Metagenome / Metatranscriptome Family F074834

Basic Information
Family ID	F074834
Family Type	Metagenome / Metatranscriptome
Number of Sequences	119
Average Sequence Length	42 residues
Representative Sequence	PLDDAAFAVIREQVDAAADALRAVHIEPGSARALALFSA
Number of Associated Samples	107
Number of Associated Scaffolds	119

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	93.28 %
Associated GOLD sequencing projects	100
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.64

Most Common Taxonomy
Group	Unclassified (56.303 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (9.244 % of family members)
Environment Ontology (ENVO)	Unclassified (49.580 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (54.622 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 119 Family Scaffolds
PF01653	DNA_ligase_aden	81.51
PF03120	DNA_ligase_OB	10.08
PF14520	HHH_5	3.36
PF00483	NTP_transferase	2.52
PF01497	Peripla_BP_2	0.84
PF03480	DctP	0.84

COG ID	Name	Functional Category	% Frequency in 119 Family Scaffolds
COG0272	NAD-dependent DNA ligase	Replication, recombination and repair [L]	91.60
COG0614	ABC-type Fe3+-hydroxamate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.84
COG4558	ABC-type hemin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.84
COG4592	ABC-type Fe2+-enterobactin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.84
COG4594	ABC-type Fe3+-citrate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.84
COG4607	ABC-type enterochelin transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.84

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.30 %
All Organisms	root	All Organisms	43.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.30 %
cellular organisms	root	All Organisms → cellular organisms	43.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.30 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	42.02 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.30 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	36.13 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	1.68 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.30 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	34.45 %
Stramenopiles	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles	1.68 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.30 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3.36 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2.52 %
Ochrophyta	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta	1.68 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	0.84 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.30 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2.52 %
Raphidophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Raphidophyceae	1.68 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.84 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.84 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.30 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2.52 %
Chattonellales	order	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Raphidophyceae → Chattonellales	1.68 %
Aromatoleum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum	0.84 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.84 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.30 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2.52 %
Chattonellaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Raphidophyceae → Chattonellales → Chattonellaceae	1.68 %
Aromatoleum tolulyticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum tolulyticum	0.84 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.84 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.30 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2.52 %
Heterosigma	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Raphidophyceae → Chattonellales → Chattonellaceae → Heterosigma	1.68 %
Aromatoleum tolulyticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum tolulyticum	0.84 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.84 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	56.30 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2.52 %
