPHHEVTEEE* |
| Ga0062589_1012279622 | 3300004156 | Soil | MDRDATFLLALVLFAVAGLAVGASGWVLWARDHRLAKAASAAAHREVAEER* |
| Ga0063356_1008863072 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHREVAEER* |
| Ga0066816_10058972 | 3300005158 | Soil | MDRDATFLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER* |
| Ga0066674_100034314 | 3300005166 | Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAQPEVVEER* |
| Ga0066677_100556352 | 3300005171 | Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER* |
| Ga0066683_103208302 | 3300005172 | Soil | MDRDATFLLALILFTAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER* |
| Ga0066690_101019282 | 3300005177 | Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAAIAAAHPEVVEER* |
| Ga0066684_102168601 | 3300005179 | Soil | GVALVRYPGAFMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER* |
| Ga0066678_101027972 | 3300005181 | Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAPLAEVVEER* |
| Ga0066388_1005482752 | 3300005332 | Tropical Forest Soil | MGRDATFLFALILFAAAALAVGASGWVLWVRDHRLARSANTAAPARHEVPEEE* |
| Ga0066388_1007562871 | 3300005332 | Tropical Forest Soil | MDRDATFFLALVLFAAAAIVVGASGWVLWVRDHRLAKTASAAAAASHHEVSEEH* |
| Ga0066388_1040831082 | 3300005332 | Tropical Forest Soil | MDRDATFLFALILFAAAAIAVGTSGWMLWLRDHRLAKAGAVVSHHEVTEEE* |
| Ga0066388_1072401691 | 3300005332 | Tropical Forest Soil | MDRNATVTLALVMFAAAALAVGASGWVLWIRDHRLAKAATAAPVATHLEVAEEE* |
| Ga0070691_109187481 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | LMDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAANAAAHREVAEER* |
| Ga0070692_106200761 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | DRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHREVAEER* |
| Ga0070674_1000637882 | 3300005356 | Miscanthus Rhizosphere | MDRDATFLLALILFAAAGLAVGASGWVLWARDHRLAKAASAAAHPEVAEER* |
| Ga0070708_1003822752 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRDATVTLALIMFAAAALAVGASGWVLWIRDHRLAKAVGAGPVAAHHEVTEEE* |
| Ga0066682_109492742 | 3300005450 | Soil | FAAAALAVGASGWVLWIRDHRLAKAASAAPIAARHEVAEEE* |
| Ga0070699_1013579241 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEV |
| Ga0070699_1020363831 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LMDRDATFLLALILFAVAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER* |
| Ga0070697_1002774452 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRDATFLLALILFAVAALAVGASGWVLWARDRRLAKAASAAPRREVAEER* |
| Ga0066698_100397923 | 3300005558 | Soil | MDRNATFTLALIMFAAAALAVGASGWVLWIRDHRLAKAASAAPIAARHEVAEEE* |
| Ga0066703_108294101 | 3300005568 | Soil | DRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER* |
| Ga0066694_105421411 | 3300005574 | Soil | LFAAAALAVGASGWVLWARDHRLAKAASAAAQPEVVEER* |
| Ga0066691_102908452 | 3300005586 | Soil | MDRDATFLLALILFAGAALAVGASGWVLWARDHRLAKAASAAAHPEVSEDR* |
| Ga0068856_1015940541 | 3300005614 | Corn Rhizosphere | CVRSVPWRLMDRDATFLLALVLFAAAALAVGTSGWVLWARDHRLAKAASAPAHPEVAEER |
| Ga0070702_1009397511 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRDATFLLALVLFAAAALAVGTSGWVLWARDHRLAKAASAPAHPEVAEER* |
| Ga0066905_1005061752 | 3300005713 | Tropical Forest Soil | ALAVGASGWVLWVRDHRLAKAANTAAPAAHEVPEEE* |
| Ga0068861_1000928301 | 3300005719 | Switchgrass Rhizosphere | LLALVLFAAAALAVGTSGWVLWARDHRLAKAASAPAHPEVAEER* |
