| Basic Information | |
|---|---|
| Family ID | F074833 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 49 residues |
| Representative Sequence | PGVTPDVSITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.68 % |
| % of genes near scaffold ends (potentially truncated) | 95.80 % |
| % of genes from short scaffolds (< 2000 bps) | 93.28 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.639 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.849 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.412 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.101 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.58% β-sheet: 0.00% Coil/Unstructured: 68.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF01904 | DUF72 | 73.95 |
| PF02511 | Thy1 | 11.76 |
| PF13188 | PAS_8 | 3.36 |
| PF12844 | HTH_19 | 1.68 |
| PF01636 | APH | 1.68 |
| PF13473 | Cupredoxin_1 | 1.68 |
| PF07969 | Amidohydro_3 | 0.84 |
| PF10099 | RskA | 0.84 |
| PF01022 | HTH_5 | 0.84 |
| PF02130 | YbeY | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 73.95 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 11.76 |
| COG0319 | ssRNA-specific RNase YbeY, 16S rRNA maturation enzyme | Translation, ribosomal structure and biogenesis [J] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.64 % |
| Unclassified | root | N/A | 3.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001536|A1565W1_10398271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 589 | Open in IMG/M |
| 3300005175|Ga0066673_10763045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300005180|Ga0066685_11012704 | Not Available | 548 | Open in IMG/M |
| 3300005181|Ga0066678_11000672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300005186|Ga0066676_10500968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 824 | Open in IMG/M |
| 3300005336|Ga0070680_100153399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1934 | Open in IMG/M |
| 3300005341|Ga0070691_10216447 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300005343|Ga0070687_100282572 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300005355|Ga0070671_101174369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 675 | Open in IMG/M |
| 3300005440|Ga0070705_101688572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300005444|Ga0070694_100334380 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300005444|Ga0070694_100370267 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300005458|Ga0070681_10906965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 800 | Open in IMG/M |
| 3300005467|Ga0070706_100105421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2623 | Open in IMG/M |
| 3300005518|Ga0070699_100344001 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300005526|Ga0073909_10660266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 521 | Open in IMG/M |
| 3300005548|Ga0070665_100277865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1676 | Open in IMG/M |
| 3300005556|Ga0066707_10901521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300005575|Ga0066702_10140055 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300005576|Ga0066708_10449016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 828 | Open in IMG/M |
| 3300005598|Ga0066706_11474880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300005840|Ga0068870_10997925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300005844|Ga0068862_101822142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 618 | Open in IMG/M |
| 3300006034|Ga0066656_10216291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 1224 | Open in IMG/M |
| 3300006046|Ga0066652_100041321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3402 | Open in IMG/M |