Heterosigma akashiwo	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Raphidophyceae → Chattonellales → Chattonellaceae → Heterosigma → Heterosigma akashiwo	1.68 %
Aromatoleum tolulyticum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum tolulyticum	0.84 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.84 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.84 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300003991\|Ga0055461_10021744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1359	Open in IMG/M
3300004463\|Ga0063356_101491098	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1001	Open in IMG/M
3300004479\|Ga0062595_102532569	Not Available	512	Open in IMG/M
3300005330\|Ga0070690_101212088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	602	Open in IMG/M
3300005333\|Ga0070677_10431545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	701	Open in IMG/M
3300005334\|Ga0068869_100032969	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3654	Open in IMG/M
3300005339\|Ga0070660_101416170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	590	Open in IMG/M
3300005341\|Ga0070691_10125069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1298	Open in IMG/M
3300005341\|Ga0070691_10347873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	822	Open in IMG/M
3300005343\|Ga0070687_100548217	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	786	Open in IMG/M
3300005347\|Ga0070668_100127185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2042	Open in IMG/M
3300005353\|Ga0070669_100472616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1036	Open in IMG/M
3300005353\|Ga0070669_100612629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	913	Open in IMG/M
3300005364\|Ga0070673_102089248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	538	Open in IMG/M
3300005439\|Ga0070711_100317573	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1243	Open in IMG/M
3300005455\|Ga0070663_101060144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	707	Open in IMG/M
3300005455\|Ga0070663_101513960	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	596	Open in IMG/M
3300005458\|Ga0070681_11711204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	555	Open in IMG/M
3300005481\|Ga0074210_114803	Not Available	811	Open in IMG/M
3300005530\|Ga0070679_100340993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1447	Open in IMG/M
3300005539\|Ga0068853_100597329	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1048	Open in IMG/M
3300005539\|Ga0068853_101498595	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	653	Open in IMG/M
3300005543\|Ga0070672_101829911	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300005546\|Ga0070696_100977702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	706	Open in IMG/M
3300005548\|Ga0070665_101030808	Not Available	835	Open in IMG/M
3300005548\|Ga0070665_101095892	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	808	Open in IMG/M
3300005548\|Ga0070665_101350629	All Organisms → cellular organisms → Bacteria → Proteobacteria	722	Open in IMG/M
3300005553\|Ga0066695_10502476	All Organisms → cellular organisms → Bacteria → Proteobacteria	745	Open in IMG/M
3300005564\|Ga0070664_101972608	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	554	Open in IMG/M
3300005616\|Ga0068852_102569930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	529	Open in IMG/M
3300005834\|Ga0068851_10462412	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	755	Open in IMG/M
3300006606\|Ga0074062_12035420	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	544	Open in IMG/M
3300006844\|Ga0075428_102214875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	567	Open in IMG/M
3300006852\|Ga0075433_11300091	Not Available	630	Open in IMG/M
3300006854\|Ga0075425_100432714	Not Available	1515	Open in IMG/M
3300006871\|Ga0075434_102560923	Not Available	511	Open in IMG/M
3300006914\|Ga0075436_100935363	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	649	Open in IMG/M
