NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074833

Metagenome / Metatranscriptome Family F074833

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074833
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 49 residues
Representative Sequence PGVTPDVSITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH
Number of Associated Samples 108
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.68 %
% of genes near scaffold ends (potentially truncated) 95.80 %
% of genes from short scaffolds (< 2000 bps) 93.28 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.639 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.849 % of family members)
Environment Ontology (ENVO) Unclassified
(29.412 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.101 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.58%    β-sheet: 0.00%    Coil/Unstructured: 68.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF01904DUF72 73.95
PF02511Thy1 11.76
PF13188PAS_8 3.36
PF12844HTH_19 1.68
PF01636APH 1.68
PF13473Cupredoxin_1 1.68
PF07969Amidohydro_3 0.84
PF10099RskA 0.84
PF01022HTH_5 0.84
PF02130YbeY 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG1801Sugar isomerase-related protein YecE, UPF0759/DUF72 familyGeneral function prediction only [R] 73.95
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 11.76
COG0319ssRNA-specific RNase YbeY, 16S rRNA maturation enzymeTranslation, ribosomal structure and biogenesis [J] 0.84

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.64 %
UnclassifiedrootN/A3.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001536|A1565W1_10398271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9589Open in IMG/M
3300005175|Ga0066673_10763045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300005180|Ga0066685_11012704Not Available548Open in IMG/M
3300005181|Ga0066678_11000672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300005186|Ga0066676_10500968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria824Open in IMG/M
3300005336|Ga0070680_100153399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1934Open in IMG/M
3300005341|Ga0070691_10216447All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300005343|Ga0070687_100282572All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300005355|Ga0070671_101174369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9675Open in IMG/M
3300005440|Ga0070705_101688572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300005444|Ga0070694_100334380All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300005444|Ga0070694_100370267All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300005458|Ga0070681_10906965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9800Open in IMG/M
3300005467|Ga0070706_100105421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2623Open in IMG/M
3300005518|Ga0070699_100344001All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300005526|Ga0073909_10660266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9521Open in IMG/M
3300005548|Ga0070665_100277865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1676Open in IMG/M
3300005556|Ga0066707_10901521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300005575|Ga0066702_10140055All Organisms → cellular organisms → Bacteria1423Open in IMG/M
3300005576|Ga0066708_10449016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9828Open in IMG/M
3300005598|Ga0066706_11474880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300005840|Ga0068870_10997925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300005844|Ga0068862_101822142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9618Open in IMG/M