| 3300006046|Ga0066652_100272633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1491 | Open in IMG/M |
| 3300006048|Ga0075363_100107075 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300006606|Ga0074062_12981406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 596 | Open in IMG/M |
| 3300006755|Ga0079222_10306665 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300006800|Ga0066660_10935642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 703 | Open in IMG/M |
| 3300006852|Ga0075433_10493536 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300006871|Ga0075434_102640314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300007004|Ga0079218_13633493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300009088|Ga0099830_11666001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300009090|Ga0099827_10445874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 1109 | Open in IMG/M |
| 3300009177|Ga0105248_10104572 | All Organisms → cellular organisms → Bacteria | 3192 | Open in IMG/M |
| 3300009551|Ga0105238_10176866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2111 | Open in IMG/M |
| 3300009789|Ga0126307_10609202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 882 | Open in IMG/M |
| 3300009817|Ga0105062_1039575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 843 | Open in IMG/M |
| 3300010036|Ga0126305_10937001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300010039|Ga0126309_10282545 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300010329|Ga0134111_10521131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300010333|Ga0134080_10445990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300010336|Ga0134071_10657575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 552 | Open in IMG/M |
| 3300010336|Ga0134071_10791187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300010375|Ga0105239_10990713 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300010396|Ga0134126_12838531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300010401|Ga0134121_10208330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1694 | Open in IMG/M |
| 3300010401|Ga0134121_11290792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 735 | Open in IMG/M |
| 3300012096|Ga0137389_10154323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1882 | Open in IMG/M |
| 3300012096|Ga0137389_10281820 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300012198|Ga0137364_10578879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 845 | Open in IMG/M |
| 3300012200|Ga0137382_10011384 | All Organisms → cellular organisms → Bacteria | 4763 | Open in IMG/M |
| 3300012201|Ga0137365_10528831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 866 | Open in IMG/M |
| 3300012203|Ga0137399_11419519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300012206|Ga0137380_10290872 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300012208|Ga0137376_10404948 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300012361|Ga0137360_11649862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300012915|Ga0157302_10260056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 655 | Open in IMG/M |
| 3300012918|Ga0137396_10819571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 684 | Open in IMG/M |
| 3300012958|Ga0164299_11332747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300012961|Ga0164302_11468722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300012975|Ga0134110_10477573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300012977|Ga0134087_10240503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 826 | Open in IMG/M |