| Ga0066903_1000289409 | 3300005764 | Tropical Forest Soil | MDRNATVTLALVMFAAAALAVGASGWVLWIRDHRLAKAATAAPVTAHHEVTEEE* |
| Ga0066903_1001177332 | 3300005764 | Tropical Forest Soil | MDRDATFLFALILFAAAALAVGASGWLLWTRDHRLAKAASAAAAPREHEVAEEE* |
| Ga0066651_105551861 | 3300006031 | Soil | VGSVPWRLMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAGSAAAHPEVAEER* |
| Ga0066652_1000029822 | 3300006046 | Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAGSAAAHPEVAEER* |
| Ga0066652_1004843442 | 3300006046 | Soil | MDRNATVTLALVMFATAALAVGASGWVLWIRDHRLAKAASAAPVAAHHEVAEEE* |
| Ga0074053_119903082 | 3300006575 | Soil | MTRDATFLLALILFASAALAVGVSGWVLWTRDHRLAKASSAAGPAAHPEVVEER* |
| Ga0074054_105093222 | 3300006579 | Soil | MDRDATFLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAE |
| Ga0074049_124774001 | 3300006580 | Soil | AALTVGVSGWVLWTRDHRLAKASSAAGPAAHPEVVEER* |
| Ga0074064_110777632 | 3300006603 | Soil | MTRDATFLLTLILFAAAALAVGASGWVLWTRDHRLAKAASAATGAAHTEVVEER* |
| Ga0066658_100963482 | 3300006794 | Soil | VRYPDAFMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER* |
| Ga0066659_103064942 | 3300006797 | Soil | MDRDATFLLALILFAAAALAVGACGWVLWARDHRLVKAASAAAHPEVVEER* |
| Ga0075433_100072827 | 3300006852 | Populus Rhizosphere | MDRDATFLLALILFAAAALAVGASGWVLWIRDHRLAKAAAVAPDAAHHEVTEEE* |
| Ga0075425_1013255551 | 3300006854 | Populus Rhizosphere | LALVLFAVAALAVGASGWVLWARDHRLAKAANAAAHREVAEER* |
| Ga0075424_1000344152 | 3300006904 | Populus Rhizosphere | MDRDATFLFALMLFAAAALAVGASGWVLWIRDHRLAKATDVAPDAPHHEVTEEE* |
| Ga0074063_124286112 | 3300006953 | Soil | MTRDATFLLTLILFAAAALAVGASGWVLWTRDHRLAKAASAATGAA |
| Ga0066710_1010295802 | 3300009012 | Grasslands Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHREVAEER |
| Ga0066710_1014920142 | 3300009012 | Grasslands Soil | MDRDATFLLALILFTAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER |
| Ga0105250_106265222 | 3300009092 | Switchgrass Rhizosphere | ALAVGASGWVLWARDHRLAKAASAAAHREVAEER* |
| Ga0066709_1003983302 | 3300009137 | Grasslands Soil | MDRDATFLLALIVFAAAALAVGASGWVLWARDHRLAKAASAAAHREVAEER* |
| Ga0066709_1026774992 | 3300009137 | Grasslands Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAPHPEVVEER* |
| Ga0066709_1030779302 | 3300009137 | Grasslands Soil | RDSTFLFVLILFAAAALAVGASGWVLWIRDHRLAKAANVATVAAHHEVTEEE* |
| Ga0114129_122160242 | 3300009147 | Populus Rhizosphere | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHREVAEER* |
| Ga0105243_100091442 | 3300009148 | Miscanthus Rhizosphere | MDRDATFLLALVLFAAAALAVGTSGWVLWARDHRLAKAASAAAHPEVAEER* |
| Ga0127503_108121332 | 3300010154 | Soil | RDATFLLALILFASAALAVGVSGWVLWTRDHRLAKASSAAGSAAHPEVVEER* |
| Ga0134064_100920992 | 3300010325 | Grasslands Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAMAASAAAQPEVVEER* |
| Ga0105239_115545252 | 3300010375 | Corn Rhizosphere | MDRDATFLLALVLFAVAGLAVGASGWVLWARDHRLAKAASAAAHPEVAEER* |
| Ga0137364_107909252 | 3300012198 | Vadose Zone Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAARHPEVVEER* |
| Ga0137383_102825173 | 3300012199 | Vadose Zone Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER* |
| Ga0137380_102340052 | 3300012206 | Vadose Zone Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEDR* |
| Ga0137380_106757322 | 3300012206 | Vadose Zone Soil | MDRDATFLLALFLFAAAALAVGASGWVLWARDHRLAKAASAARHPEVVEER* |
| Ga0137376_101578202 | 3300012208 | Vadose Zone Soil | MDRDATFLLALVLFAAAGLAVGASGWVLWARDHRLAKAASAAAHHEVAEER* |
| Ga0137379_103381522 | 3300012209 | Vadose Zone Soil | ILFAAAALAVGASGWVLWARDHRLAKAASAAPHPEVVEER* |
| Ga0137377_100133683 | 3300012211 | Vadose Zone Soil | MDRDATFLLALILFAGAALAVGASGWVLWVRDHRLAKAASAAAHPEVVEER* |
| Ga0137385_103564672 | 3300012359 | Vadose Zone Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVIEER* |
| Ga0134042_10147292 | 3300012373 | Grasslands Soil | FLLALILFAAAALAVGASGWVLWARDHRLAKAASDAAQPEVVEER* |
| Ga0134048_10723102 | 3300012400 | Grasslands Soil | RDATVTLALIMFAAAALAVGASGWVLWIRDHRLAKAASAAAVAPHPGITEEE* |
| Ga0164303_100600722 | 3300012957 | Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER* |
| Ga0164301_103693662 | 3300012960 | Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDRRLAKAASAAAHREVAEER* |
| Ga0164308_105614182 | 3300012985 | Soil | MDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHHEVVEER* |
| Ga0164306_101889942 | 3300012988 | Soil | MDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER* |
| Ga0164305_100597712 | 3300012989 | Soil | MDRDATFLLALILFAVAALAVGASGWVLWARDHRLAKAASAAAHREVAEER* |
| Ga0120111_10928862 | 3300013764 | Permafrost | MDRDATFLLALILFAAAALAVGASGWVLWARDPRLARAASAAAHPEVVEER* |
| Ga0134081_103594732 | 3300014150 | Grasslands Soil | GAFMDRDATFLLALILFTAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER* |
| Ga0134079_101895552 | 3300014166 | Grasslands Soil | MDRDATFLLALILFTAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER* |
| Ga0134072_102303061 | 3300015357 | Grasslands Soil | DATFLLALILFAAAALAVGASGWVLWARDHRLAKAGSAAAHPEVAEER* |
| Ga0134089_102034492 | 3300015358 | Grasslands Soil | MDRDATFLLALILFAAAALAVGASGWVLWTRDHRLAKAASAAIVGAHHGVTEEA* |
| Ga0132258_127149532 | 3300015371 | Arabidopsis Rhizosphere | MDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAANAAAHREVAEER* |
| Ga0132255_1015255332 | 3300015374 | Arabidopsis Rhizosphere | MDRAATFLLALVLFAVAALAVGASGWVLWARDHRLAKAANAAAHREVAEER* |
| Ga0134069_11242741 | 3300017654 | Grasslands Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAMAASAAAQPEVVEER |
| Ga0134083_101608931 | 3300017659 | Grasslands Soil | ALAVGASGWVLWIRDHRLAKAATAAPIAARHEVAEEE |
| Ga0187786_100834322 | 3300017944 | Tropical Peatland | MTRDATFLLALILFAAAALAVGVSGWVLWTRDHRLAKATGAPEPAGHPEVVEEH |
| Ga0184604_101154282 | 3300018000 | Groundwater Sediment | LVLFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER |
| Ga0184605_100066683 | 3300018027 | Groundwater Sediment | MDRDATFLLALVLFAIAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER |
| Ga0187765_111726221 | 3300018060 | Tropical Peatland | MTRDATFLLALILFAGAALAVGVSGWVLWTRDHRLAKASGAPEPAGHPEVVEEH |
| Ga0184617_11696622 | 3300018066 | Groundwater Sediment | MDRDATFLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER |
| Ga0066655_100104675 | 3300018431 | Grasslands Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAQPEVVEER |
| Ga0066662_100714002 | 3300018468 | Grasslands Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAPLAEVVEER |
| Ga0066669_104769621 | 3300018482 | Grasslands Soil | MDRNATVTLALVMFATAALAVGASGWVLWIRDHRLAKAASAAPVAAHHEVAEEE |