3300007076\|Ga0075435_100375892	Not Available	1220	Open in IMG/M
3300009101\|Ga0105247_11540937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	543	Open in IMG/M
3300009101\|Ga0105247_11685867	Not Available	523	Open in IMG/M
3300009156\|Ga0111538_12591816	Not Available	636	Open in IMG/M
3300009174\|Ga0105241_12239346	Not Available	543	Open in IMG/M
3300009177\|Ga0105248_12641085	Not Available	573	Open in IMG/M
3300010364\|Ga0134066_10449571	Not Available	503	Open in IMG/M
3300010399\|Ga0134127_10955401	Not Available	915	Open in IMG/M
3300010401\|Ga0134121_12287493	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Raphidophyceae → Chattonellales → Chattonellaceae → Heterosigma → Heterosigma akashiwo	579	Open in IMG/M
3300011423\|Ga0137436_1214260	Not Available	505	Open in IMG/M
3300012200\|Ga0137382_10402734	Not Available	964	Open in IMG/M
3300012511\|Ga0157332_1065567	Not Available	555	Open in IMG/M
3300012958\|Ga0164299_10791742	Not Available	675	Open in IMG/M
3300013100\|Ga0157373_11295806	Not Available	551	Open in IMG/M
3300013296\|Ga0157374_10415123	Not Available	1344	Open in IMG/M
3300013297\|Ga0157378_13262031	Not Available	504	Open in IMG/M
3300013307\|Ga0157372_13333382	Not Available	511	Open in IMG/M
3300014318\|Ga0075351_1204948	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	504	Open in IMG/M
3300014321\|Ga0075353_1061063	Not Available	807	Open in IMG/M
3300014879\|Ga0180062_1055131	Not Available	859	Open in IMG/M
3300014880\|Ga0180082_1134093	Not Available	571	Open in IMG/M
3300018071\|Ga0184618_10240508	Not Available	764	Open in IMG/M
3300018083\|Ga0184628_10272938	Not Available	888	Open in IMG/M
3300019362\|Ga0173479_10298533	Not Available	733	Open in IMG/M
3300021322\|Ga0210330_1131167	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300021432\|Ga0210384_10638510	Not Available	955	Open in IMG/M
3300021445\|Ga0182009_10136002	All Organisms → cellular organisms → Bacteria	1156	Open in IMG/M
3300025555\|Ga0210121_1053308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	682	Open in IMG/M
3300025893\|Ga0207682_10531077	Not Available	557	Open in IMG/M
3300025907\|Ga0207645_10429823	Not Available	890	Open in IMG/M
3300025917\|Ga0207660_11590611	Not Available	527	Open in IMG/M
3300025923\|Ga0207681_10449522	Not Available	1048	Open in IMG/M
3300025926\|Ga0207659_10832151	Not Available	793	Open in IMG/M
3300025931\|Ga0207644_10274384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1352	Open in IMG/M
3300025938\|Ga0207704_10628131	All Organisms → cellular organisms → Bacteria	882	Open in IMG/M
3300025945\|Ga0207679_10131955	Not Available	2005	Open in IMG/M
3300025960\|Ga0207651_11618935	Not Available	583	Open in IMG/M
3300025961\|Ga0207712_11929115	Not Available	529	Open in IMG/M
3300025972\|Ga0207668_11215053	Not Available	677	Open in IMG/M
3300025981\|Ga0207640_11550652	Not Available	596	Open in IMG/M
3300026023\|Ga0207677_10048295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2865	Open in IMG/M
3300026023\|Ga0207677_10058293	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum tolulyticum	2658	Open in IMG/M
3300026078\|Ga0207702_11485961	Not Available	671	Open in IMG/M
3300026121\|Ga0207683_10872312	Not Available	835	Open in IMG/M
3300026142\|Ga0207698_11000685	Not Available	847	Open in IMG/M
3300026142\|Ga0207698_12128409	Not Available	574	Open in IMG/M
3300027843\|Ga0209798_10232666	All Organisms → cellular organisms → Bacteria → Acidobacteria	900	Open in IMG/M
3300027885\|Ga0209450_10617560	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	791	Open in IMG/M
3300027909\|Ga0209382_11519741	Not Available	666	Open in IMG/M
3300028380\|Ga0268265_11847112	Not Available	611	Open in IMG/M
3300028802\|Ga0307503_10251635	Not Available	864	Open in IMG/M
3300028889\|Ga0247827_10614340	Not Available	697	Open in IMG/M
3300029980\|Ga0302298_10291111	Not Available	543	Open in IMG/M
3300030002\|Ga0311350_10820863	Not Available	833	Open in IMG/M
3300030010\|Ga0302299_10169128	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Raphidophyceae → Chattonellales → Chattonellaceae → Heterosigma → Heterosigma akashiwo	1177	Open in IMG/M