3300006034|Ga0066656_10216291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_91224Open in IMG/M
3300006046|Ga0066652_100041321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3402Open in IMG/M
3300006046|Ga0066652_100272633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1491Open in IMG/M
3300006048|Ga0075363_100107075All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300006606|Ga0074062_12981406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9596Open in IMG/M
3300006755|Ga0079222_10306665All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300006800|Ga0066660_10935642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9703Open in IMG/M
3300006852|Ga0075433_10493536All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300006871|Ga0075434_102640314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300007004|Ga0079218_13633493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300009088|Ga0099830_11666001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300009090|Ga0099827_10445874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_91109Open in IMG/M
3300009177|Ga0105248_10104572All Organisms → cellular organisms → Bacteria3192Open in IMG/M
3300009551|Ga0105238_10176866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2111Open in IMG/M
3300009789|Ga0126307_10609202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9882Open in IMG/M
3300009817|Ga0105062_1039575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9843Open in IMG/M
3300010036|Ga0126305_10937001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300010039|Ga0126309_10282545All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300010329|Ga0134111_10521131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300010333|Ga0134080_10445990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300010336|Ga0134071_10657575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9552Open in IMG/M
3300010336|Ga0134071_10791187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300010375|Ga0105239_10990713All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300010396|Ga0134126_12838531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300010401|Ga0134121_10208330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1694Open in IMG/M
3300010401|Ga0134121_11290792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9735Open in IMG/M
3300012096|Ga0137389_10154323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1882Open in IMG/M
3300012096|Ga0137389_10281820All Organisms → cellular organisms → Bacteria1404Open in IMG/M
3300012198|Ga0137364_10578879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9845Open in IMG/M
3300012200|Ga0137382_10011384All Organisms → cellular organisms → Bacteria4763Open in IMG/M
3300012201|Ga0137365_10528831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9866Open in IMG/M
3300012203|Ga0137399_11419519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria580Open in IMG/M
3300012206|Ga0137380_10290872All Organisms → cellular organisms → Bacteria1465Open in IMG/M
3300012208|Ga0137376_10404948All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300012361|Ga0137360_11649862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria546Open in IMG/M
3300012915|Ga0157302_10260056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9655Open in IMG/M
3300012918|Ga0137396_10819571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9684Open in IMG/M