| 3300012984|Ga0164309_10086446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1938 | Open in IMG/M |
| 3300012986|Ga0164304_10288332 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300012989|Ga0164305_10278342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 1224 | Open in IMG/M |
| 3300013105|Ga0157369_10419296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1388 | Open in IMG/M |
| 3300014054|Ga0120135_1054946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| 3300014157|Ga0134078_10651101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300014745|Ga0157377_11412042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300017659|Ga0134083_10395515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300018054|Ga0184621_10230440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 662 | Open in IMG/M |
| 3300018061|Ga0184619_10467178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 561 | Open in IMG/M |
| 3300018061|Ga0184619_10488615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300018433|Ga0066667_11459823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300018468|Ga0066662_10732986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 949 | Open in IMG/M |
| 3300018468|Ga0066662_11236869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 759 | Open in IMG/M |
| 3300018468|Ga0066662_12601752 | Not Available | 534 | Open in IMG/M |
| 3300018482|Ga0066669_11921676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300019867|Ga0193704_1044652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 876 | Open in IMG/M |
| 3300019873|Ga0193700_1020735 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300019873|Ga0193700_1034626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 826 | Open in IMG/M |
| 3300019878|Ga0193715_1014885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1680 | Open in IMG/M |
| 3300020059|Ga0193745_1118969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300021078|Ga0210381_10278275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 600 | Open in IMG/M |
| 3300021344|Ga0193719_10206528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 838 | Open in IMG/M |
| 3300021445|Ga0182009_10078241 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300022694|Ga0222623_10159177 | Not Available | 879 | Open in IMG/M |
| 3300025908|Ga0207643_10918897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300025916|Ga0207663_10305187 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300025917|Ga0207660_10251370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1395 | Open in IMG/M |
| 3300025931|Ga0207644_11333605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300026088|Ga0207641_12226023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300026095|Ga0207676_11038379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 809 | Open in IMG/M |
| 3300026300|Ga0209027_1069584 | Not Available | 1306 | Open in IMG/M |
| 3300026301|Ga0209238_1033661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1894 | Open in IMG/M |
| 3300026532|Ga0209160_1089265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1597 | Open in IMG/M |
| 3300026552|Ga0209577_10714241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 565 | Open in IMG/M |
| 3300027056|Ga0209879_1028903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 920 | Open in IMG/M |
| 3300027821|Ga0209811_10042728 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300027821|Ga0209811_10099734 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300028380|Ga0268265_12160735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300028709|Ga0307279_10069912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 608 | Open in IMG/M |