3300030943\|Ga0311366_10516275	Not Available	1040	Open in IMG/M
3300031712\|Ga0265342_10125783	All Organisms → cellular organisms → Bacteria	1440	Open in IMG/M
3300031713\|Ga0318496_10696967	Not Available	560	Open in IMG/M
3300031720\|Ga0307469_10183031	Not Available	1614	Open in IMG/M
3300031720\|Ga0307469_12370206	Not Available	518	Open in IMG/M
3300031722\|Ga0311351_11383436	Not Available	541	Open in IMG/M
3300031772\|Ga0315288_11179223	Not Available	662	Open in IMG/M
3300031781\|Ga0318547_10860617	Not Available	565	Open in IMG/M
3300031943\|Ga0310885_10630270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	597	Open in IMG/M
3300031996\|Ga0308176_10715838	Not Available	1039	Open in IMG/M
3300031999\|Ga0315274_10417082	Not Available	1550	Open in IMG/M
3300032122\|Ga0310895_10669324	Not Available	538	Open in IMG/M
3300032164\|Ga0315283_10121858	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2756	Open in IMG/M
3300032174\|Ga0307470_10971891	Not Available	673	Open in IMG/M
3300032179\|Ga0310889_10679842	Not Available	536	Open in IMG/M
3300032256\|Ga0315271_11374849	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	609	Open in IMG/M
3300032516\|Ga0315273_10042954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	6085	Open in IMG/M
3300032516\|Ga0315273_11411630	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	862	Open in IMG/M
3300032954\|Ga0335083_10484458	Not Available	1039	Open in IMG/M
3300033004\|Ga0335084_11096744	Not Available	799	Open in IMG/M
3300033004\|Ga0335084_12343342	Not Available	515	Open in IMG/M
3300033408\|Ga0316605_10747700	Not Available	926	Open in IMG/M
3300033419\|Ga0316601_100085324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	2497	Open in IMG/M
3300033482\|Ga0316627_100292215	All Organisms → cellular organisms → Bacteria	1332	Open in IMG/M
3300034149\|Ga0364929_0032644	Not Available	1545	Open in IMG/M
3300034169\|Ga0370480_0129162	Not Available	868	Open in IMG/M
3300034417\|Ga0364941_131013	Not Available	622	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	54.62%
Host-Associated	Host-Associated	45.38%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	45.38%
Terrestrial	Environmental → Terrestrial	40.34%
Aquatic	Environmental → Aquatic	14.29%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	34.45%
Rhizosphere	Host-Associated → Plants → Rhizosphere	32.77%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.61%
Freshwater	Environmental → Aquatic → Freshwater	7.56%
Sediment	Environmental → Aquatic → Sediment	4.20%
Peat	Environmental → Terrestrial → Peat	4.20%
Marine	Environmental → Aquatic → Marine	2.52%
Floodplain	Environmental → Terrestrial → Floodplain	1.68%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	19.33%
Soil	Host-Associated → Plants → Rhizosphere → Soil	18.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.29%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.76%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	7.56%
Loam	Environmental → Terrestrial → Soil → Loam	7.56%
Lake	Environmental → Aquatic → Freshwater → Lake	5.04%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.20%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.20%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.68%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.68%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	1.68%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.84%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.84%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.84%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	18.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.76%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	8.40%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	7.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.56%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	5.04%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.04%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.20%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.20%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.20%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	1.68%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.68%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	1.68%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.84%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.84%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.84%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.84%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.84%

