| Basic Information | |
|---|---|
| Family ID | F074803 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVEILETAAAQHKPE |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 4.20 % |
| % of genes near scaffold ends (potentially truncated) | 60.50 % |
| % of genes from short scaffolds (< 2000 bps) | 82.35 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (84.034 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (24.370 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.101 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (47.059 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.00% β-sheet: 0.00% Coil/Unstructured: 44.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 10.92 |
| PF07880 | T4_gp9_10 | 2.52 |
| PF00574 | CLP_protease | 1.68 |
| PF12850 | Metallophos_2 | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 3.36 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 3.36 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.28 % |
| Unclassified | root | N/A | 6.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002138|M3t6FKB1_1289853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300003413|JGI25922J50271_10005883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3434 | Open in IMG/M |
| 3300004240|Ga0007787_10018075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2928 | Open in IMG/M |
| 3300004481|Ga0069718_10127233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1157 | Open in IMG/M |
| 3300004795|Ga0007756_10066011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300005527|Ga0068876_10301952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
| 3300005662|Ga0078894_10512068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1076 | Open in IMG/M |
| 3300006030|Ga0075470_10011480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2730 | Open in IMG/M |
| 3300006030|Ga0075470_10048027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1309 | Open in IMG/M |
| 3300006030|Ga0075470_10061625 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
| 3300006639|Ga0079301_1036562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1632 | Open in IMG/M |
| 3300006641|Ga0075471_10062758 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
| 3300006802|Ga0070749_10250779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1002 | Open in IMG/M |
| 3300006802|Ga0070749_10343856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
| 3300006917|Ga0075472_10042840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2137 | Open in IMG/M |
| 3300006917|Ga0075472_10167750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
| 3300006917|Ga0075472_10438743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300007538|Ga0099851_1202848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300007734|Ga0104986_1556 | Not Available | 17436 | Open in IMG/M |
| 3300007973|Ga0105746_1329853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300008113|Ga0114346_1257746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300008266|Ga0114363_1012735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3910 | Open in IMG/M |
| 3300008266|Ga0114363_1064126 | Not Available | 1417 | Open in IMG/M |
| 3300008266|Ga0114363_1081594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1603 | Open in IMG/M |
| 3300008266|Ga0114363_1100540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
| 3300008266|Ga0114363_1142915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
| 3300008266|Ga0114363_1195672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
| 3300008266|Ga0114363_1218283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300008448|Ga0114876_1233505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300008448|Ga0114876_1260897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300008450|Ga0114880_1079472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1312 | Open in IMG/M |
| 3300008450|Ga0114880_1096345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1152 | Open in IMG/M |
| 3300009059|Ga0102830_1173501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300009081|Ga0105098_10015425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2864 | Open in IMG/M |
| 3300009111|Ga0115026_11556731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300010354|Ga0129333_11237734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300011268|Ga0151620_1118361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300011337|Ga0153702_1119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30031 | Open in IMG/M |
| 3300012702|Ga0157596_1143338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3578 | Open in IMG/M |
| 3300012731|Ga0157616_1068126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1753 | Open in IMG/M |
| 3300012733|Ga0157606_1408271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1799 | Open in IMG/M |
| 3300013004|Ga0164293_10188317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1500 | Open in IMG/M |
| 3300013005|Ga0164292_10564206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300013372|Ga0177922_10215145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300013372|Ga0177922_10748255 | Not Available | 1780 | Open in IMG/M |
| 3300015243|Ga0180041_103736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1459 | Open in IMG/M |