| Ga0066669_112926142 | 3300018482 | Grasslands Soil | MDRNATFTLALIMFAAAALAVGASGWVLWIRDHRLAKAASAAPIAARHEVAEEE |
| Ga0184643_10408882 | 3300019255 | Groundwater Sediment | FAAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER |
| Ga0173481_101365622 | 3300019356 | Soil | MDRDATFLLALVLFAVAGLAVGASGWVLWARDHRLAKAASAAAHREVVEER |
| Ga0193701_10568552 | 3300019875 | Soil | MDRDATFLLALVLFAIAALAVGASGWVLWARDHRLAKAASAAAHREVAEER |
| Ga0193747_10098632 | 3300019885 | Soil | MDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER |
| Ga0210382_103478622 | 3300021080 | Groundwater Sediment | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAH |
| Ga0193695_10021602 | 3300021418 | Soil | MDRDATFLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER |
| Ga0222625_16446922 | 3300022195 | Groundwater Sediment | AAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER |
| Ga0207684_103343972 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRDATVTLALIMFAAAALAVGASGWVLWIRDHRLAKAVGAGPVAAHHEVTEEE |
| Ga0207681_107650191 | 3300025923 | Switchgrass Rhizosphere | MDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHREVAEER |
| Ga0207686_102542062 | 3300025934 | Miscanthus Rhizosphere | MDRDATFLLALVLFAAAALAVGTSGWVLWARDHRLAKAASAPAHPEVAEER |
| Ga0207709_100617453 | 3300025935 | Miscanthus Rhizosphere | MDRDATFLLALVLFAAAALAVGTSGWVLWARDHRLAKAASAAAHPEVAEER |
| Ga0207669_108390352 | 3300025937 | Miscanthus Rhizosphere | MDRDATFLLALILFAAAGLAVGASGWVLWARDHRLAKAASAAAHPEVAEER |
| Ga0207676_119677942 | 3300026095 | Switchgrass Rhizosphere | FLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER |
| Ga0209686_12176061 | 3300026315 | Soil | ALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER |
| Ga0209266_10478384 | 3300026327 | Soil | MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAPHPEVVEER |
| Ga0307280_102624422 | 3300028768 | Soil | AAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER |
| Ga0307282_103144871 | 3300028784 | Soil | AAAALAVGASGWVLWARDHRLAKAASAAAHREVAEER |
| Ga0307296_102644562 | 3300028819 | Soil | TFLLALTLFAAAALAVGASGWVLWARDHRLAKTARAAAHPEVAEDR |
| Ga0307278_101902071 | 3300028878 | Soil | LILFAAAALAVGASGWVLWIRDHRLVKAASAAPVPAHHEVTEEE |
| Ga0307308_102831012 | 3300028884 | Soil | MDRDATFLLALTLFAAAALAVGASGWVLWARDHRLAKTARAAAHPEVAEDR |
| Ga0307304_100146141 | 3300028885 | Soil | PWRLMDRDATFLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHREVAEER |
| Ga0308203_10432661 | 3300030829 | Soil | ATFLLALVLFAIAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER |
| Ga0308187_102960591 | 3300031114 | Soil | FLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER |
| Ga0307501_100176392 | 3300031152 | Soil | MDRDATFLLALVLFAAAGLAVGASGWVLWARDHRLAKAASAAAHHEVAEER |
| Ga0307473_103434342 | 3300031820 | Hardwood Forest Soil | MTRDATFLLALILFASAALAVGVSGWVLWTRDHRLAKASNAAGPAAHPEVVEER |
| Ga0315297_100294354 | 3300031873 | Sediment | MTRDATFLFALVSLAAAALAVGVSGWVLFSRDHRMATLTHDAAVAHPEVPEGS |
| Ga0307472_1002023772 | 3300032205 | Hardwood Forest Soil | MTRDATFLLALILFACAALAVGASGWIHWARDHRLAKAAGPAPAAHPEVVEER |
| Ga0335085_103154702 | 3300032770 | Soil | MTRDATFLLALILFAFAALAVGVSGWVLWTRDHRLAKAASAAGPAAHPEVVEER |
| Ga0326729_10225142 | 3300033432 | Peat Soil | MTRDATFLLALILFAAAALAVGTSGWVLWTRDHRLAKAASAAARAAHTEVVEER |
| ⦗Top⦘ |