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	9.24%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	6.72%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.72%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	5.04%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	5.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.20%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	4.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	4.20%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.20%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.36%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.36%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.36%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.36%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.52%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.52%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.52%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.52%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.68%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.68%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.68%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.68%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.68%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	1.68%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.68%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.84%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment	0.84%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.84%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.84%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.84%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.84%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.84%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.84%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.84%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.84%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.84%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.84%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.84%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300003991	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005481	Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methylamine enrichment	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300006606	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300010364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011423	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012511	Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014318	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd	Environmental	Open in IMG/M
3300014321	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1	Environmental	Open in IMG/M
3300014879	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D	Environmental	Open in IMG/M
3300014880	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300021322	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.298 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300025555	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 (SPAdes)	Environmental	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027843	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)	Environmental	Open in IMG/M
3300027885	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300028889	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2	Environmental	Open in IMG/M
3300029980	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3	Environmental	Open in IMG/M
3300030002	II_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030010	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4	Environmental	Open in IMG/M
3300030943	III_Fen_N2 coassembly	Environmental	Open in IMG/M
3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Host-Associated	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031722	II_Fen_N3 coassembly	Environmental	Open in IMG/M
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental	Open in IMG/M
3300031781	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20	Environmental	Open in IMG/M
3300031943	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032179	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2	Environmental	Open in IMG/M
3300032256	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M
3300034169	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15	Environmental	Open in IMG/M
3300034417	Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0055461_100217442	3300003991	Natural And Restored Wetlands	VDDNRRALDDTALTAIRQQVQRTAAALKEIRVEPGSPRALALFGG*
Ga0063356_1014910981	3300004463	Arabidopsis Thaliana Rhizosphere	PLDDAAFATIREQVSDAADALRAVHIEPGSPRALALFSA*
Ga0062595_1025325691	3300004479	Soil	PLDDAAFAVIREQVDAAADALRAVHIEPGSARALALFSA*
Ga0070690_1012120881	3300005330	Switchgrass Rhizosphere	ALVDDNRRVLDDAAFSAIREQVRQTATALREVHIEPGSPRALALFGG*
Ga0070677_104315452	3300005333	Miscanthus Rhizosphere	RPLDDAAFAAIREQVRGTTAALREVNIEPGSPRALALFGG*
Ga0068869_1000329694	3300005334	Miscanthus Rhizosphere	NRRPLDDAALAAIRQQVQLAADALKACRIDPGSPRAQALFGA*
Ga0070660_1014161702	3300005339	Corn Rhizosphere	TLGGELVDDNHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA*
Ga0070691_101250692	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	NHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA*
Ga0070691_103478731	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	KTLGAELVDDNHRPLDDAAFTVIREQVDGAVEALRAVHIEPGSARALALFSA*
Ga0070687_1005482172	3300005343	Switchgrass Rhizosphere	LVDDNRRPLDDAALAAIRQQVQLAADALKACRIDPGSPRAQALFGA*
Ga0070668_1001271852	3300005347	Switchgrass Rhizosphere	RRPLDDAAFAAIRDQVRSTAEALREVNIEPGSPRALALFGG*
Ga0070669_1004726161	3300005353	Switchgrass Rhizosphere	RALDDAALASIKKQVEAAAEALRESGIEPGSPRALALFGA*
Ga0070669_1006126291	3300005353	Switchgrass Rhizosphere	RRPLDDAAFAAIREQVRVTMEALREANIEPGSPRALALFGG*
Ga0070673_1020892482	3300005364	Switchgrass Rhizosphere	MAKTLGAELVDDNHRPLDDAAFTVIREQVDGAVEALRVVHIEPGSARALALFSA*
Ga0070711_1003175732	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	AELVDDKRRPLDDAALVRIREQVEAAADALRTVHIEPGSARAMALFSA*
Ga0070663_1010601441	3300005455	Corn Rhizosphere	AKTLGAELVDDNHRPLDDAAFTVIREQVDGAVEALRAVHIEPGSARALALFSA*
Ga0070663_1015139601	3300005455	Corn Rhizosphere	DNRRPLDDPALAKIRAQVQSAADELAAVHIEPGSPRALALFGA*
Ga0070681_117112041	3300005458	Corn Rhizosphere	VDDNHRPLDDAAFAAIREQVEGAADALRAVHIEPGSARALALFSA*
Ga0074210_1148032	3300005481	Sediment	AALPAIRQQVEATAGALRDARLDPGSPRALALFSG*
Ga0070679_1003409931	3300005530	Corn Rhizosphere	ADLVDDNRRPLDDAALAKIRAQVQVAADALVHAHIEPGSARAQALFGA*
Ga0068853_1005973291	3300005539	Corn Rhizosphere	RPLDDEALGTIREQVQAAAEALRAVHIPPGSPRALALFSA*
Ga0068853_1014985952	3300005539	Corn Rhizosphere	ELVDDNHRPLDDAAFAVIREQVDAAADALRAVHIEPGSARALALFSA*
Ga0070672_1018299111	3300005543	Miscanthus Rhizosphere	PLDDAALASIRKQVDGAAEALRESGIEPGSPRALALFGA*
Ga0070696_1009777022	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	GELVDDNHRALDDAAFAAIREQVAAAAEALRAVHIEPGSARALALFSA*
Ga0070665_1010308081	3300005548	Switchgrass Rhizosphere	AAFAAIREQVRSTTAALREVNIEPGSPRALALFGG*
Ga0070665_1010958921	3300005548	Switchgrass Rhizosphere	PLDDAALAKIRGQVEAAATALRNGYIEPGSARALALFGA*
Ga0070665_1013506292	3300005548	Switchgrass Rhizosphere	VDDNRRVLDDAALAAIRDQVRTTAAAMREVNIEPGSARALALFGG*
Ga0066695_105024761	3300005553	Soil	VDDNRRVLDDAALTGIRAQVEAAALALKNVHIEPGSARALALFGA*
Ga0070664_1019726081	3300005564	Corn Rhizosphere	TLGAELVDDNHRPLDDAAFTVIREQVDGAAEALRAVHIEPGSARALALFSA*
Ga0068852_1025699301	3300005616	Corn Rhizosphere	RPLDDAALAAIRQQVQLAADALKACRIDPGSPRAQALFGA*
Ga0068851_104624122	3300005834	Corn Rhizosphere	DDAALASIRKQVEGAAEALRESGIEPGSPRALALFGA*