| 3300017722|Ga0181347_1155533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300017747|Ga0181352_1158293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300017754|Ga0181344_1189631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300017766|Ga0181343_1066496 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300017766|Ga0181343_1098422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300017777|Ga0181357_1046048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1710 | Open in IMG/M |
| 3300017784|Ga0181348_1258280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300018420|Ga0181563_10278837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
| 3300019784|Ga0181359_1094365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1105 | Open in IMG/M |
| 3300020176|Ga0181556_1093066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1392 | Open in IMG/M |
| 3300020494|Ga0208326_108947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300021438|Ga0213920_1002279 | Not Available | 9281 | Open in IMG/M |
| 3300021961|Ga0222714_10213243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1107 | Open in IMG/M |
| 3300021962|Ga0222713_10360224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300022179|Ga0181353_1006082 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2880 | Open in IMG/M |
| 3300022190|Ga0181354_1139176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300022190|Ga0181354_1179822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300022407|Ga0181351_1222707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300022752|Ga0214917_10190102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
| 3300024554|Ga0255242_1061628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
| 3300024556|Ga0256341_1068036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300024560|Ga0256306_1113809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300024560|Ga0256306_1153013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300024568|Ga0255238_1010832 | Not Available | 2189 | Open in IMG/M |
| 3300025585|Ga0208546_1011163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2365 | Open in IMG/M |
| 3300025585|Ga0208546_1032809 | All Organisms → Viruses → Predicted Viral | 1272 | Open in IMG/M |
| 3300025585|Ga0208546_1054801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
| 3300025646|Ga0208161_1110122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300025848|Ga0208005_1009151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3028 | Open in IMG/M |
| 3300025889|Ga0208644_1182323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300026569|Ga0255277_1110215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300027137|Ga0255092_1049122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
| 3300027499|Ga0208788_1041263 | Not Available | 1285 | Open in IMG/M |
| 3300027693|Ga0209704_1164691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
| 3300027697|Ga0209033_1035532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. CFD-1 | 1880 | Open in IMG/M |
| 3300027769|Ga0209770_10120804 | Not Available | 1069 | Open in IMG/M |
| 3300027769|Ga0209770_10202245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300027805|Ga0209229_10363323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300027956|Ga0209820_1008119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2566 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1090480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1434 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10301706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300031787|Ga0315900_10202382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1756 | Open in IMG/M |
| 3300031857|Ga0315909_10073919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3037 | Open in IMG/M |
| 3300031857|Ga0315909_10262575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1317 | Open in IMG/M |
| 3300031951|Ga0315904_10692360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300031963|Ga0315901_10545096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300031963|Ga0315901_10663065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300032050|Ga0315906_10677786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300032093|Ga0315902_10148727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2441 | Open in IMG/M |
| 3300032093|Ga0315902_11164212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300032116|Ga0315903_10705880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300032116|Ga0315903_10760147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300033416|Ga0316622_100839075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1069 | Open in IMG/M |
| 3300033980|Ga0334981_0158056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
| 3300033981|Ga0334982_0093704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1591 | Open in IMG/M |
| 3300033981|Ga0334982_0113667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1413 | Open in IMG/M |
| 3300033981|Ga0334982_0173301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
| 3300033993|Ga0334994_0177033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
| 3300033996|Ga0334979_0260637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
| 3300034012|Ga0334986_0373144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300034018|Ga0334985_0168550 | All Organisms → Viruses → Predicted Viral | 1477 | Open in IMG/M |
| 3300034020|Ga0335002_0110405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1850 | Open in IMG/M |
| 3300034061|Ga0334987_0148235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1721 | Open in IMG/M |
| 3300034061|Ga0334987_0502826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300034066|Ga0335019_0003159 | Not Available | 10991 | Open in IMG/M |