| 3300028712|Ga0307285_10049376 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300028717|Ga0307298_10260440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300028720|Ga0307317_10012621 | All Organisms → cellular organisms → Bacteria | 2526 | Open in IMG/M |
| 3300028782|Ga0307306_10008342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2188 | Open in IMG/M |
| 3300028787|Ga0307323_10028717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1926 | Open in IMG/M |
| 3300028787|Ga0307323_10085103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 1129 | Open in IMG/M |
| 3300028791|Ga0307290_10031894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1871 | Open in IMG/M |
| 3300028796|Ga0307287_10122881 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300028802|Ga0307503_10082372 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300028819|Ga0307296_10301041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 874 | Open in IMG/M |
| 3300028828|Ga0307312_10864220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300028885|Ga0307304_10306238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 703 | Open in IMG/M |
| 3300031170|Ga0307498_10279493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
| 3300032180|Ga0307471_103090302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300033805|Ga0314864_0007176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2094 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.36% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.52% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.68% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.68% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.84% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.84% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A1565W1_103982712 | 3300001536 | Permafrost | LHDYNPNNSGDVAYEHQQNALQDSIIGVDKKCRVH* |
| Ga0066673_107630452 | 3300005175 | Soil | AKYRLNVVGPGVTPDVSIVVPGLHDFNRNNPGDVAYENQQNALLDSIVGVDKKCHVH* |
| Ga0066685_110127041 | 3300005180 | Soil | GPGVTPDVSVVVPGLHDFDPKNPADIEYERRQNAILDSIVGVDKLCRQH* |
| Ga0066678_110006722 | 3300005181 | Soil | PFTSRGPGNGAKYRLTAIGPGVTPDVSITLPGLHDYNAANAADVAYERQQNALQDSIASGDNKCRVH* |
| Ga0066676_105009682 | 3300005186 | Soil | MTLPGLHDYDPNNSADAAYERQQSALQDSVAAGDKKCRVH* |
| Ga0070680_1001533991 | 3300005336 | Corn Rhizosphere | PDVSITVAGLHDYNPNSSTDVAYERQQNALLDSIAGADKKCHVH* |
| Ga0070691_102164473 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | GVTPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH* |
| Ga0070687_1002825723 | 3300005343 | Switchgrass Rhizosphere | KYRLSTIGPGVTPDVSTTIAGLHDYNPNSSEDVAYERQQNALQDSIAGVDKKCHVH* |
| Ga0070671_1011743691 | 3300005355 | Switchgrass Rhizosphere | LSTIGPGVTPDVSTTIAGLHDYNPNSSEDVAYERQQNALQDSIAGVDKKCHVH* |
| Ga0070705_1016885721 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TAIGPGVTPDVSVTAPGLHDYNPNSSGDVTYEHQQNALQDSIAGADKKCHVH* |
| Ga0070694_1003343803 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | TPDVSVTVPGLHDYDPNSPGDVAYERQQNALQDSIVGADKTCRVH* |
| Ga0070694_1003702671 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | DVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH* |
| Ga0070681_109069652 | 3300005458 | Corn Rhizosphere | DVSITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH* |
| Ga0070706_1001054211 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TPDVTITVPGLHDYNPNNPADVAYERQQNALLDSIISVDKQCRRH* |
| Ga0070699_1003440011 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VVGPGVTPDVSVVVPGLHDYDRNNPADVAYERQQNALLDSIVGADKKCRVH* |
| Ga0073909_106602662 | 3300005526 | Surface Soil | VTPDVSIVVSGLHDFNRNSSGDVAYENQQNALQDSLGDKKCRVH* |