Ga0074062_120354201	3300006606	Soil	DDNRRPLDDAALAAIRQQVQAAADALKACHIDPGSPRAQALFGA*
Ga0075428_1022148752	3300006844	Populus Rhizosphere	DDNHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA*
Ga0075433_113000912	3300006852	Populus Rhizosphere	LDDAALASIRAQVEAAAEALRAVHIDPGSPRALALFSA*
Ga0075425_1004327141	3300006854	Populus Rhizosphere	AALAGIRGQVEAAAVALKRVHIEPGSARALALFGA*
Ga0075434_1025609231	3300006871	Populus Rhizosphere	AALTGIRAQVEAAALALKRVHIEPGSPRAQALFGA*
Ga0075436_1009353631	3300006914	Populus Rhizosphere	ALAAIRKQVDAAAEALRESGIEPGSPRALALFGA*
Ga0075435_1003758921	3300007076	Populus Rhizosphere	DAALAGIRGQVEAAAVALKRVHIEPGSARALALFGA*
Ga0105247_115409372	3300009101	Switchgrass Rhizosphere	GGELVDDNHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA*
Ga0105247_116858672	3300009101	Switchgrass Rhizosphere	ALAAIRAQVDAAAAALKRGYIDPGSPRALALFGA*
Ga0111538_125918161	3300009156	Populus Rhizosphere	EPALAAIRKQVDAAAAALREVGIEPGSPRALALFGA*
Ga0105241_122393462	3300009174	Corn Rhizosphere	ALATIREQVGDAAEALRAVHIEPGSPRALALFSA*
Ga0105248_126410852	3300009177	Switchgrass Rhizosphere	DAAFSAIREQVRQTATALREVHIEPGSPRALALFGG*
Ga0134066_104495712	3300010364	Grasslands Soil	GGDLVDDNRRVLDDAALGTIRQQVEAAADALKACNIDPGSPRARALFGA*
Ga0134127_109554012	3300010399	Terrestrial Soil	DDAALATIREQVQAAADALRAVHIEPGSSRALALFSA*
Ga0134121_122874931	3300010401	Terrestrial Soil	GELVDDNGRPLDDAALAKIRAQVDAAAAALRNGYIEPGSARALALFGA*
Ga0137436_12142602	3300011423	Soil	VLVDDNRRALDDAAFAAIREQVRDTAAALREVHIEPGSPRALALFGG*
Ga0137382_104027342	3300012200	Vadose Zone Soil	LNAELVDDNRRALDDTALTGIRAQVEAAALALKHVHIEPGSARALALFGA*
Ga0157332_10655672	3300012511	Soil	LGGELVDDNHRPLDDAAFAVIREQVDGAADALRGVHIEPGSARALALFSA*
Ga0164299_107917421	3300012958	Soil	HRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA*
Ga0157373_112958061	3300013100	Corn Rhizosphere	PLDDAALASIRAQVEAAAEALRAVHIDPGSPRALALFSA*
Ga0157374_104151231	3300013296	Miscanthus Rhizosphere	SLDDAAMGAIREQVEASALALKRAHIEPGSARALALFGA*
Ga0157378_132620311	3300013297	Miscanthus Rhizosphere	DDNRRPLDDAALNAIRNQVRATSTALTEVRIDPGSARALALFGG*
Ga0157372_133333821	3300013307	Corn Rhizosphere	ELVDDNRRPLDDAALATIREQVETAADALRAVHIEPGSQRALALFTA*
Ga0075351_12049482	3300014318	Natural And Restored Wetlands	PLDDAALSAIRDQVRATATALREVHIEPGSPRALALFGS*
Ga0075353_10610631	3300014321	Natural And Restored Wetlands	DDNRRELDDGALNAISEQVRTTVAAMREVHIDPGSPRALALFGG*
Ga0180062_10551313	3300014879	Soil	LDDAALAAIRQQVQATAAALKAIRIDPGSPRALALFSG*
Ga0180082_11340932	3300014880	Soil	LDAALVDDNRRVLDDAAFSAIREQVRQTATALREVHIEPGSPRALALFGG*
Ga0184618_102405081	3300018071	Groundwater Sediment	VDDNRRPLDDAALTAIRGQVEAAVIALKHVHIEPGSARALALFGA
Ga0184628_102729381	3300018083	Groundwater Sediment	DNALAAIRQQVEVTARALKEARLDPGSPRALALFSG
Ga0173479_102985332	3300019362	Soil	LVDDNRRPLDDPALAKIRAQVQSAADELAAVHIEPGSPRALALFGA
Ga0210330_11311672	3300021322	Estuarine	VDDNRRALDDAALNAIRDQVRSTAAALREVHIEPGSPRAQALFGG
Ga0210384_106385102	3300021432	Soil	NRRPLDDAALNAIREQVRSTAAALREVHIEPGSPRSLALFGG
Ga0182009_101360021	3300021445	Soil	RPLDDQGLAAIRVQVQKTADALKAVHIDPGSPRALALFGG
Ga0210121_10533081	3300025555	Natural And Restored Wetlands	VDDNRRALDDTALTAIRQQVQRTAAALKEIRVEPGSPRALALFGG
Ga0207682_105310771	3300025893	Miscanthus Rhizosphere	LDDAAFSAIREQVRQTATALREVHIEPGSPRALALFGG
Ga0207645_104298231	3300025907	Miscanthus Rhizosphere	NRRPLDDAALNAIREQVRNTATALREVRIEPGSARALALFGG
Ga0207660_115906112	3300025917	Corn Rhizosphere	DNRRALDDAALATIRDQVQAAADALRAVHIQPGSPRALALFSA
Ga0207681_104495222	3300025923	Switchgrass Rhizosphere	DNQRALDDAALASIKKQVEAAAEALRESGIEPGSPRALALFGA
Ga0207659_108321511	3300025926	Miscanthus Rhizosphere	LDDAALASIRKQVEAAAEALRESGIEPGSPRALALFGA
Ga0207644_102743841	3300025931	Switchgrass Rhizosphere	DAALVDDNRRVLDDAAFSAIREQVRQTATALREVHIEPGSPRALALFGG
Ga0207704_106281312	3300025938	Miscanthus Rhizosphere	DAALAKIRGQVDAAAAALRNGYIEPGSARALALFGA
Ga0207679_101319551	3300025945	Corn Rhizosphere	MSKTLGGELVDDNHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA
Ga0207651_116189351	3300025960	Switchgrass Rhizosphere	NRRVLDDAAFSAIREQVRQTATALREVHIEPGSPRALALFGG
