NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074848

Metagenome / Metatranscriptome Family F074848

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074848
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 50 residues
Representative Sequence MDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER
Number of Associated Samples 108
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.56 %
% of genes near scaffold ends (potentially truncated) 34.45 %
% of genes from short scaffolds (< 2000 bps) 81.51 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.479 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.126 % of family members)
Environment Ontology (ENVO) Unclassified
(28.571 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.143 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 80.39%    β-sheet: 0.00%    Coil/Unstructured: 19.61%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00815Histidinol_dh 57.14
PF00144Beta-lactamase 23.53
PF02511Thy1 10.92
PF00977His_biosynth 3.36
PF17164DUF5122 0.84
PF00701DHDPS 0.84
PF03793PASTA 0.84
PF00005ABC_tran 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0141Histidinol dehydrogenaseAmino acid transport and metabolism [E] 57.14
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 23.53
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 23.53
COG2367Beta-lactamase class ADefense mechanisms [V] 23.53
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 10.92
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.48 %
UnclassifiedrootN/A2.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908032|Perma_A_C_ConsensusfromContig108737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria913Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101898637All Organisms → cellular organisms → Bacteria2268Open in IMG/M
3300004156|Ga0062589_101227962All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300004463|Ga0063356_100886307All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300005158|Ga0066816_1005897All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300005166|Ga0066674_10003431All Organisms → cellular organisms → Bacteria5967Open in IMG/M
3300005171|Ga0066677_10055635All Organisms → cellular organisms → Bacteria1991Open in IMG/M
3300005172|Ga0066683_10320830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium963Open in IMG/M
3300005177|Ga0066690_10101928All Organisms → cellular organisms → Bacteria1844Open in IMG/M
3300005179|Ga0066684_10216860All Organisms → cellular organisms → Bacteria1244Open in IMG/M
3300005181|Ga0066678_10102797All Organisms → cellular organisms → Bacteria1733Open in IMG/M
3300005332|Ga0066388_100548275All Organisms → cellular organisms → Bacteria1786Open in IMG/M
3300005332|Ga0066388_100756287All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300005332|Ga0066388_104083108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium744Open in IMG/M
3300005332|Ga0066388_107240169Not Available557Open in IMG/M
3300005341|Ga0070691_10918748All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300005345|Ga0070692_10620076All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300005356|Ga0070674_100063788All Organisms → cellular organisms → Bacteria2580Open in IMG/M
3300005445|Ga0070708_100382275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1327Open in IMG/M
3300005450|Ga0066682_10949274All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005518|Ga0070699_101357924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium652Open in IMG/M
3300005518|Ga0070699_102036383Not Available525Open in IMG/M
3300005536|Ga0070697_100277445All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300005558|Ga0066698_10039792All Organisms → cellular organisms → Bacteria2914Open in IMG/M
3300005568|Ga0066703_10829410All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005574|Ga0066694_10542141All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005586|Ga0066691_10290845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium963Open in IMG/M
3300005614|Ga0068856_101594054All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005615|Ga0070702_100939751All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300005713|Ga0066905_100506175All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300005719|Ga0068861_100092830All Organisms → cellular organisms → Bacteria2385Open in IMG/M
3300005764|Ga0066903_100028940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6199Open in IMG/M
3300005764|Ga0066903_100117733All Organisms → cellular organisms → Bacteria3677Open in IMG/M
3300006031|Ga0066651_10555186All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300006046|Ga0066652_100002982All Organisms → cellular organisms → Bacteria9462Open in IMG/M
3300006046|Ga0066652_100484344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1146Open in IMG/M
3300006575|Ga0074053_11990308All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300006579|Ga0074054_10509322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300006580|Ga0074049_12477400All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300006603|Ga0074064_11077763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1189Open in IMG/M
3300006794|Ga0066658_10096348All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300006797|Ga0066659_10306494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1214Open in IMG/M
3300006852|Ga0075433_10007282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8770Open in IMG/M
3300006854|Ga0075425_101325555All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300006904|Ga0075424_100034415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5255Open in IMG/M
3300006953|Ga0074063_12428611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300009012|Ga0066710_101029580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1271Open in IMG/M
3300009012|Ga0066710_101492014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1044Open in IMG/M
3300009092|Ga0105250_10626522All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300009137|Ga0066709_100398330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1909Open in IMG/M
3300009137|Ga0066709_102677499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300009137|Ga0066709_103077930All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300009147|Ga0114129_12216024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300009148|Ga0105243_10009144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7566Open in IMG/M
3300010154|Ga0127503_10812133All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300010325|Ga0134064_10092099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium987Open in IMG/M
3300010375|Ga0105239_11554525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300012198|Ga0137364_10790925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium717Open in IMG/M
3300012199|Ga0137383_10282517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1216Open in IMG/M
3300012206|Ga0137380_10234005All Organisms → cellular organisms → Bacteria1659Open in IMG/M
3300012206|Ga0137380_10675732All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300012208|Ga0137376_10157820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1954Open in IMG/M
3300012209|Ga0137379_10338152All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300012211|Ga0137377_10013368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7007Open in IMG/M
3300012359|Ga0137385_10356467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1251Open in IMG/M
3300012373|Ga0134042_1014729All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300012400|Ga0134048_1072310All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300012957|Ga0164303_10060072All Organisms → cellular organisms → Bacteria1728Open in IMG/M
3300012960|Ga0164301_10369366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium993Open in IMG/M
3300012985|Ga0164308_10561418All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300012988|Ga0164306_10188994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1437Open in IMG/M
3300012989|Ga0164305_10059771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2276Open in IMG/M
3300013764|Ga0120111_1092886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium715Open in IMG/M
3300014150|Ga0134081_10359473All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300014166|Ga0134079_10189555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium855Open in IMG/M
3300015357|Ga0134072_10230306All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300015358|Ga0134089_10203449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium797Open in IMG/M
3300015371|Ga0132258_12714953All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300015374|Ga0132255_101525533All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300017654|Ga0134069_1124274All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300017659|Ga0134083_10160893All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300017944|Ga0187786_10083432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300018000|Ga0184604_10115428All Organisms → cellular organisms → Bacteria850Open in IMG/M
3300018027|Ga0184605_10006668All Organisms → cellular organisms → Bacteria4249Open in IMG/M
3300018060|Ga0187765_11172622Not Available537Open in IMG/M
3300018066|Ga0184617_1169662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300018431|Ga0066655_10010467All Organisms → cellular organisms → Bacteria3996Open in IMG/M
3300018468|Ga0066662_10071400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2327Open in IMG/M
3300018482|Ga0066669_10476962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1076Open in IMG/M
3300018482|Ga0066669_11292614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300019255|Ga0184643_1040888All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300019356|Ga0173481_10136562All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300019875|Ga0193701_1056855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium785Open in IMG/M
3300019885|Ga0193747_1009863All Organisms → cellular organisms → Bacteria2294Open in IMG/M
3300021080|Ga0210382_10347862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300021418|Ga0193695_1002160All Organisms → cellular organisms → Bacteria3470Open in IMG/M
3300022195|Ga0222625_1644692All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300025910|Ga0207684_10334397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1305Open in IMG/M
3300025923|Ga0207681_10765019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium806Open in IMG/M
3300025934|Ga0207686_10254206All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300025935|Ga0207709_10061745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2343Open in IMG/M
3300025937|Ga0207669_10839035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium764Open in IMG/M
3300026095|Ga0207676_11967794All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300026315|Ga0209686_1217606All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300026327|Ga0209266_1047838All Organisms → cellular organisms → Bacteria2124Open in IMG/M
3300028768|Ga0307280_10262442All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300028784|Ga0307282_10314487All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300028819|Ga0307296_10264456All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300028878|Ga0307278_10190207All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300028884|Ga0307308_10283101All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300028885|Ga0307304_10014614All Organisms → cellular organisms → Bacteria2552Open in IMG/M
3300030829|Ga0308203_1043266All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300031114|Ga0308187_10296059All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300031152|Ga0307501_10017639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1310Open in IMG/M
3300031820|Ga0307473_10343434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium957Open in IMG/M
3300031873|Ga0315297_10029435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4017Open in IMG/M
3300032205|Ga0307472_100202377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1511Open in IMG/M
3300032770|Ga0335085_10315470All Organisms → cellular organisms → Bacteria1846Open in IMG/M
3300033432|Ga0326729_1022514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1029Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil14.29%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil7.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.04%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.36%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.52%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.52%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.68%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.68%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.84%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.84%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.84%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.84%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005158Soil and rhizosphere microbial communities from Laval, Canada - mgHAAEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012373Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012400Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033432Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Perma_A_C_031297702124908032SoilMTRDATFLLALVSLAAAALAVGVSGWVLFSRDHRMAKQTHDAAAAHPEVPEGT
INPhiseqgaiiFebDRAFT_10189863723300000364SoilMDRDATFLFALILFAAAALAVGASGWVLWIRDHRLAKATDVAPDAPHHEVTEEE*
Ga0062589_10122796223300004156SoilMDRDATFLLALVLFAVAGLAVGASGWVLWARDHRLAKAASAAAHREVAEER*
Ga0063356_10088630723300004463Arabidopsis Thaliana RhizosphereMDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHREVAEER*
Ga0066816_100589723300005158SoilMDRDATFLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER*
Ga0066674_1000343143300005166SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAQPEVVEER*
Ga0066677_1005563523300005171SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER*
Ga0066683_1032083023300005172SoilMDRDATFLLALILFTAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER*
Ga0066690_1010192823300005177SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAAIAAAHPEVVEER*
Ga0066684_1021686013300005179SoilGVALVRYPGAFMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER*
Ga0066678_1010279723300005181SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAPLAEVVEER*
Ga0066388_10054827523300005332Tropical Forest SoilMGRDATFLFALILFAAAALAVGASGWVLWVRDHRLARSANTAAPARHEVPEEE*
Ga0066388_10075628713300005332Tropical Forest SoilMDRDATFFLALVLFAAAAIVVGASGWVLWVRDHRLAKTASAAAAASHHEVSEEH*
Ga0066388_10408310823300005332Tropical Forest SoilMDRDATFLFALILFAAAAIAVGTSGWMLWLRDHRLAKAGAVVSHHEVTEEE*
Ga0066388_10724016913300005332Tropical Forest SoilMDRNATVTLALVMFAAAALAVGASGWVLWIRDHRLAKAATAAPVATHLEVAEEE*
Ga0070691_1091874813300005341Corn, Switchgrass And Miscanthus RhizosphereLMDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAANAAAHREVAEER*
Ga0070692_1062007613300005345Corn, Switchgrass And Miscanthus RhizosphereDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHREVAEER*
Ga0070674_10006378823300005356Miscanthus RhizosphereMDRDATFLLALILFAAAGLAVGASGWVLWARDHRLAKAASAAAHPEVAEER*
Ga0070708_10038227523300005445Corn, Switchgrass And Miscanthus RhizosphereMDRDATVTLALIMFAAAALAVGASGWVLWIRDHRLAKAVGAGPVAAHHEVTEEE*
Ga0066682_1094927423300005450SoilFAAAALAVGASGWVLWIRDHRLAKAASAAPIAARHEVAEEE*
Ga0070699_10135792413300005518Corn, Switchgrass And Miscanthus RhizosphereMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEV
Ga0070699_10203638313300005518Corn, Switchgrass And Miscanthus RhizosphereLMDRDATFLLALILFAVAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER*
Ga0070697_10027744523300005536Corn, Switchgrass And Miscanthus RhizosphereMDRDATFLLALILFAVAALAVGASGWVLWARDRRLAKAASAAPRREVAEER*
Ga0066698_1003979233300005558SoilMDRNATFTLALIMFAAAALAVGASGWVLWIRDHRLAKAASAAPIAARHEVAEEE*
Ga0066703_1082941013300005568SoilDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER*
Ga0066694_1054214113300005574SoilLFAAAALAVGASGWVLWARDHRLAKAASAAAQPEVVEER*
Ga0066691_1029084523300005586SoilMDRDATFLLALILFAGAALAVGASGWVLWARDHRLAKAASAAAHPEVSEDR*
Ga0068856_10159405413300005614Corn RhizosphereCVRSVPWRLMDRDATFLLALVLFAAAALAVGTSGWVLWARDHRLAKAASAPAHPEVAEER
Ga0070702_10093975113300005615Corn, Switchgrass And Miscanthus RhizosphereMDRDATFLLALVLFAAAALAVGTSGWVLWARDHRLAKAASAPAHPEVAEER*
Ga0066905_10050617523300005713Tropical Forest SoilALAVGASGWVLWVRDHRLAKAANTAAPAAHEVPEEE*
Ga0068861_10009283013300005719Switchgrass RhizosphereLLALVLFAAAALAVGTSGWVLWARDHRLAKAASAPAHPEVAEER*
Ga0066903_10002894093300005764Tropical Forest SoilMDRNATVTLALVMFAAAALAVGASGWVLWIRDHRLAKAATAAPVTAHHEVTEEE*
Ga0066903_10011773323300005764Tropical Forest SoilMDRDATFLFALILFAAAALAVGASGWLLWTRDHRLAKAASAAAAPREHEVAEEE*
Ga0066651_1055518613300006031SoilVGSVPWRLMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAGSAAAHPEVAEER*
Ga0066652_10000298223300006046SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAGSAAAHPEVAEER*
Ga0066652_10048434423300006046SoilMDRNATVTLALVMFATAALAVGASGWVLWIRDHRLAKAASAAPVAAHHEVAEEE*
Ga0074053_1199030823300006575SoilMTRDATFLLALILFASAALAVGVSGWVLWTRDHRLAKASSAAGPAAHPEVVEER*
Ga0074054_1050932223300006579SoilMDRDATFLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAE
Ga0074049_1247740013300006580SoilAALTVGVSGWVLWTRDHRLAKASSAAGPAAHPEVVEER*
Ga0074064_1107776323300006603SoilMTRDATFLLTLILFAAAALAVGASGWVLWTRDHRLAKAASAATGAAHTEVVEER*
Ga0066658_1009634823300006794SoilVRYPDAFMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER*
Ga0066659_1030649423300006797SoilMDRDATFLLALILFAAAALAVGACGWVLWARDHRLVKAASAAAHPEVVEER*
Ga0075433_1000728273300006852Populus RhizosphereMDRDATFLLALILFAAAALAVGASGWVLWIRDHRLAKAAAVAPDAAHHEVTEEE*
Ga0075425_10132555513300006854Populus RhizosphereLALVLFAVAALAVGASGWVLWARDHRLAKAANAAAHREVAEER*
Ga0075424_10003441523300006904Populus RhizosphereMDRDATFLFALMLFAAAALAVGASGWVLWIRDHRLAKATDVAPDAPHHEVTEEE*
Ga0074063_1242861123300006953SoilMTRDATFLLTLILFAAAALAVGASGWVLWTRDHRLAKAASAATGAA
Ga0066710_10102958023300009012Grasslands SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHREVAEER
Ga0066710_10149201423300009012Grasslands SoilMDRDATFLLALILFTAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER
Ga0105250_1062652223300009092Switchgrass RhizosphereALAVGASGWVLWARDHRLAKAASAAAHREVAEER*
Ga0066709_10039833023300009137Grasslands SoilMDRDATFLLALIVFAAAALAVGASGWVLWARDHRLAKAASAAAHREVAEER*
Ga0066709_10267749923300009137Grasslands SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAPHPEVVEER*
Ga0066709_10307793023300009137Grasslands SoilRDSTFLFVLILFAAAALAVGASGWVLWIRDHRLAKAANVATVAAHHEVTEEE*
Ga0114129_1221602423300009147Populus RhizosphereMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHREVAEER*
Ga0105243_1000914423300009148Miscanthus RhizosphereMDRDATFLLALVLFAAAALAVGTSGWVLWARDHRLAKAASAAAHPEVAEER*
Ga0127503_1081213323300010154SoilRDATFLLALILFASAALAVGVSGWVLWTRDHRLAKASSAAGSAAHPEVVEER*
Ga0134064_1009209923300010325Grasslands SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAMAASAAAQPEVVEER*
Ga0105239_1155452523300010375Corn RhizosphereMDRDATFLLALVLFAVAGLAVGASGWVLWARDHRLAKAASAAAHPEVAEER*
Ga0137364_1079092523300012198Vadose Zone SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAARHPEVVEER*
Ga0137383_1028251733300012199Vadose Zone SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER*
Ga0137380_1023400523300012206Vadose Zone SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEDR*
Ga0137380_1067573223300012206Vadose Zone SoilMDRDATFLLALFLFAAAALAVGASGWVLWARDHRLAKAASAARHPEVVEER*
Ga0137376_1015782023300012208Vadose Zone SoilMDRDATFLLALVLFAAAGLAVGASGWVLWARDHRLAKAASAAAHHEVAEER*
Ga0137379_1033815223300012209Vadose Zone SoilILFAAAALAVGASGWVLWARDHRLAKAASAAPHPEVVEER*
Ga0137377_1001336833300012211Vadose Zone SoilMDRDATFLLALILFAGAALAVGASGWVLWVRDHRLAKAASAAAHPEVVEER*
Ga0137385_1035646723300012359Vadose Zone SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVIEER*
Ga0134042_101472923300012373Grasslands SoilFLLALILFAAAALAVGASGWVLWARDHRLAKAASDAAQPEVVEER*
Ga0134048_107231023300012400Grasslands SoilRDATVTLALIMFAAAALAVGASGWVLWIRDHRLAKAASAAAVAPHPGITEEE*
Ga0164303_1006007223300012957SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER*
Ga0164301_1036936623300012960SoilMDRDATFLLALILFAAAALAVGASGWVLWARDRRLAKAASAAAHREVAEER*
Ga0164308_1056141823300012985SoilMDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHHEVVEER*
Ga0164306_1018899423300012988SoilMDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER*
Ga0164305_1005977123300012989SoilMDRDATFLLALILFAVAALAVGASGWVLWARDHRLAKAASAAAHREVAEER*
Ga0120111_109288623300013764PermafrostMDRDATFLLALILFAAAALAVGASGWVLWARDPRLARAASAAAHPEVVEER*
Ga0134081_1035947323300014150Grasslands SoilGAFMDRDATFLLALILFTAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER*
Ga0134079_1018955523300014166Grasslands SoilMDRDATFLLALILFTAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER*
Ga0134072_1023030613300015357Grasslands SoilDATFLLALILFAAAALAVGASGWVLWARDHRLAKAGSAAAHPEVAEER*
Ga0134089_1020344923300015358Grasslands SoilMDRDATFLLALILFAAAALAVGASGWVLWTRDHRLAKAASAAIVGAHHGVTEEA*
Ga0132258_1271495323300015371Arabidopsis RhizosphereMDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAANAAAHREVAEER*
Ga0132255_10152553323300015374Arabidopsis RhizosphereMDRAATFLLALVLFAVAALAVGASGWVLWARDHRLAKAANAAAHREVAEER*
Ga0134069_112427413300017654Grasslands SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAMAASAAAQPEVVEER
Ga0134083_1016089313300017659Grasslands SoilALAVGASGWVLWIRDHRLAKAATAAPIAARHEVAEEE
Ga0187786_1008343223300017944Tropical PeatlandMTRDATFLLALILFAAAALAVGVSGWVLWTRDHRLAKATGAPEPAGHPEVVEEH
Ga0184604_1011542823300018000Groundwater SedimentLVLFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER
Ga0184605_1000666833300018027Groundwater SedimentMDRDATFLLALVLFAIAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER
Ga0187765_1117262213300018060Tropical PeatlandMTRDATFLLALILFAGAALAVGVSGWVLWTRDHRLAKASGAPEPAGHPEVVEEH
Ga0184617_116966223300018066Groundwater SedimentMDRDATFLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER
Ga0066655_1001046753300018431Grasslands SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAQPEVVEER
Ga0066662_1007140023300018468Grasslands SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAPLAEVVEER
Ga0066669_1047696213300018482Grasslands SoilMDRNATVTLALVMFATAALAVGASGWVLWIRDHRLAKAASAAPVAAHHEVAEEE
Ga0066669_1129261423300018482Grasslands SoilMDRNATFTLALIMFAAAALAVGASGWVLWIRDHRLAKAASAAPIAARHEVAEEE
Ga0184643_104088823300019255Groundwater SedimentFAAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER
Ga0173481_1013656223300019356SoilMDRDATFLLALVLFAVAGLAVGASGWVLWARDHRLAKAASAAAHREVVEER
Ga0193701_105685523300019875SoilMDRDATFLLALVLFAIAALAVGASGWVLWARDHRLAKAASAAAHREVAEER
Ga0193747_100986323300019885SoilMDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER
Ga0210382_1034786223300021080Groundwater SedimentMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAH
Ga0193695_100216023300021418SoilMDRDATFLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHHEVAEER
Ga0222625_164469223300022195Groundwater SedimentAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER
Ga0207684_1033439723300025910Corn, Switchgrass And Miscanthus RhizosphereMDRDATVTLALIMFAAAALAVGASGWVLWIRDHRLAKAVGAGPVAAHHEVTEEE
Ga0207681_1076501913300025923Switchgrass RhizosphereMDRDATFLLALVLFAVAALAVGASGWVLWARDHRLAKAASAAAHREVAEER
Ga0207686_1025420623300025934Miscanthus RhizosphereMDRDATFLLALVLFAAAALAVGTSGWVLWARDHRLAKAASAPAHPEVAEER
Ga0207709_1006174533300025935Miscanthus RhizosphereMDRDATFLLALVLFAAAALAVGTSGWVLWARDHRLAKAASAAAHPEVAEER
Ga0207669_1083903523300025937Miscanthus RhizosphereMDRDATFLLALILFAAAGLAVGASGWVLWARDHRLAKAASAAAHPEVAEER
Ga0207676_1196779423300026095Switchgrass RhizosphereFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER
Ga0209686_121760613300026315SoilALILFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVVEER
Ga0209266_104783843300026327SoilMDRDATFLLALILFAAAALAVGASGWVLWARDHRLAKAASAAPHPEVVEER
Ga0307280_1026244223300028768SoilAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER
Ga0307282_1031448713300028784SoilAAAALAVGASGWVLWARDHRLAKAASAAAHREVAEER
Ga0307296_1026445623300028819SoilTFLLALTLFAAAALAVGASGWVLWARDHRLAKTARAAAHPEVAEDR
Ga0307278_1019020713300028878SoilLILFAAAALAVGASGWVLWIRDHRLVKAASAAPVPAHHEVTEEE
Ga0307308_1028310123300028884SoilMDRDATFLLALTLFAAAALAVGASGWVLWARDHRLAKTARAAAHPEVAEDR
Ga0307304_1001461413300028885SoilPWRLMDRDATFLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHREVAEER
Ga0308203_104326613300030829SoilATFLLALVLFAIAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER
Ga0308187_1029605913300031114SoilFLLALVLFAAAALAVGASGWVLWARDHRLAKAASAAAHPEVAEER
Ga0307501_1001763923300031152SoilMDRDATFLLALVLFAAAGLAVGASGWVLWARDHRLAKAASAAAHHEVAEER
Ga0307473_1034343423300031820Hardwood Forest SoilMTRDATFLLALILFASAALAVGVSGWVLWTRDHRLAKASNAAGPAAHPEVVEER
Ga0315297_1002943543300031873SedimentMTRDATFLFALVSLAAAALAVGVSGWVLFSRDHRMATLTHDAAVAHPEVPEGS
Ga0307472_10020237723300032205Hardwood Forest SoilMTRDATFLLALILFACAALAVGASGWIHWARDHRLAKAAGPAPAAHPEVVEER
Ga0335085_1031547023300032770SoilMTRDATFLLALILFAFAALAVGVSGWVLWTRDHRLAKAASAAGPAAHPEVVEER
Ga0326729_102251423300033432Peat SoilMTRDATFLLALILFAAAALAVGTSGWVLWTRDHRLAKAASAAARAAHTEVVEER


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.