| Ga0070665_1002778654 | 3300005548 | Switchgrass Rhizosphere | RLTAPGPGVTPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH* |
| Ga0066707_109015211 | 3300005556 | Soil | NGAKYRLTAIGPGVTPDVSITLAGLRDYDSKNAADVAYERQQNALQDSVASGDKKCRVH* |
| Ga0066702_101400553 | 3300005575 | Soil | PGAAPDVSIVVPGLHDFNPGSQADVDFERQQNAVLDSIIGPDKLCRAH* |
| Ga0066708_104490161 | 3300005576 | Soil | YRLTAIGPGVTPDVSVTVPGLHDYDPKSSGDVAYEHQQNALQDSIAGVDKKCRVH* |
| Ga0066706_114748802 | 3300005598 | Soil | PGNGAKYRLTVVGPGVTPDVSVVVPGLPDYDRNNTADVAYERQQNALLDSMRGVDKKCRAH* |
| Ga0068870_109979251 | 3300005840 | Miscanthus Rhizosphere | VTPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH* |
| Ga0068862_1018221422 | 3300005844 | Switchgrass Rhizosphere | GPGVTPDVSVVVAGLHDYNASNASDVAYERQQNALLDSILGVDKKCGVH* |
| Ga0066656_102162913 | 3300006034 | Soil | GLHDYNPNNSADVAYEHERNALQDSIAGADKKCHVH* |
| Ga0066652_1000413216 | 3300006046 | Soil | KYRLTVVGPGVTPDVSVVIPGLHDFNRDSPGDVAYESRQNALQDSVAVGDKKCKVH* |
| Ga0066652_1002726331 | 3300006046 | Soil | VTPDVSVVVPGLHDFDPKNPADIEYERRQNAILDSIVGVDKLCRRH* |
| Ga0075363_1001070753 | 3300006048 | Populus Endosphere | RLTAVGPGVTPDVSVVIPGLHDFNPNSPGDVAYESQQNALQDSVAAGDRKCKVH* |
| Ga0074062_129814061 | 3300006606 | Soil | LHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH* |
| Ga0079222_103066653 | 3300006755 | Agricultural Soil | VGPGVTPDVSIVVPGLHDFNRNNAADVAYENQQNALLDSIVGVDKKCRVH* |
| Ga0066660_109356421 | 3300006800 | Soil | PGGTPDLSVVVPGLHDYDRNNAADVAYERQRNALLDSMLGADRKCRVH* |
| Ga0075433_104935363 | 3300006852 | Populus Rhizosphere | TSRGPGNGAKYRLTAVGPGVTPDVSIVVPGLHDYNRNDPADVAYEQQQNALLDSIVGVDKKCRVH* |
| Ga0075434_1026403141 | 3300006871 | Populus Rhizosphere | PDVSIVIPGLHDFDRNNPGDVAYENQQNALQDSITAGDKKCRTH* |
| Ga0079218_136334931 | 3300007004 | Agricultural Soil | IGPGVTPDVSITIPGLHDYNPNNPADVAYERQQNALQDSIVVGDGKKCRRH* |
| Ga0099830_116660011 | 3300009088 | Vadose Zone Soil | PDVSITIPGLHDYNPNSSGDVAYEHQQNALQDSLMGADKKCRAH* |
| Ga0099827_104458741 | 3300009090 | Vadose Zone Soil | TIPGLHDYNPNSSGDVEYEHQRNALQDSLVGVDKKCRVH* |
| Ga0105248_101045721 | 3300009177 | Switchgrass Rhizosphere | TVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH* |
| Ga0105238_101768661 | 3300009551 | Corn Rhizosphere | PGPGVTPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH* |
| Ga0126307_106092021 | 3300009789 | Serpentine Soil | NGEQYRLTVIGPGVTPDVSITIPGLDDFNSNNAEHVAYERQQNALLDSIVGVDRKCRRH* |
| Ga0105062_10395752 | 3300009817 | Groundwater Sand | EQYRLTVIGPGVTPDVSITVPGLHNYNPGNAADVAYERQQNTLQDTVTAGGKRCSH* |
| Ga0126305_109370011 | 3300010036 | Serpentine Soil | GPGVTPDVSITIPGLDDFKPNNAEHVAYERQQNALLDSIVGVDRKCRRH* |
| Ga0126309_102825451 | 3300010039 | Serpentine Soil | PDVSTTVSGLHNFNPNSSEDVVYEQQQNALQDSVAGADKTCHVH* |
| Ga0134111_105211312 | 3300010329 | Grasslands Soil | GPGNGAKYRLTAIGPGVTPDVSVTIPGLHDYDANSSGDVAYEQHQNVLQDSIAGVDKKCRVH* |
| Ga0134080_104459902 | 3300010333 | Grasslands Soil | SSRGPGNGAKYRLTAIGPGVTPDVSVTIPGLHDYDANSSGDVAYEQHQNVLQDSIAGVDKKCRVH* |
| Ga0134071_106575751 | 3300010336 | Grasslands Soil | ITLPGLHDYDAKNAADVAYERQRNALQDSIASGDKKCRVH* |
| Ga0134071_107911872 | 3300010336 | Grasslands Soil | VSVTIPGLHDYSANSSEDVAYEQQQNALQDSIAGVDKKCRVH* |
| Ga0105239_109907133 | 3300010375 | Corn Rhizosphere | GVTPDVSVVVSGLHSFDRNNAADVAYEQQQNALQDSFGDRKCKVH* |
| Ga0134126_128385311 | 3300010396 | Terrestrial Soil | GPGVTPDVSITIPGLHDYNPNSSTDVAYEREQNALQDSIAGADKKCHVH* |
| Ga0134121_102083301 | 3300010401 | Terrestrial Soil | PGVTPDVSITIPGLHDYNPNSSTDVAYEREQNALQDSIAGADKKCHVH* |
| Ga0134121_112907921 | 3300010401 | Terrestrial Soil | PGVTPDVSITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH* |
| Ga0137389_101543232 | 3300012096 | Vadose Zone Soil | VTPDVSITIPGLHDYNPNDGADVAYERQQNALQDSIAGVDKKCHVH* |
| Ga0137389_102818201 | 3300012096 | Vadose Zone Soil | HDYNPNSSGDVAYEHQQNALQDSLMGADKNCRVH* |
| Ga0137364_105788792 | 3300012198 | Vadose Zone Soil | AIGPGVTPDVSVTLPGLHDYNPNSSEDVAYEQQRNALQDSIAGVDKKCRVH* |
| Ga0137382_100113841 | 3300012200 | Vadose Zone Soil | KYRLTAIGPGVTPDVSVTLPGLHDYNPNSSEDVAYEQQRNALQDSIAGVDKKCRVH* |
| Ga0137365_105288311 | 3300012201 | Vadose Zone Soil | NGAKYRLTTIGPGVTPDVSITIPGLHDYNPNSSGDVAYEHQQNALQDSLVGVDKKCRVH* |
| Ga0137399_114195191 | 3300012203 | Vadose Zone Soil | PGNGEKYRLTVSGPGVTPDVSMTIPGLHDFNRDNPADVAYEHKQNGILDSIVSVDKLCRQH* |
| Ga0137380_102908721 | 3300012206 | Vadose Zone Soil | DVSVTVPGLHDYDPKSSGDVAYEHQQNALQDSLVGVDKKCRVH* |
| Ga0137376_104049483 | 3300012208 | Vadose Zone Soil | LHDFNRNSPGDVAYERRQNALQDSVALGDKKCKVH* |
| Ga0137360_116498622 | 3300012361 | Vadose Zone Soil | PGLHDYDPNSSGDVAYEQQRNALQDSIAGVDKKCRVH* |
| Ga0157302_102600561 | 3300012915 | Soil | SVVIPGLHDFNPNSPGDVAYENQQNALLDSIVGVDKKCRVH* |
| Ga0137396_108195711 | 3300012918 | Vadose Zone Soil | RGPGNGAKYRLTAIGPGVTPDVSVTVPGPHDYDPKSSGDVAYEHQQNALQDSIAGVDKKCRVH* |
| Ga0164299_113327471 | 3300012958 | Soil | NGAKYRLNVVGPGVTPDVSIVVPGLHDFNRNNAADVAYENQQNALLDSIVGVDKKCRVH* |
| Ga0164302_114687221 | 3300012961 | Soil | VSGLHDFNPNSSEDVAYEQRQNALQDSVAGADKKCHVH* |
| Ga0134110_104775731 | 3300012975 | Grasslands Soil | VTPDVSVVVPGLHNYDRYNAADVAYERQQNALLDSIRGVDKKCRAH* |
| Ga0134087_102405031 | 3300012977 | Grasslands Soil | GPGVTPDVSITVAGLHDYDPKNGADVAYERQQNALQDSIASGDKKCRVH* |
| Ga0164309_100864464 | 3300012984 | Soil | GVTPDVSTTVSGLHDFNPNSSEDVAYEQRQNALQDSVAGADKKCHVH* |
| Ga0164304_102883323 | 3300012986 | Soil | VTPDVSITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH* |
| Ga0164305_102783421 | 3300012989 | Soil | PDVSITIPGLHDYNPNSPGDVAYERQQNALQDSIAGVDKKCHVH* |
| Ga0157369_104192961 | 3300013105 | Corn Rhizosphere | IVIPGLHDFDRNNPGDVAYENQQNALQDSITAGDKKCRTH* |
| Ga0120135_10549463 | 3300014054 | Permafrost | FYRFSSRGPGNGSKYRLNAIGPGVTPDVSITVPGLHDFDRNNPADVAYEQRQNALLDSIVGVDKKCRVH* |
| Ga0134078_106511012 | 3300014157 | Grasslands Soil | YRLTVEGPGVTPDVSIVVPGLHDFDRNNPADVAYERQQDALLFSMLGPDKICRHH* |
| Ga0157377_114120421 | 3300014745 | Miscanthus Rhizosphere | VSTTIAGLHDYNPNSSEDVAYERQQNALQDSIAGVDKKCHVH* |
| Ga0134083_103955152 | 3300017659 | Grasslands Soil | PGVTPDVSVVVPGLHDYNRSNPADVAYEQHQNALLDSIIGVDKLCRQH |
| Ga0184621_102304402 | 3300018054 | Groundwater Sediment | LTAIGPGVTPDVSTTLSGLHDFNPNSSEDVAYEQRQNALQDSVAGADKKCHVH |
| Ga0184619_104671782 | 3300018061 | Groundwater Sediment | LPGLHDYNPNNAADVAYERQQNALLDSIVGVDKQCRHH |
| Ga0184619_104886151 | 3300018061 | Groundwater Sediment | TGIFCYGFYPFTKRGPGNGARYRLNVVGSGVTPDVSVVVPGLHDYDRNNAADVAYERQQNAVLDSILGVDKKCRVH |
| Ga0066667_114598232 | 3300018433 | Grasslands Soil | GQKYRLSANGPGAAPDVSIVVAGLHDFNPGNQADVDYERQQNAVLDSIIGPDKLCRQH |
| Ga0066662_107329861 | 3300018468 | Grasslands Soil | LTAVGPGVTPDVSIVIPGLHDYDRSNAADVAYERQQNALLDSIAAGDRKCHVH |
| Ga0066662_112368692 | 3300018468 | Grasslands Soil | RKLRGPGNGAKYRLTVNGPGVTPDVSLVLTGLHDFNRNNPADVAYEQQQNAVLDSIVSTDKLCRQH |
| Ga0066662_126017522 | 3300018468 | Grasslands Soil | TPDVSTVVPGLHDYDGHNAADVAYERQQNALLDSIAAGDPKCHVH |
| Ga0066669_119216762 | 3300018482 | Grasslands Soil | RGPGNGAKYRLTAVGSGVTPDVSVVVPGLHNYVRNNAADVAYERQQNALLDSMLGVDKKCRVH |
| Ga0193704_10446521 | 3300019867 | Soil | PDVSITVPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH |
| Ga0193700_10207353 | 3300019873 | Soil | PDVSITIPGLHDYSPNSSTDVAYERQQNALQDSIAGADKKCHVH |
| Ga0193700_10346261 | 3300019873 | Soil | FYKFSARGPGNGAKYRLTAIGPGVSPDVSTTVSGLHDFNSNSSEDVAYEQRQNALQDSVAGADKKCHVH |
| Ga0193715_10148854 | 3300019878 | Soil | GLHDYDPNSSTDVAYERQQNALQDSVAGADKKCHVH |
| Ga0193745_11189692 | 3300020059 | Soil | IPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH |
| Ga0210381_102782751 | 3300021078 | Groundwater Sediment | TIPGLHDYDPNSSGDVAYEHQQNALQDSIAGVGKKCRVH |
| Ga0193719_102065281 | 3300021344 | Soil | TAIGPGVTPDVSVTLPGLHDYNPNSSEDVAYEQQRNALQDSIAGVDTKCRVH |
| Ga0182009_100782411 | 3300021445 | Soil | PGNGAQYRLSAIGPGVTPDVSITLAGLHDYNPSDPADVAYEKQQNALLDSVAAGDQKCKV |
| Ga0222623_101591772 | 3300022694 | Groundwater Sediment | VGPGVTPDVRITLPGLHDYDARNPADVEYEERQNGLLNSILGVDKKCGRP |
| Ga0207643_109188972 | 3300025908 | Miscanthus Rhizosphere | VTPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH |
| Ga0207663_103051873 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LSTIGPGVTPDVSTTVAGLHDYNPNSSEDVAYERQQNALQDSIAGVDKKCHVH |
| Ga0207660_102513703 | 3300025917 | Corn Rhizosphere | PDVSITVAGLHDYNPNSSTDVAYERQQNALLDSIAGADKKCHVH |
| Ga0207644_113336051 | 3300025931 | Switchgrass Rhizosphere | SRGPGNGAKYRLNVVGPGVTPDVSVVVAGLHDFNRNNAADVAFETQQNALLDSIVGVDKKCRTH |
| Ga0207641_122260232 | 3300026088 | Switchgrass Rhizosphere | TPDVSITVAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH |
| Ga0207676_110383792 | 3300026095 | Switchgrass Rhizosphere | PDVSITIQGLHDYNPNSATDVAYELQQNALQDSIAGADKKCHVH |
| Ga0209027_10695843 | 3300026300 | Grasslands Soil | LHDYNAKNPADVAYERQQNALQDAIASGDKKCRVH |
| Ga0209238_10336614 | 3300026301 | Grasslands Soil | GVTPDVSVVIPGLHDFDRNSPGDVAYESQQNARQDSVAAGDKKCKVH |
| Ga0209160_10892653 | 3300026532 | Soil | YRLTAIGPGVTPDVSITLPGLHDYNAANAADVAYERQQNALQDSIASGDNKCRVH |
| Ga0209577_107142412 | 3300026552 | Soil | PGGTPDLSVVVPGLHDYDRNNAADVAYERQRNALLDSMLGADRKCRVH |
| Ga0209879_10289033 | 3300027056 | Groundwater Sand | PFTSRGSGNGEKYRLTAIGPGVTPDVSITLPGLHDYNRDNASDVAYERQQNTLQDTVTAGGKRCSH |
| Ga0209811_100427283 | 3300027821 | Surface Soil | DVSITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH |
| Ga0209811_100997343 | 3300027821 | Surface Soil | ITIPGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH |
| Ga0268265_121607351 | 3300028380 | Switchgrass Rhizosphere | GPGVTPDVSVVVAGLHDYNASNASDVAYERQQNALLDSILGVDKKCGVH |
| Ga0307279_100699122 | 3300028709 | Soil | TTVSGLHDFNSNSSEDVAYEQRQNALQDSVAGADKKCHVH |
| Ga0307285_100493761 | 3300028712 | Soil | PWLHDYDPNSSTDVAYERQQNALQDSVAGADKKCHVH |
| Ga0307298_102604401 | 3300028717 | Soil | TLPGLNDYNPNSPEDVAYEQQRNALQDSIAGVDTKCRVH |
| Ga0307317_100126211 | 3300028720 | Soil | SVVVPGLHDYDGNNSADVAYERQQNALLDSIVGVDKKCRVH |
| Ga0307306_100083424 | 3300028782 | Soil | PGPGVTPDVSITIPGLHDYDPNSSTDVAYERQQNALQDSVAGADKKCHVH |
| Ga0307323_100287174 | 3300028787 | Soil | PGVTPDVSITIPGLHDYDPNSSGDVAYEHQQNALQDSIAGVDKKCRVH |
| Ga0307323_100851031 | 3300028787 | Soil | PDVSVTLPGLNDYNPNSPEDVAYEQQRNALQDSIAGVDTKCRVH |
| Ga0307290_100318941 | 3300028791 | Soil | LHDFNPNSSEDVAYEQQQNALQDSVAGADKKCHVH |
| Ga0307287_101228811 | 3300028796 | Soil | GPGVTPDVSITIPGLHDYSPNSSTDVAYERQQNALQDSIAGADKKCHVH |
| Ga0307503_100823723 | 3300028802 | Soil | AIGPGVTPDVSTTIAGLHDFDQNSSADVEYERQQNALQDSVAGADKKCHVH |
| Ga0307296_103010411 | 3300028819 | Soil | PGVTPDVSTTVPGLHDYDPRNPADVSYEQQQNAFLDSIVGVDKQCRRH |
| Ga0307312_108642201 | 3300028828 | Soil | YGFYKFSARGPGNGAKYRLTAIGPGVSPDVSTTVSGLHDFNSNSSEDVAYEQRQNALQDSVAGADKKCHVH |
| Ga0307304_103062381 | 3300028885 | Soil | DVSITLPGLHDFDPNSSGDVAYEQQQNALQDSIAGADKKCHVH |
| Ga0307498_102794931 | 3300031170 | Soil | VTPDVSITIAGLHDYNPNSSTDVAYERQQNALQDSIAGADKKCHVH |
| Ga0307471_1030903022 | 3300032180 | Hardwood Forest Soil | IGPGVTPDVSTTVSGLHDFNPNSSEDVAYEQRQNALQDSVAGADKKCHVH |
| Ga0314864_0007176_1929_2093 | 3300033805 | Peatland | RLTVEGPGVTPDVSVVVPGLHPYNRNDPSDVAYEQQQNAILDSIVGVDKLCRTH |
| ⦗Top⦘ |