Ga0207712_119291152	3300025961	Switchgrass Rhizosphere	HRPLDDAALATIREQVTDAADALRGVHIEPGSTRALALFSA
Ga0207668_112150531	3300025972	Switchgrass Rhizosphere	DDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA
Ga0207640_115506521	3300025981	Corn Rhizosphere	TLGAELVDDNRRVLDDAAFASIRGQVEEAADALRAVHIEPGSARALALFTA
Ga0207677_100482951	3300026023	Miscanthus Rhizosphere	VDDNGRPLDDAALAKIRAQVDAAAAALRNGYIEPGSARALALFGA
Ga0207677_100582931	3300026023	Miscanthus Rhizosphere	DNHRPLDDAAFTVIREQVDGAVEALRAVHIEPGSARALALFSA
Ga0207702_114859611	3300026078	Corn Rhizosphere	DAAFAVIREQVDAAADALRAVHIEPGSARALALFSA
Ga0207683_108723121	3300026121	Miscanthus Rhizosphere	AALNTIREQIRVTADAMREVNIEPGSPRALALFGG
Ga0207698_110006851	3300026142	Corn Rhizosphere	RPLDEPALAAIRKQVDAAAAALREVGIEPGSPRALALFGA
Ga0207698_121284092	3300026142	Corn Rhizosphere	RRPLDDAALAAIRQQVQLAADALKACRIDPGSPRAQALFGA
Ga0209798_102326662	3300027843	Wetland Sediment	NRRALDDAALNAIREQVRSTTAALHEVHIEPGSPRALALFGG
Ga0209450_106175601	3300027885	Freshwater Lake Sediment	RRALDDAALAAIRQQVQATAAALASVRIDPGSARAQALFGG
Ga0209382_115197411	3300027909	Populus Rhizosphere	PLDDAALAKIRTQVEAAAGALKSGYIEPGSARALALFGA
Ga0268265_118471121	3300028380	Switchgrass Rhizosphere	DNRRPLTDASLAAIRQQVETTASALRESRLDPGSPRAMALFGG
Ga0307503_102516352	3300028802	Soil	LDDAALVAIRTQIQGTVDALRKTNIEPGSPRAMALFGG
Ga0247827_106143401	3300028889	Soil	PLDDAAFTTIREQVGDAAEALRAVHIEPGSPRALALFSA
Ga0302298_102911111	3300029980	Fen	DLVDDNRRSLDDAALAAIRQQVQIAADALRACRIDPGSPRAQALFGA
Ga0311350_108208631	3300030002	Fen	DGDLVDDNRRLLDDAALASIRQQVQIAADALKACRIDPGSPRAQALFGA
Ga0302299_101691282	3300030010	Fen	LDDTALAAIRDQVKATAAALRQVNIEPGSPRALALFGG
Ga0311366_105162751	3300030943	Fen	RPLDDAALAVTRQQVQRAGDALRECGIEPGTPRALALFGA
Ga0265342_101257832	3300031712	Rhizosphere	DDAALAAIRQQVDAAGTALRDVHIEPGSARALALFGG
Ga0318496_106969672	3300031713	Soil	DNQRALDDVALAKIRTQVEAAAGALRNGYIEPGSARALALFGS
Ga0307469_101830312	3300031720	Hardwood Forest Soil	AALNAIREQVRSTAAALREVHIEPGSPRSLALFGG
Ga0307469_123702062	3300031720	Hardwood Forest Soil	ELVDDNHRPLDDAALAKIRTQVETAAGALKRGYIEPGSARALALFGA
Ga0311351_113834362	3300031722	Fen	PLDDAALASIRRQVQLAADALQTCRIDPGSPRAQALFGA
Ga0315288_111792232	3300031772	Sediment	DNRRTLDDAALNAIREQVRKTAAALREVHIEPGSPRALALFGG
Ga0318547_108606172	3300031781	Soil	LDDAALAKIRAQVVAAAQALSEVHIEPGSPRALALFGA
Ga0310885_106302701	3300031943	Soil	TLGGELVDDNHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA
Ga0308176_107158382	3300031996	Soil	AAFGVIREQVDGAAEALRAVHIEPGSARALALFSA
Ga0315274_104170822	3300031999	Sediment	ALDDAALNAIREQVRTTAAALREVHIEPGSPRAQALFGG
Ga0310895_106693242	3300032122	Soil	NRRPLDDAALNTIREQVRSTAAALREVRIEPGSARALALFGG
Ga0315283_101218581	3300032164	Sediment	AALNAIREQVRNTASALREVHIEPGSPRALALFGG
Ga0307470_109718912	3300032174	Hardwood Forest Soil	LDDAALNAIREQVRSTAAALREVHIEPGSPRSLARFGG
Ga0310889_106798422	3300032179	Soil	NHRPLDDAAFTTIREQVGDAAEALRAVHIEPGSPRALALFSA
Ga0315271_113748492	3300032256	Sediment	NRRALDDAALNAIREQVRATAAALREVHIEPGSPRAQALFGG
Ga0315273_100429541	3300032516	Sediment	TLDDAALNAIREQVRKTAAALREVHIDPGSPRALALFGG
Ga0315273_114116301	3300032516	Sediment	LDATLVDDNRRELDDGALDAIREQVRTTAAAMREVHIEPGSPRALALFGG
Ga0335083_104844581	3300032954	Soil	DDAALNAIRDQVRSTAAALAEVRIEPGSARALALFGG
Ga0335084_110967441	3300033004	Soil	DDAALNAIRDQVKTTAAALREAHIEAGSARALALFGA
Ga0335084_123433422	3300033004	Soil	QALDALLVDDNRRPLDEAALNAIRDQVRSTAAALAEVRIEPGSARALALFGG
Ga0316605_107477002	3300033408	Soil	AQTLDAVLVDDNRRALDDAALAAIRQQVQATAAALASVRIDPGSARAQALFGG
Ga0316601_1000853243	3300033419	Soil	NRRPLDDAALAAIRQQVQAAVAALRDVNIEPGSPRALALFGG
Ga0316627_1002922151	3300033482	Soil	RRPLDDASLAAIRKQVDAATAALRECGIEPGSPRALALFGA
Ga0364929_0032644_1411_1545	3300034149	Sediment	DDNRRPLDDAALAAIRQQVQMAADALKACRIDPGSPRAQALFGA
Ga0370480_0129162_3_110	3300034169	Untreated Peat Soil	PALAAIRKQVDAAATALTESGIEPGSPRALALFGA
Ga0364941_131013_484_621	3300034417	Sediment	VDDNRRPLDDAALAAIRQQVQMAADALKACRIDPGSPRAQALFGA

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.64
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.64
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F074834

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign