| Basic Information | |
|---|---|
| Family ID | F074834 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PLDDAAFAVIREQVDAAADALRAVHIEPGSARALALFSA |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.28 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.303 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (9.244 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.580 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.622 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF01653 | DNA_ligase_aden | 81.51 |
| PF03120 | DNA_ligase_OB | 10.08 |
| PF14520 | HHH_5 | 3.36 |
| PF00483 | NTP_transferase | 2.52 |
| PF01497 | Peripla_BP_2 | 0.84 |
| PF03480 | DctP | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 91.60 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.84 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.84 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.84 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.84 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.30 % |
| All Organisms | root | All Organisms | 43.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003991|Ga0055461_10021744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1359 | Open in IMG/M |
| 3300004463|Ga0063356_101491098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1001 | Open in IMG/M |
| 3300004479|Ga0062595_102532569 | Not Available | 512 | Open in IMG/M |
| 3300005330|Ga0070690_101212088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 602 | Open in IMG/M |
| 3300005333|Ga0070677_10431545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 701 | Open in IMG/M |
| 3300005334|Ga0068869_100032969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3654 | Open in IMG/M |
| 3300005339|Ga0070660_101416170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 590 | Open in IMG/M |
| 3300005341|Ga0070691_10125069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1298 | Open in IMG/M |
| 3300005341|Ga0070691_10347873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 822 | Open in IMG/M |
| 3300005343|Ga0070687_100548217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 786 | Open in IMG/M |
| 3300005347|Ga0070668_100127185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2042 | Open in IMG/M |
| 3300005353|Ga0070669_100472616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1036 | Open in IMG/M |
| 3300005353|Ga0070669_100612629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 913 | Open in IMG/M |
| 3300005364|Ga0070673_102089248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 538 | Open in IMG/M |
| 3300005439|Ga0070711_100317573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1243 | Open in IMG/M |
| 3300005455|Ga0070663_101060144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 707 | Open in IMG/M |
| 3300005455|Ga0070663_101513960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 596 | Open in IMG/M |
| 3300005458|Ga0070681_11711204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 555 | Open in IMG/M |
| 3300005481|Ga0074210_114803 | Not Available | 811 | Open in IMG/M |
| 3300005530|Ga0070679_100340993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1447 | Open in IMG/M |
| 3300005539|Ga0068853_100597329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1048 | Open in IMG/M |
| 3300005539|Ga0068853_101498595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 653 | Open in IMG/M |
| 3300005543|Ga0070672_101829911 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005546|Ga0070696_100977702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 706 | Open in IMG/M |
| 3300005548|Ga0070665_101030808 | Not Available | 835 | Open in IMG/M |
| 3300005548|Ga0070665_101095892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 808 | Open in IMG/M |
| 3300005548|Ga0070665_101350629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300005553|Ga0066695_10502476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
| 3300005564|Ga0070664_101972608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 554 | Open in IMG/M |
| 3300005616|Ga0068852_102569930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 529 | Open in IMG/M |
| 3300005834|Ga0068851_10462412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 755 | Open in IMG/M |
| 3300006606|Ga0074062_12035420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 544 | Open in IMG/M |
| 3300006844|Ga0075428_102214875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 567 | Open in IMG/M |
| 3300006852|Ga0075433_11300091 | Not Available | 630 | Open in IMG/M |
| 3300006854|Ga0075425_100432714 | Not Available | 1515 | Open in IMG/M |
| 3300006871|Ga0075434_102560923 | Not Available | 511 | Open in IMG/M |
| 3300006914|Ga0075436_100935363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 649 | Open in IMG/M |
| 3300007076|Ga0075435_100375892 | Not Available | 1220 | Open in IMG/M |
| 3300009101|Ga0105247_11540937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 543 | Open in IMG/M |
| 3300009101|Ga0105247_11685867 | Not Available | 523 | Open in IMG/M |
| 3300009156|Ga0111538_12591816 | Not Available | 636 | Open in IMG/M |
| 3300009174|Ga0105241_12239346 | Not Available | 543 | Open in IMG/M |
| 3300009177|Ga0105248_12641085 | Not Available | 573 | Open in IMG/M |
| 3300010364|Ga0134066_10449571 | Not Available | 503 | Open in IMG/M |
| 3300010399|Ga0134127_10955401 | Not Available | 915 | Open in IMG/M |
| 3300010401|Ga0134121_12287493 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Raphidophyceae → Chattonellales → Chattonellaceae → Heterosigma → Heterosigma akashiwo | 579 | Open in IMG/M |
| 3300011423|Ga0137436_1214260 | Not Available | 505 | Open in IMG/M |
| 3300012200|Ga0137382_10402734 | Not Available | 964 | Open in IMG/M |
| 3300012511|Ga0157332_1065567 | Not Available | 555 | Open in IMG/M |
| 3300012958|Ga0164299_10791742 | Not Available | 675 | Open in IMG/M |
| 3300013100|Ga0157373_11295806 | Not Available | 551 | Open in IMG/M |
| 3300013296|Ga0157374_10415123 | Not Available | 1344 | Open in IMG/M |
| 3300013297|Ga0157378_13262031 | Not Available | 504 | Open in IMG/M |
| 3300013307|Ga0157372_13333382 | Not Available | 511 | Open in IMG/M |
| 3300014318|Ga0075351_1204948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 504 | Open in IMG/M |
| 3300014321|Ga0075353_1061063 | Not Available | 807 | Open in IMG/M |
| 3300014879|Ga0180062_1055131 | Not Available | 859 | Open in IMG/M |
| 3300014880|Ga0180082_1134093 | Not Available | 571 | Open in IMG/M |
| 3300018071|Ga0184618_10240508 | Not Available | 764 | Open in IMG/M |
| 3300018083|Ga0184628_10272938 | Not Available | 888 | Open in IMG/M |
| 3300019362|Ga0173479_10298533 | Not Available | 733 | Open in IMG/M |
| 3300021322|Ga0210330_1131167 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300021432|Ga0210384_10638510 | Not Available | 955 | Open in IMG/M |
| 3300021445|Ga0182009_10136002 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300025555|Ga0210121_1053308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 682 | Open in IMG/M |
| 3300025893|Ga0207682_10531077 | Not Available | 557 | Open in IMG/M |
| 3300025907|Ga0207645_10429823 | Not Available | 890 | Open in IMG/M |
| 3300025917|Ga0207660_11590611 | Not Available | 527 | Open in IMG/M |
| 3300025923|Ga0207681_10449522 | Not Available | 1048 | Open in IMG/M |
| 3300025926|Ga0207659_10832151 | Not Available | 793 | Open in IMG/M |
| 3300025931|Ga0207644_10274384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1352 | Open in IMG/M |
| 3300025938|Ga0207704_10628131 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300025945|Ga0207679_10131955 | Not Available | 2005 | Open in IMG/M |
| 3300025960|Ga0207651_11618935 | Not Available | 583 | Open in IMG/M |
| 3300025961|Ga0207712_11929115 | Not Available | 529 | Open in IMG/M |
| 3300025972|Ga0207668_11215053 | Not Available | 677 | Open in IMG/M |
| 3300025981|Ga0207640_11550652 | Not Available | 596 | Open in IMG/M |
| 3300026023|Ga0207677_10048295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2865 | Open in IMG/M |
| 3300026023|Ga0207677_10058293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → Aromatoleum tolulyticum | 2658 | Open in IMG/M |
| 3300026078|Ga0207702_11485961 | Not Available | 671 | Open in IMG/M |
| 3300026121|Ga0207683_10872312 | Not Available | 835 | Open in IMG/M |
| 3300026142|Ga0207698_11000685 | Not Available | 847 | Open in IMG/M |
| 3300026142|Ga0207698_12128409 | Not Available | 574 | Open in IMG/M |
| 3300027843|Ga0209798_10232666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
| 3300027885|Ga0209450_10617560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 791 | Open in IMG/M |
| 3300027909|Ga0209382_11519741 | Not Available | 666 | Open in IMG/M |
| 3300028380|Ga0268265_11847112 | Not Available | 611 | Open in IMG/M |
| 3300028802|Ga0307503_10251635 | Not Available | 864 | Open in IMG/M |
| 3300028889|Ga0247827_10614340 | Not Available | 697 | Open in IMG/M |
| 3300029980|Ga0302298_10291111 | Not Available | 543 | Open in IMG/M |
| 3300030002|Ga0311350_10820863 | Not Available | 833 | Open in IMG/M |
| 3300030010|Ga0302299_10169128 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Raphidophyceae → Chattonellales → Chattonellaceae → Heterosigma → Heterosigma akashiwo | 1177 | Open in IMG/M |
| 3300030943|Ga0311366_10516275 | Not Available | 1040 | Open in IMG/M |
| 3300031712|Ga0265342_10125783 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300031713|Ga0318496_10696967 | Not Available | 560 | Open in IMG/M |
| 3300031720|Ga0307469_10183031 | Not Available | 1614 | Open in IMG/M |
| 3300031720|Ga0307469_12370206 | Not Available | 518 | Open in IMG/M |
| 3300031722|Ga0311351_11383436 | Not Available | 541 | Open in IMG/M |
| 3300031772|Ga0315288_11179223 | Not Available | 662 | Open in IMG/M |
| 3300031781|Ga0318547_10860617 | Not Available | 565 | Open in IMG/M |
| 3300031943|Ga0310885_10630270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 597 | Open in IMG/M |
| 3300031996|Ga0308176_10715838 | Not Available | 1039 | Open in IMG/M |
| 3300031999|Ga0315274_10417082 | Not Available | 1550 | Open in IMG/M |
| 3300032122|Ga0310895_10669324 | Not Available | 538 | Open in IMG/M |
| 3300032164|Ga0315283_10121858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2756 | Open in IMG/M |
| 3300032174|Ga0307470_10971891 | Not Available | 673 | Open in IMG/M |
| 3300032179|Ga0310889_10679842 | Not Available | 536 | Open in IMG/M |
| 3300032256|Ga0315271_11374849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 609 | Open in IMG/M |
| 3300032516|Ga0315273_10042954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6085 | Open in IMG/M |
| 3300032516|Ga0315273_11411630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 862 | Open in IMG/M |
| 3300032954|Ga0335083_10484458 | Not Available | 1039 | Open in IMG/M |
| 3300033004|Ga0335084_11096744 | Not Available | 799 | Open in IMG/M |
| 3300033004|Ga0335084_12343342 | Not Available | 515 | Open in IMG/M |
| 3300033408|Ga0316605_10747700 | Not Available | 926 | Open in IMG/M |
| 3300033419|Ga0316601_100085324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 2497 | Open in IMG/M |
| 3300033482|Ga0316627_100292215 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300034149|Ga0364929_0032644 | Not Available | 1545 | Open in IMG/M |
| 3300034169|Ga0370480_0129162 | Not Available | 868 | Open in IMG/M |
| 3300034417|Ga0364941_131013 | Not Available | 622 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 9.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.72% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.20% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.20% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.36% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.36% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.52% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.68% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.68% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.84% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.84% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.84% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.84% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005481 | Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methylamine enrichment | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021322 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.298 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025555 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055461_100217442 | 3300003991 | Natural And Restored Wetlands | VDDNRRALDDTALTAIRQQVQRTAAALKEIRVEPGSPRALALFGG* |
| Ga0063356_1014910981 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PLDDAAFATIREQVSDAADALRAVHIEPGSPRALALFSA* |
| Ga0062595_1025325691 | 3300004479 | Soil | PLDDAAFAVIREQVDAAADALRAVHIEPGSARALALFSA* |
| Ga0070690_1012120881 | 3300005330 | Switchgrass Rhizosphere | ALVDDNRRVLDDAAFSAIREQVRQTATALREVHIEPGSPRALALFGG* |
| Ga0070677_104315452 | 3300005333 | Miscanthus Rhizosphere | RPLDDAAFAAIREQVRGTTAALREVNIEPGSPRALALFGG* |
| Ga0068869_1000329694 | 3300005334 | Miscanthus Rhizosphere | NRRPLDDAALAAIRQQVQLAADALKACRIDPGSPRAQALFGA* |
| Ga0070660_1014161702 | 3300005339 | Corn Rhizosphere | TLGGELVDDNHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA* |
| Ga0070691_101250692 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | NHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA* |
| Ga0070691_103478731 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | KTLGAELVDDNHRPLDDAAFTVIREQVDGAVEALRAVHIEPGSARALALFSA* |
| Ga0070687_1005482172 | 3300005343 | Switchgrass Rhizosphere | LVDDNRRPLDDAALAAIRQQVQLAADALKACRIDPGSPRAQALFGA* |
| Ga0070668_1001271852 | 3300005347 | Switchgrass Rhizosphere | RRPLDDAAFAAIRDQVRSTAEALREVNIEPGSPRALALFGG* |
| Ga0070669_1004726161 | 3300005353 | Switchgrass Rhizosphere | RALDDAALASIKKQVEAAAEALRESGIEPGSPRALALFGA* |
| Ga0070669_1006126291 | 3300005353 | Switchgrass Rhizosphere | RRPLDDAAFAAIREQVRVTMEALREANIEPGSPRALALFGG* |
| Ga0070673_1020892482 | 3300005364 | Switchgrass Rhizosphere | MAKTLGAELVDDNHRPLDDAAFTVIREQVDGAVEALRVVHIEPGSARALALFSA* |
| Ga0070711_1003175732 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | AELVDDKRRPLDDAALVRIREQVEAAADALRTVHIEPGSARAMALFSA* |
| Ga0070663_1010601441 | 3300005455 | Corn Rhizosphere | AKTLGAELVDDNHRPLDDAAFTVIREQVDGAVEALRAVHIEPGSARALALFSA* |
| Ga0070663_1015139601 | 3300005455 | Corn Rhizosphere | DNRRPLDDPALAKIRAQVQSAADELAAVHIEPGSPRALALFGA* |
| Ga0070681_117112041 | 3300005458 | Corn Rhizosphere | VDDNHRPLDDAAFAAIREQVEGAADALRAVHIEPGSARALALFSA* |
| Ga0074210_1148032 | 3300005481 | Sediment | AALPAIRQQVEATAGALRDARLDPGSPRALALFSG* |
| Ga0070679_1003409931 | 3300005530 | Corn Rhizosphere | ADLVDDNRRPLDDAALAKIRAQVQVAADALVHAHIEPGSARAQALFGA* |
| Ga0068853_1005973291 | 3300005539 | Corn Rhizosphere | RPLDDEALGTIREQVQAAAEALRAVHIPPGSPRALALFSA* |
| Ga0068853_1014985952 | 3300005539 | Corn Rhizosphere | ELVDDNHRPLDDAAFAVIREQVDAAADALRAVHIEPGSARALALFSA* |
| Ga0070672_1018299111 | 3300005543 | Miscanthus Rhizosphere | PLDDAALASIRKQVDGAAEALRESGIEPGSPRALALFGA* |
| Ga0070696_1009777022 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GELVDDNHRALDDAAFAAIREQVAAAAEALRAVHIEPGSARALALFSA* |
| Ga0070665_1010308081 | 3300005548 | Switchgrass Rhizosphere | AAFAAIREQVRSTTAALREVNIEPGSPRALALFGG* |
| Ga0070665_1010958921 | 3300005548 | Switchgrass Rhizosphere | PLDDAALAKIRGQVEAAATALRNGYIEPGSARALALFGA* |
| Ga0070665_1013506292 | 3300005548 | Switchgrass Rhizosphere | VDDNRRVLDDAALAAIRDQVRTTAAAMREVNIEPGSARALALFGG* |
| Ga0066695_105024761 | 3300005553 | Soil | VDDNRRVLDDAALTGIRAQVEAAALALKNVHIEPGSARALALFGA* |
| Ga0070664_1019726081 | 3300005564 | Corn Rhizosphere | TLGAELVDDNHRPLDDAAFTVIREQVDGAAEALRAVHIEPGSARALALFSA* |
| Ga0068852_1025699301 | 3300005616 | Corn Rhizosphere | RPLDDAALAAIRQQVQLAADALKACRIDPGSPRAQALFGA* |
| Ga0068851_104624122 | 3300005834 | Corn Rhizosphere | DDAALASIRKQVEGAAEALRESGIEPGSPRALALFGA* |
| Ga0074062_120354201 | 3300006606 | Soil | DDNRRPLDDAALAAIRQQVQAAADALKACHIDPGSPRAQALFGA* |
| Ga0075428_1022148752 | 3300006844 | Populus Rhizosphere | DDNHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA* |
| Ga0075433_113000912 | 3300006852 | Populus Rhizosphere | LDDAALASIRAQVEAAAEALRAVHIDPGSPRALALFSA* |
| Ga0075425_1004327141 | 3300006854 | Populus Rhizosphere | AALAGIRGQVEAAAVALKRVHIEPGSARALALFGA* |
| Ga0075434_1025609231 | 3300006871 | Populus Rhizosphere | AALTGIRAQVEAAALALKRVHIEPGSPRAQALFGA* |
| Ga0075436_1009353631 | 3300006914 | Populus Rhizosphere | ALAAIRKQVDAAAEALRESGIEPGSPRALALFGA* |
| Ga0075435_1003758921 | 3300007076 | Populus Rhizosphere | DAALAGIRGQVEAAAVALKRVHIEPGSARALALFGA* |
| Ga0105247_115409372 | 3300009101 | Switchgrass Rhizosphere | GGELVDDNHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA* |
| Ga0105247_116858672 | 3300009101 | Switchgrass Rhizosphere | ALAAIRAQVDAAAAALKRGYIDPGSPRALALFGA* |
| Ga0111538_125918161 | 3300009156 | Populus Rhizosphere | EPALAAIRKQVDAAAAALREVGIEPGSPRALALFGA* |
| Ga0105241_122393462 | 3300009174 | Corn Rhizosphere | ALATIREQVGDAAEALRAVHIEPGSPRALALFSA* |
| Ga0105248_126410852 | 3300009177 | Switchgrass Rhizosphere | DAAFSAIREQVRQTATALREVHIEPGSPRALALFGG* |
| Ga0134066_104495712 | 3300010364 | Grasslands Soil | GGDLVDDNRRVLDDAALGTIRQQVEAAADALKACNIDPGSPRARALFGA* |
| Ga0134127_109554012 | 3300010399 | Terrestrial Soil | DDAALATIREQVQAAADALRAVHIEPGSSRALALFSA* |
| Ga0134121_122874931 | 3300010401 | Terrestrial Soil | GELVDDNGRPLDDAALAKIRAQVDAAAAALRNGYIEPGSARALALFGA* |
| Ga0137436_12142602 | 3300011423 | Soil | VLVDDNRRALDDAAFAAIREQVRDTAAALREVHIEPGSPRALALFGG* |
| Ga0137382_104027342 | 3300012200 | Vadose Zone Soil | LNAELVDDNRRALDDTALTGIRAQVEAAALALKHVHIEPGSARALALFGA* |
| Ga0157332_10655672 | 3300012511 | Soil | LGGELVDDNHRPLDDAAFAVIREQVDGAADALRGVHIEPGSARALALFSA* |
| Ga0164299_107917421 | 3300012958 | Soil | HRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA* |
| Ga0157373_112958061 | 3300013100 | Corn Rhizosphere | PLDDAALASIRAQVEAAAEALRAVHIDPGSPRALALFSA* |
| Ga0157374_104151231 | 3300013296 | Miscanthus Rhizosphere | SLDDAAMGAIREQVEASALALKRAHIEPGSARALALFGA* |
| Ga0157378_132620311 | 3300013297 | Miscanthus Rhizosphere | DDNRRPLDDAALNAIRNQVRATSTALTEVRIDPGSARALALFGG* |
| Ga0157372_133333821 | 3300013307 | Corn Rhizosphere | ELVDDNRRPLDDAALATIREQVETAADALRAVHIEPGSQRALALFTA* |
| Ga0075351_12049482 | 3300014318 | Natural And Restored Wetlands | PLDDAALSAIRDQVRATATALREVHIEPGSPRALALFGS* |
| Ga0075353_10610631 | 3300014321 | Natural And Restored Wetlands | DDNRRELDDGALNAISEQVRTTVAAMREVHIDPGSPRALALFGG* |
| Ga0180062_10551313 | 3300014879 | Soil | LDDAALAAIRQQVQATAAALKAIRIDPGSPRALALFSG* |
| Ga0180082_11340932 | 3300014880 | Soil | LDAALVDDNRRVLDDAAFSAIREQVRQTATALREVHIEPGSPRALALFGG* |
| Ga0184618_102405081 | 3300018071 | Groundwater Sediment | VDDNRRPLDDAALTAIRGQVEAAVIALKHVHIEPGSARALALFGA |
| Ga0184628_102729381 | 3300018083 | Groundwater Sediment | DNALAAIRQQVEVTARALKEARLDPGSPRALALFSG |
| Ga0173479_102985332 | 3300019362 | Soil | LVDDNRRPLDDPALAKIRAQVQSAADELAAVHIEPGSPRALALFGA |
| Ga0210330_11311672 | 3300021322 | Estuarine | VDDNRRALDDAALNAIRDQVRSTAAALREVHIEPGSPRAQALFGG |
| Ga0210384_106385102 | 3300021432 | Soil | NRRPLDDAALNAIREQVRSTAAALREVHIEPGSPRSLALFGG |
| Ga0182009_101360021 | 3300021445 | Soil | RPLDDQGLAAIRVQVQKTADALKAVHIDPGSPRALALFGG |
| Ga0210121_10533081 | 3300025555 | Natural And Restored Wetlands | VDDNRRALDDTALTAIRQQVQRTAAALKEIRVEPGSPRALALFGG |
| Ga0207682_105310771 | 3300025893 | Miscanthus Rhizosphere | LDDAAFSAIREQVRQTATALREVHIEPGSPRALALFGG |
| Ga0207645_104298231 | 3300025907 | Miscanthus Rhizosphere | NRRPLDDAALNAIREQVRNTATALREVRIEPGSARALALFGG |
| Ga0207660_115906112 | 3300025917 | Corn Rhizosphere | DNRRALDDAALATIRDQVQAAADALRAVHIQPGSPRALALFSA |
| Ga0207681_104495222 | 3300025923 | Switchgrass Rhizosphere | DNQRALDDAALASIKKQVEAAAEALRESGIEPGSPRALALFGA |
| Ga0207659_108321511 | 3300025926 | Miscanthus Rhizosphere | LDDAALASIRKQVEAAAEALRESGIEPGSPRALALFGA |
| Ga0207644_102743841 | 3300025931 | Switchgrass Rhizosphere | DAALVDDNRRVLDDAAFSAIREQVRQTATALREVHIEPGSPRALALFGG |
| Ga0207704_106281312 | 3300025938 | Miscanthus Rhizosphere | DAALAKIRGQVDAAAAALRNGYIEPGSARALALFGA |
| Ga0207679_101319551 | 3300025945 | Corn Rhizosphere | MSKTLGGELVDDNHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA |
| Ga0207651_116189351 | 3300025960 | Switchgrass Rhizosphere | NRRVLDDAAFSAIREQVRQTATALREVHIEPGSPRALALFGG |
| Ga0207712_119291152 | 3300025961 | Switchgrass Rhizosphere | HRPLDDAALATIREQVTDAADALRGVHIEPGSTRALALFSA |
| Ga0207668_112150531 | 3300025972 | Switchgrass Rhizosphere | DDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA |
| Ga0207640_115506521 | 3300025981 | Corn Rhizosphere | TLGAELVDDNRRVLDDAAFASIRGQVEEAADALRAVHIEPGSARALALFTA |
| Ga0207677_100482951 | 3300026023 | Miscanthus Rhizosphere | VDDNGRPLDDAALAKIRAQVDAAAAALRNGYIEPGSARALALFGA |
| Ga0207677_100582931 | 3300026023 | Miscanthus Rhizosphere | DNHRPLDDAAFTVIREQVDGAVEALRAVHIEPGSARALALFSA |
| Ga0207702_114859611 | 3300026078 | Corn Rhizosphere | DAAFAVIREQVDAAADALRAVHIEPGSARALALFSA |
| Ga0207683_108723121 | 3300026121 | Miscanthus Rhizosphere | AALNTIREQIRVTADAMREVNIEPGSPRALALFGG |
| Ga0207698_110006851 | 3300026142 | Corn Rhizosphere | RPLDEPALAAIRKQVDAAAAALREVGIEPGSPRALALFGA |
| Ga0207698_121284092 | 3300026142 | Corn Rhizosphere | RRPLDDAALAAIRQQVQLAADALKACRIDPGSPRAQALFGA |
| Ga0209798_102326662 | 3300027843 | Wetland Sediment | NRRALDDAALNAIREQVRSTTAALHEVHIEPGSPRALALFGG |
| Ga0209450_106175601 | 3300027885 | Freshwater Lake Sediment | RRALDDAALAAIRQQVQATAAALASVRIDPGSARAQALFGG |
| Ga0209382_115197411 | 3300027909 | Populus Rhizosphere | PLDDAALAKIRTQVEAAAGALKSGYIEPGSARALALFGA |
| Ga0268265_118471121 | 3300028380 | Switchgrass Rhizosphere | DNRRPLTDASLAAIRQQVETTASALRESRLDPGSPRAMALFGG |
| Ga0307503_102516352 | 3300028802 | Soil | LDDAALVAIRTQIQGTVDALRKTNIEPGSPRAMALFGG |
| Ga0247827_106143401 | 3300028889 | Soil | PLDDAAFTTIREQVGDAAEALRAVHIEPGSPRALALFSA |
| Ga0302298_102911111 | 3300029980 | Fen | DLVDDNRRSLDDAALAAIRQQVQIAADALRACRIDPGSPRAQALFGA |
| Ga0311350_108208631 | 3300030002 | Fen | DGDLVDDNRRLLDDAALASIRQQVQIAADALKACRIDPGSPRAQALFGA |
| Ga0302299_101691282 | 3300030010 | Fen | LDDTALAAIRDQVKATAAALRQVNIEPGSPRALALFGG |
| Ga0311366_105162751 | 3300030943 | Fen | RPLDDAALAVTRQQVQRAGDALRECGIEPGTPRALALFGA |
| Ga0265342_101257832 | 3300031712 | Rhizosphere | DDAALAAIRQQVDAAGTALRDVHIEPGSARALALFGG |
| Ga0318496_106969672 | 3300031713 | Soil | DNQRALDDVALAKIRTQVEAAAGALRNGYIEPGSARALALFGS |
| Ga0307469_101830312 | 3300031720 | Hardwood Forest Soil | AALNAIREQVRSTAAALREVHIEPGSPRSLALFGG |
| Ga0307469_123702062 | 3300031720 | Hardwood Forest Soil | ELVDDNHRPLDDAALAKIRTQVETAAGALKRGYIEPGSARALALFGA |
| Ga0311351_113834362 | 3300031722 | Fen | PLDDAALASIRRQVQLAADALQTCRIDPGSPRAQALFGA |
| Ga0315288_111792232 | 3300031772 | Sediment | DNRRTLDDAALNAIREQVRKTAAALREVHIEPGSPRALALFGG |
| Ga0318547_108606172 | 3300031781 | Soil | LDDAALAKIRAQVVAAAQALSEVHIEPGSPRALALFGA |
| Ga0310885_106302701 | 3300031943 | Soil | TLGGELVDDNHRPLDDAAFALIREQVDGAAEALRAVHIEPGSARALALFSA |
| Ga0308176_107158382 | 3300031996 | Soil | AAFGVIREQVDGAAEALRAVHIEPGSARALALFSA |
| Ga0315274_104170822 | 3300031999 | Sediment | ALDDAALNAIREQVRTTAAALREVHIEPGSPRAQALFGG |
| Ga0310895_106693242 | 3300032122 | Soil | NRRPLDDAALNTIREQVRSTAAALREVRIEPGSARALALFGG |
| Ga0315283_101218581 | 3300032164 | Sediment | AALNAIREQVRNTASALREVHIEPGSPRALALFGG |
| Ga0307470_109718912 | 3300032174 | Hardwood Forest Soil | LDDAALNAIREQVRSTAAALREVHIEPGSPRSLARFGG |
| Ga0310889_106798422 | 3300032179 | Soil | NHRPLDDAAFTTIREQVGDAAEALRAVHIEPGSPRALALFSA |
| Ga0315271_113748492 | 3300032256 | Sediment | NRRALDDAALNAIREQVRATAAALREVHIEPGSPRAQALFGG |
| Ga0315273_100429541 | 3300032516 | Sediment | TLDDAALNAIREQVRKTAAALREVHIDPGSPRALALFGG |
| Ga0315273_114116301 | 3300032516 | Sediment | LDATLVDDNRRELDDGALDAIREQVRTTAAAMREVHIEPGSPRALALFGG |
| Ga0335083_104844581 | 3300032954 | Soil | DDAALNAIRDQVRSTAAALAEVRIEPGSARALALFGG |
| Ga0335084_110967441 | 3300033004 | Soil | DDAALNAIRDQVKTTAAALREAHIEAGSARALALFGA |
| Ga0335084_123433422 | 3300033004 | Soil | QALDALLVDDNRRPLDEAALNAIRDQVRSTAAALAEVRIEPGSARALALFGG |
| Ga0316605_107477002 | 3300033408 | Soil | AQTLDAVLVDDNRRALDDAALAAIRQQVQATAAALASVRIDPGSARAQALFGG |
| Ga0316601_1000853243 | 3300033419 | Soil | NRRPLDDAALAAIRQQVQAAVAALRDVNIEPGSPRALALFGG |
| Ga0316627_1002922151 | 3300033482 | Soil | RRPLDDASLAAIRKQVDAATAALRECGIEPGSPRALALFGA |
| Ga0364929_0032644_1411_1545 | 3300034149 | Sediment | DDNRRPLDDAALAAIRQQVQMAADALKACRIDPGSPRAQALFGA |
| Ga0370480_0129162_3_110 | 3300034169 | Untreated Peat Soil | PALAAIRKQVDAAATALTESGIEPGSPRALALFGA |
| Ga0364941_131013_484_621 | 3300034417 | Sediment | VDDNRRPLDDAALAAIRQQVQMAADALKACRIDPGSPRAQALFGA |
| ⦗Top⦘ |