3300012958|Ga0164299_11332747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300012961|Ga0164302_11468722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300012975|Ga0134110_10477573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300012977|Ga0134087_10240503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9826Open in IMG/M
3300012984|Ga0164309_10086446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1938Open in IMG/M
3300012986|Ga0164304_10288332All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300012989|Ga0164305_10278342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_91224Open in IMG/M
3300013105|Ga0157369_10419296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1388Open in IMG/M
3300014054|Ga0120135_1054946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria622Open in IMG/M
3300014157|Ga0134078_10651101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300014745|Ga0157377_11412042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300017659|Ga0134083_10395515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300018054|Ga0184621_10230440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9662Open in IMG/M
3300018061|Ga0184619_10467178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9561Open in IMG/M
3300018061|Ga0184619_10488615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300018433|Ga0066667_11459823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300018468|Ga0066662_10732986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9949Open in IMG/M
3300018468|Ga0066662_11236869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9759Open in IMG/M
3300018468|Ga0066662_12601752Not Available534Open in IMG/M
3300018482|Ga0066669_11921676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300019867|Ga0193704_1044652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9876Open in IMG/M
3300019873|Ga0193700_1020735All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300019873|Ga0193700_1034626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9826Open in IMG/M
3300019878|Ga0193715_1014885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1680Open in IMG/M
3300020059|Ga0193745_1118969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300021078|Ga0210381_10278275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9600Open in IMG/M
3300021344|Ga0193719_10206528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9838Open in IMG/M
3300021445|Ga0182009_10078241All Organisms → cellular organisms → Bacteria1467Open in IMG/M
3300022694|Ga0222623_10159177Not Available879Open in IMG/M
3300025908|Ga0207643_10918897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300025916|Ga0207663_10305187All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300025917|Ga0207660_10251370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1395Open in IMG/M
3300025931|Ga0207644_11333605All Organisms → cellular organisms → Bacteria → Proteobacteria603Open in IMG/M
3300026088|Ga0207641_12226023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300026095|Ga0207676_11038379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9809Open in IMG/M
3300026300|Ga0209027_1069584Not Available1306Open in IMG/M
3300026301|Ga0209238_1033661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1894Open in IMG/M
3300026532|Ga0209160_1089265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1597Open in IMG/M
3300026552|Ga0209577_10714241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9565Open in IMG/M
3300027056|Ga0209879_1028903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9920Open in IMG/M
3300027821|Ga0209811_10042728All Organisms → cellular organisms → Bacteria1532Open in IMG/M
3300027821|Ga0209811_10099734All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300028380|Ga0268265_12160735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300028709|Ga0307279_10069912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9608Open in IMG/M
3300028712|Ga0307285_10049376All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300028717|Ga0307298_10260440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300028720|Ga0307317_10012621All Organisms → cellular organisms → Bacteria2526Open in IMG/M
3300028782|Ga0307306_10008342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2188Open in IMG/M
3300028787|Ga0307323_10028717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1926Open in IMG/M
3300028787|Ga0307323_10085103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_91129Open in IMG/M
3300028791|Ga0307290_10031894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1871Open in IMG/M
3300028796|Ga0307287_10122881All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300028802|Ga0307503_10082372All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300028819|Ga0307296_10301041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9874Open in IMG/M
3300028828|Ga0307312_10864220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300028885|Ga0307304_10306238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9703Open in IMG/M
3300031170|Ga0307498_10279493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300032180|Ga0307471_103090302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300033805|Ga0314864_0007176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2094Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.08%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.36%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.52%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.52%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.52%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.52%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.68%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.68%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.68%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.84%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.84%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.84%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014054Permafrost microbial communities from Nunavut, Canada - A34_5cm_12MEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027056Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028709Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A1565W1_1039827123300001536PermafrostLHDYNPNNSGDVAYEHQQNALQDSIIGVDKKCRVH*
Ga0066673_1076304523300005175SoilAKYRLNVVGPGVTPDVSIVVPGLHDFNRNNPGDVAYENQQNALLDSIVGVDKKCHVH*
Ga0066685_1101270413300005180SoilGPGVTPDVSVVVPGLHDFDPKNPADIEYERRQNAILDSIVGVDKLCRQH*
Ga0066678_1100067223300005181SoilPFTSRGPGNGAKYRLTAIGPGVTPDVSITLPGLHDYNAANAADVAYERQQNALQDSIASGDNKCRVH*
Ga0066676_1050096823300005186SoilMTLPGLHDYDPNNSADAAYERQQSALQDSVAAGDKKCRVH*
Ga0070680_10015339913300005336Corn RhizospherePDVSITVAGLHDYNPNSSTDVAYERQQNALLDSIAGADKKCHVH*
Ga0070691_1021644733300005341Corn, Switchgrass And Miscanthus RhizosphereGVTPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH*
Ga0070687_10028257233300005343Switchgrass RhizosphereKYRLSTIGPGVTPDVSTTIAGLHDYNPNSSEDVAYERQQNALQDSIAGVDKKCHVH*
Ga0070671_10117436913300005355Switchgrass RhizosphereLSTIGPGVTPDVSTTIAGLHDYNPNSSEDVAYERQQNALQDSIAGVDKKCHVH*
Ga0070705_10168857213300005440Corn, Switchgrass And Miscanthus RhizosphereTAIGPGVTPDVSVTAPGLHDYNPNSSGDVTYEHQQNALQDSIAGADKKCHVH*
Ga0070694_10033438033300005444Corn, Switchgrass And Miscanthus RhizosphereTPDVSVTVPGLHDYDPNSPGDVAYERQQNALQDSIVGADKTCRVH*
Ga0070694_10037026713300005444Corn, Switchgrass And Miscanthus RhizosphereDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH*
Ga0070681_1090696523300005458Corn RhizosphereDVSITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH*
Ga0070706_10010542113300005467Corn, Switchgrass And Miscanthus RhizosphereTPDVTITVPGLHDYNPNNPADVAYERQQNALLDSIISVDKQCRRH*
Ga0070699_10034400113300005518Corn, Switchgrass And Miscanthus RhizosphereVVGPGVTPDVSVVVPGLHDYDRNNPADVAYERQQNALLDSIVGADKKCRVH*
Ga0073909_1066026623300005526Surface SoilVTPDVSIVVSGLHDFNRNSSGDVAYENQQNALQDSLGDKKCRVH*
Ga0070665_10027786543300005548Switchgrass RhizosphereRLTAPGPGVTPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH*
Ga0066707_1090152113300005556SoilNGAKYRLTAIGPGVTPDVSITLAGLRDYDSKNAADVAYERQQNALQDSVASGDKKCRVH*
Ga0066702_1014005533300005575SoilPGAAPDVSIVVPGLHDFNPGSQADVDFERQQNAVLDSIIGPDKLCRAH*
Ga0066708_1044901613300005576SoilYRLTAIGPGVTPDVSVTVPGLHDYDPKSSGDVAYEHQQNALQDSIAGVDKKCRVH*
Ga0066706_1147488023300005598SoilPGNGAKYRLTVVGPGVTPDVSVVVPGLPDYDRNNTADVAYERQQNALLDSMRGVDKKCRAH*
Ga0068870_1099792513300005840Miscanthus RhizosphereVTPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH*
Ga0068862_10182214223300005844Switchgrass RhizosphereGPGVTPDVSVVVAGLHDYNASNASDVAYERQQNALLDSILGVDKKCGVH*
Ga0066656_1021629133300006034SoilGLHDYNPNNSADVAYEHERNALQDSIAGADKKCHVH*
Ga0066652_10004132163300006046SoilKYRLTVVGPGVTPDVSVVIPGLHDFNRDSPGDVAYESRQNALQDSVAVGDKKCKVH*
Ga0066652_10027263313300006046SoilVTPDVSVVVPGLHDFDPKNPADIEYERRQNAILDSIVGVDKLCRRH*
Ga0075363_10010707533300006048Populus EndosphereRLTAVGPGVTPDVSVVIPGLHDFNPNSPGDVAYESQQNALQDSVAAGDRKCKVH*
Ga0074062_1298140613300006606SoilLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH*
Ga0079222_1030666533300006755Agricultural SoilVGPGVTPDVSIVVPGLHDFNRNNAADVAYENQQNALLDSIVGVDKKCRVH*
Ga0066660_1093564213300006800SoilPGGTPDLSVVVPGLHDYDRNNAADVAYERQRNALLDSMLGADRKCRVH*
Ga0075433_1049353633300006852Populus RhizosphereTSRGPGNGAKYRLTAVGPGVTPDVSIVVPGLHDYNRNDPADVAYEQQQNALLDSIVGVDKKCRVH*
Ga0075434_10264031413300006871Populus RhizospherePDVSIVIPGLHDFDRNNPGDVAYENQQNALQDSITAGDKKCRTH*
Ga0079218_1363349313300007004Agricultural SoilIGPGVTPDVSITIPGLHDYNPNNPADVAYERQQNALQDSIVVGDGKKCRRH*
Ga0099830_1166600113300009088Vadose Zone SoilPDVSITIPGLHDYNPNSSGDVAYEHQQNALQDSLMGADKKCRAH*
Ga0099827_1044587413300009090Vadose Zone SoilTIPGLHDYNPNSSGDVEYEHQRNALQDSLVGVDKKCRVH*
Ga0105248_1010457213300009177Switchgrass RhizosphereTVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH*
Ga0105238_1017686613300009551Corn RhizospherePGPGVTPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH*
Ga0126307_1060920213300009789Serpentine SoilNGEQYRLTVIGPGVTPDVSITIPGLDDFNSNNAEHVAYERQQNALLDSIVGVDRKCRRH*
Ga0105062_103957523300009817Groundwater SandEQYRLTVIGPGVTPDVSITVPGLHNYNPGNAADVAYERQQNTLQDTVTAGGKRCSH*
Ga0126305_1093700113300010036Serpentine SoilGPGVTPDVSITIPGLDDFKPNNAEHVAYERQQNALLDSIVGVDRKCRRH*
Ga0126309_1028254513300010039Serpentine SoilPDVSTTVSGLHNFNPNSSEDVVYEQQQNALQDSVAGADKTCHVH*
Ga0134111_1052113123300010329Grasslands SoilGPGNGAKYRLTAIGPGVTPDVSVTIPGLHDYDANSSGDVAYEQHQNVLQDSIAGVDKKCRVH*
Ga0134080_1044599023300010333Grasslands SoilSSRGPGNGAKYRLTAIGPGVTPDVSVTIPGLHDYDANSSGDVAYEQHQNVLQDSIAGVDKKCRVH*
Ga0134071_1065757513300010336Grasslands SoilITLPGLHDYDAKNAADVAYERQRNALQDSIASGDKKCRVH*
Ga0134071_1079118723300010336Grasslands SoilVSVTIPGLHDYSANSSEDVAYEQQQNALQDSIAGVDKKCRVH*
Ga0105239_1099071333300010375Corn RhizosphereGVTPDVSVVVSGLHSFDRNNAADVAYEQQQNALQDSFGDRKCKVH*
Ga0134126_1283853113300010396Terrestrial SoilGPGVTPDVSITIPGLHDYNPNSSTDVAYEREQNALQDSIAGADKKCHVH*
Ga0134121_1020833013300010401Terrestrial SoilPGVTPDVSITIPGLHDYNPNSSTDVAYEREQNALQDSIAGADKKCHVH*
Ga0134121_1129079213300010401Terrestrial SoilPGVTPDVSITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH*
Ga0137389_1015432323300012096Vadose Zone SoilVTPDVSITIPGLHDYNPNDGADVAYERQQNALQDSIAGVDKKCHVH*
Ga0137389_1028182013300012096Vadose Zone SoilHDYNPNSSGDVAYEHQQNALQDSLMGADKNCRVH*
Ga0137364_1057887923300012198Vadose Zone SoilAIGPGVTPDVSVTLPGLHDYNPNSSEDVAYEQQRNALQDSIAGVDKKCRVH*
Ga0137382_1001138413300012200Vadose Zone SoilKYRLTAIGPGVTPDVSVTLPGLHDYNPNSSEDVAYEQQRNALQDSIAGVDKKCRVH*
Ga0137365_1052883113300012201Vadose Zone SoilNGAKYRLTTIGPGVTPDVSITIPGLHDYNPNSSGDVAYEHQQNALQDSLVGVDKKCRVH*
Ga0137399_1141951913300012203Vadose Zone SoilPGNGEKYRLTVSGPGVTPDVSMTIPGLHDFNRDNPADVAYEHKQNGILDSIVSVDKLCRQH*
Ga0137380_1029087213300012206Vadose Zone SoilDVSVTVPGLHDYDPKSSGDVAYEHQQNALQDSLVGVDKKCRVH*
Ga0137376_1040494833300012208Vadose Zone SoilLHDFNRNSPGDVAYERRQNALQDSVALGDKKCKVH*
Ga0137360_1164986223300012361Vadose Zone SoilPGLHDYDPNSSGDVAYEQQRNALQDSIAGVDKKCRVH*
Ga0157302_1026005613300012915SoilSVVIPGLHDFNPNSPGDVAYENQQNALLDSIVGVDKKCRVH*
Ga0137396_1081957113300012918Vadose Zone SoilRGPGNGAKYRLTAIGPGVTPDVSVTVPGPHDYDPKSSGDVAYEHQQNALQDSIAGVDKKCRVH*
Ga0164299_1133274713300012958SoilNGAKYRLNVVGPGVTPDVSIVVPGLHDFNRNNAADVAYENQQNALLDSIVGVDKKCRVH*
Ga0164302_1146872213300012961SoilVSGLHDFNPNSSEDVAYEQRQNALQDSVAGADKKCHVH*
Ga0134110_1047757313300012975Grasslands SoilVTPDVSVVVPGLHNYDRYNAADVAYERQQNALLDSIRGVDKKCRAH*
Ga0134087_1024050313300012977Grasslands SoilGPGVTPDVSITVAGLHDYDPKNGADVAYERQQNALQDSIASGDKKCRVH*
Ga0164309_1008644643300012984SoilGVTPDVSTTVSGLHDFNPNSSEDVAYEQRQNALQDSVAGADKKCHVH*
Ga0164304_1028833233300012986SoilVTPDVSITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH*
Ga0164305_1027834213300012989SoilPDVSITIPGLHDYNPNSPGDVAYERQQNALQDSIAGVDKKCHVH*
Ga0157369_1041929613300013105Corn RhizosphereIVIPGLHDFDRNNPGDVAYENQQNALQDSITAGDKKCRTH*
Ga0120135_105494633300014054PermafrostFYRFSSRGPGNGSKYRLNAIGPGVTPDVSITVPGLHDFDRNNPADVAYEQRQNALLDSIVGVDKKCRVH*
Ga0134078_1065110123300014157Grasslands SoilYRLTVEGPGVTPDVSIVVPGLHDFDRNNPADVAYERQQDALLFSMLGPDKICRHH*
Ga0157377_1141204213300014745Miscanthus RhizosphereVSTTIAGLHDYNPNSSEDVAYERQQNALQDSIAGVDKKCHVH*
Ga0134083_1039551523300017659Grasslands SoilPGVTPDVSVVVPGLHDYNRSNPADVAYEQHQNALLDSIIGVDKLCRQH
Ga0184621_1023044023300018054Groundwater SedimentLTAIGPGVTPDVSTTLSGLHDFNPNSSEDVAYEQRQNALQDSVAGADKKCHVH
Ga0184619_1046717823300018061Groundwater SedimentLPGLHDYNPNNAADVAYERQQNALLDSIVGVDKQCRHH
Ga0184619_1048861513300018061Groundwater SedimentTGIFCYGFYPFTKRGPGNGARYRLNVVGSGVTPDVSVVVPGLHDYDRNNAADVAYERQQNAVLDSILGVDKKCRVH
Ga0066667_1145982323300018433Grasslands SoilGQKYRLSANGPGAAPDVSIVVAGLHDFNPGNQADVDYERQQNAVLDSIIGPDKLCRQH
Ga0066662_1073298613300018468Grasslands SoilLTAVGPGVTPDVSIVIPGLHDYDRSNAADVAYERQQNALLDSIAAGDRKCHVH
Ga0066662_1123686923300018468Grasslands SoilRKLRGPGNGAKYRLTVNGPGVTPDVSLVLTGLHDFNRNNPADVAYEQQQNAVLDSIVSTDKLCRQH
Ga0066662_1260175223300018468Grasslands SoilTPDVSTVVPGLHDYDGHNAADVAYERQQNALLDSIAAGDPKCHVH
Ga0066669_1192167623300018482Grasslands SoilRGPGNGAKYRLTAVGSGVTPDVSVVVPGLHNYVRNNAADVAYERQQNALLDSMLGVDKKCRVH
Ga0193704_104465213300019867SoilPDVSITVPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH
Ga0193700_102073533300019873SoilPDVSITIPGLHDYSPNSSTDVAYERQQNALQDSIAGADKKCHVH
Ga0193700_103462613300019873SoilFYKFSARGPGNGAKYRLTAIGPGVSPDVSTTVSGLHDFNSNSSEDVAYEQRQNALQDSVAGADKKCHVH
Ga0193715_101488543300019878SoilGLHDYDPNSSTDVAYERQQNALQDSVAGADKKCHVH
Ga0193745_111896923300020059SoilIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH
Ga0210381_1027827513300021078Groundwater SedimentTIPGLHDYDPNSSGDVAYEHQQNALQDSIAGVGKKCRVH
Ga0193719_1020652813300021344SoilTAIGPGVTPDVSVTLPGLHDYNPNSSEDVAYEQQRNALQDSIAGVDTKCRVH
Ga0182009_1007824113300021445SoilPGNGAQYRLSAIGPGVTPDVSITLAGLHDYNPSDPADVAYEKQQNALLDSVAAGDQKCKV
Ga0222623_1015917723300022694Groundwater SedimentVGPGVTPDVRITLPGLHDYDARNPADVEYEERQNGLLNSILGVDKKCGRP
Ga0207643_1091889723300025908Miscanthus RhizosphereVTPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH
Ga0207663_1030518733300025916Corn, Switchgrass And Miscanthus RhizosphereLSTIGPGVTPDVSTTVAGLHDYNPNSSEDVAYERQQNALQDSIAGVDKKCHVH
Ga0207660_1025137033300025917Corn RhizospherePDVSITVAGLHDYNPNSSTDVAYERQQNALLDSIAGADKKCHVH
Ga0207644_1133360513300025931Switchgrass RhizosphereSRGPGNGAKYRLNVVGPGVTPDVSVVVAGLHDFNRNNAADVAFETQQNALLDSIVGVDKKCRTH
Ga0207641_1222602323300026088Switchgrass RhizosphereTPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH
Ga0207676_1103837923300026095Switchgrass RhizospherePDVSITIQGLHDYNPNSATDVAYELQQNALQDSIAGADKKCHVH
Ga0209027_106958433300026300Grasslands SoilLHDYNAKNPADVAYERQQNALQDAIASGDKKCRVH
Ga0209238_103366143300026301Grasslands SoilGVTPDVSVVIPGLHDFDRNSPGDVAYESQQNARQDSVAAGDKKCKVH
Ga0209160_108926533300026532SoilYRLTAIGPGVTPDVSITLPGLHDYNAANAADVAYERQQNALQDSIASGDNKCRVH
Ga0209577_1071424123300026552SoilPGGTPDLSVVVPGLHDYDRNNAADVAYERQRNALLDSMLGADRKCRVH
Ga0209879_102890333300027056Groundwater SandPFTSRGSGNGEKYRLTAIGPGVTPDVSITLPGLHDYNRDNASDVAYERQQNTLQDTVTAGGKRCSH
Ga0209811_1004272833300027821Surface SoilDVSITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH
Ga0209811_1009973433300027821Surface SoilITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH
Ga0268265_1216073513300028380Switchgrass RhizosphereGPGVTPDVSVVVAGLHDYNASNASDVAYERQQNALLDSILGVDKKCGVH
Ga0307279_1006991223300028709SoilTTVSGLHDFNSNSSEDVAYEQRQNALQDSVAGADKKCHVH
Ga0307285_1004937613300028712SoilPWLHDYDPNSSTDVAYERQQNALQDSVAGADKKCHVH
Ga0307298_1026044013300028717SoilTLPGLNDYNPNSPEDVAYEQQRNALQDSIAGVDTKCRVH
Ga0307317_1001262113300028720SoilSVVVPGLHDYDGNNSADVAYERQQNALLDSIVGVDKKCRVH
Ga0307306_1000834243300028782SoilPGPGVTPDVSITIPGLHDYDPNSSTDVAYERQQNALQDSVAGADKKCHVH
Ga0307323_1002871743300028787SoilPGVTPDVSITIPGLHDYDPNSSGDVAYEHQQNALQDSIAGVDKKCRVH
Ga0307323_1008510313300028787SoilPDVSVTLPGLNDYNPNSPEDVAYEQQRNALQDSIAGVDTKCRVH
Ga0307290_1003189413300028791SoilLHDFNPNSSEDVAYEQQQNALQDSVAGADKKCHVH
Ga0307287_1012288113300028796SoilGPGVTPDVSITIPGLHDYSPNSSTDVAYERQQNALQDSIAGADKKCHVH
Ga0307503_1008237233300028802SoilAIGPGVTPDVSTTIAGLHDFDQNSSADVEYERQQNALQDSVAGADKKCHVH
Ga0307296_1030104113300028819SoilPGVTPDVSTTVPGLHDYDPRNPADVSYEQQQNAFLDSIVGVDKQCRRH
Ga0307312_1086422013300028828SoilYGFYKFSARGPGNGAKYRLTAIGPGVSPDVSTTVSGLHDFNSNSSEDVAYEQRQNALQDSVAGADKKCHVH
Ga0307304_1030623813300028885SoilDVSITLPGLHDFDPNSSGDVAYEQQQNALQDSIAGADKKCHVH
Ga0307498_1027949313300031170SoilVTPDVSITIAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH
Ga0307471_10309030223300032180Hardwood Forest SoilIGPGVTPDVSTTVSGLHDFNPNSSEDVAYEQRQNALQDSVAGADKKCHVH
Ga0314864_0007176_1929_20933300033805PeatlandRLTVEGPGVTPDVSVVVPGLHPYNRNDPSDVAYEQQQNAILDSIVGVDKLCRTH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.