| 3300034101|Ga0335027_0115351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2024 | Open in IMG/M |
| 3300034104|Ga0335031_0279343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1095 | Open in IMG/M |
| 3300034112|Ga0335066_0245953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1036 | Open in IMG/M |
| 3300034117|Ga0335033_0093731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1745 | Open in IMG/M |
| 3300034283|Ga0335007_0056471 | All Organisms → Viruses → Predicted Viral | 3010 | Open in IMG/M |
| 3300034283|Ga0335007_0151273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1661 | Open in IMG/M |
| 3300034284|Ga0335013_0547701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300034356|Ga0335048_0139444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 24.37% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.81% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.24% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.72% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.88% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.52% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.68% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.68% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.68% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.84% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.84% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.84% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.84% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.84% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.84% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002138 | M3t6FKB1 (102f) | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300011337 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan | Environmental | Open in IMG/M |
| 3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015243 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES148 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024554 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024556 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027137 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| M3t6FKB1_12898533 | 3300002138 | Marine | MIKIELTIEQVQNLHQLLVIGMKAGDVNNMRVGLPLVDAIEAAAKASQSKPE* |
| JGI25922J50271_100058837 | 3300003413 | Freshwater Lake | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE* |
| Ga0007787_100180756 | 3300004240 | Freshwater Lake | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE* |
| Ga0069718_101272332 | 3300004481 | Sediment | MIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT* |
| Ga0007756_100660111 | 3300004795 | Freshwater Lake | QFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE* |
| Ga0068876_103019524 | 3300005527 | Freshwater Lake | MIQIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHKPE* |
| Ga0078894_105120681 | 3300005662 | Freshwater Lake | DMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE* |
| Ga0075470_100114807 | 3300006030 | Aqueous | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKPE* |
| Ga0075470_100480273 | 3300006030 | Aqueous | MEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKPE* |
| Ga0075470_100616253 | 3300006030 | Aqueous | MEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLV |
| Ga0079301_10365625 | 3300006639 | Deep Subsurface | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPIVEILETAAAQHKPE* |
| Ga0075471_100627585 | 3300006641 | Aqueous | MEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQAKPE* |
| Ga0070749_102507791 | 3300006802 | Aqueous | QLYELLVIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE* |
| Ga0070749_103438564 | 3300006802 | Aqueous | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLETAAAQHKPE* |
| Ga0075472_100428406 | 3300006917 | Aqueous | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILE |
| Ga0075472_101677501 | 3300006917 | Aqueous | NQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQAKPE* |
| Ga0075472_104387432 | 3300006917 | Aqueous | MEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQA |
| Ga0099851_12028484 | 3300007538 | Aqueous | PQQFNQLYELLVIGMKAGNVTNIKVGLPLVELLETAAAAQHKPE* |
| Ga0104986_155612 | 3300007734 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVETLEAAAKASQPTD* |
| Ga0105746_13298531 | 3300007973 | Estuary Water | DRMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVDILETAAAQHKPE* |
| Ga0114346_12577461 | 3300008113 | Freshwater, Plankton | PPDMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE* |
| Ga0114363_101273510 | 3300008266 | Freshwater, Plankton | MEITIKLTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVDILETAAAQHKPE* |
| Ga0114363_10641266 | 3300008266 | Freshwater, Plankton | RMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLETAAAQHKPE* |
| Ga0114363_10815941 | 3300008266 | Freshwater, Plankton | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPL |
| Ga0114363_11005403 | 3300008266 | Freshwater, Plankton | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLV |
| Ga0114363_11429153 | 3300008266 | Freshwater, Plankton | MIKIELTPQQFNQLYELLVIGMKAGNVTNIKVGLPLVELLETAAAQHKPE* |
| Ga0114363_11956722 | 3300008266 | Freshwater, Plankton | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQLPLVEILETAAAQHKPE* |
| Ga0114363_12182831 | 3300008266 | Freshwater, Plankton | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLP |
| Ga0114876_12335052 | 3300008448 | Freshwater Lake | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHKPE* |
| Ga0114876_12608971 | 3300008448 | Freshwater Lake | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLV |
| Ga0114880_10794721 | 3300008450 | Freshwater Lake | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLP |
| Ga0114880_10963455 | 3300008450 | Freshwater Lake | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVEILETAAAQHKPE* |
| Ga0102830_11735011 | 3300009059 | Estuarine | QQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE* |
| Ga0105098_100154253 | 3300009081 | Freshwater Sediment | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE* |
| Ga0115026_115567312 | 3300009111 | Wetland | MIKIELTPQQLNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHKPE* |
| Ga0129333_112377342 | 3300010354 | Freshwater To Marine Saline Gradient | MEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE* |
| Ga0151620_11183614 | 3300011268 | Freshwater | VIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE* |
| Ga0153702_111940 | 3300011337 | Freshwater | MIKIEFTPQQFNQLYELLVIGMKAGNVTNMKVGIPLVDLLEAAAAQHKPE* |
| Ga0157596_11433387 | 3300012702 | Freshwater | MIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQLNFT* |
| Ga0157616_10681264 | 3300012731 | Freshwater | MIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNP |
| Ga0157606_14082711 | 3300012733 | Freshwater | RCRSSCRMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT* |
| Ga0164293_101883173 | 3300013004 | Freshwater | MIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAK |
| Ga0164292_105642063 | 3300013005 | Freshwater | ELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT* |
| Ga0177922_102151454 | 3300013372 | Freshwater | DSDRMIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE* |
| Ga0177922_107482556 | 3300013372 | Freshwater | MIKIELTPQQFNQLYELLIIGMKAGNVTNMKVGLPLVELLETAAAQHKPE* |
| Ga0180041_1037361 | 3300015243 | Freshwater | MIKIELTQEQANQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT* |
| Ga0181347_11555332 | 3300017722 | Freshwater Lake | MIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNLT |
| Ga0181352_11582931 | 3300017747 | Freshwater Lake | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVE |
| Ga0181344_11896311 | 3300017754 | Freshwater Lake | IELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE |
| Ga0181343_10664961 | 3300017766 | Freshwater Lake | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKP |
| Ga0181343_10984224 | 3300017766 | Freshwater Lake | GCGAGHRCRSSCRMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT |
| Ga0181357_10460484 | 3300017777 | Freshwater Lake | MIQIELTPQQFNQLYDLLVIGMKAGNVNNMKVGLPLVEILETAAAQHKP |
| Ga0181348_12582803 | 3300017784 | Freshwater Lake | MIQIELTPQQFNQLYDLLVIGMKAGNVNNMKVGLPLV |
| Ga0181563_102788375 | 3300018420 | Salt Marsh | DRSSRRMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKPE |
| Ga0181359_10943652 | 3300019784 | Freshwater Lake | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHKPE |
| Ga0181556_10930662 | 3300020176 | Salt Marsh | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKPE |
| Ga0208326_1089472 | 3300020494 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAQHKPE |
| Ga0213920_10022791 | 3300021438 | Freshwater | MEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKPE |
| Ga0222714_102132432 | 3300021961 | Estuarine Water | MIKIELTPQQFNQLYELLIIGMKAGNVTNMKVGLPLVELLETAAAQHKPE |
| Ga0222713_103602241 | 3300021962 | Estuarine Water | MIKIELTPQQFNQLYELLIIGMKAGNVTNMKVGLPLVELLET |
| Ga0181353_10060821 | 3300022179 | Freshwater Lake | MIQIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE |
| Ga0181354_11391761 | 3300022190 | Freshwater Lake | RCSYRCMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHKPE |
| Ga0181354_11798221 | 3300022190 | Freshwater Lake | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPL |
| Ga0181351_12227074 | 3300022407 | Freshwater Lake | RRMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLETAAAQHKPE |
| Ga0214917_101901021 | 3300022752 | Freshwater | MIQIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVEILETAAAQHKPE |
| Ga0255242_10616283 | 3300024554 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVDILEAAAATSQAKPE |
| Ga0256341_10680361 | 3300024556 | Freshwater | KIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQAKPE |
| Ga0256306_11138091 | 3300024560 | Freshwater | MIKIELTPQQFNQFYELLVIGMKAGNVQNMKVGLP |
| Ga0256306_11530131 | 3300024560 | Freshwater | MIQIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| Ga0255238_10108326 | 3300024568 | Freshwater | MINIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| Ga0208546_10111631 | 3300025585 | Aqueous | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHKP |
| Ga0208546_10328092 | 3300025585 | Aqueous | MEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQAKPE |
| Ga0208546_10548013 | 3300025585 | Aqueous | MIQIELTPQQFNQLYELLVIGMKAGNVNNMKVGIPLVEILETAAAQHK |
| Ga0208161_11101222 | 3300025646 | Aqueous | MIKIELTPQQFNQLYELLVIGMKAGNVTNIKVGLPLVELLETAAAQHKPE |
| Ga0208005_10091511 | 3300025848 | Aqueous | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAAQHK |
| Ga0208644_11823232 | 3300025889 | Aqueous | MEITIKLTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE |
| Ga0255277_11102152 | 3300026569 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAANSQAKPE |
| Ga0255092_10491224 | 3300027137 | Freshwater | PQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| Ga0208788_10412635 | 3300027499 | Deep Subsurface | MIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPIVEILETAAAQHKPE |
| Ga0209704_11646911 | 3300027693 | Freshwater Sediment | RCRSSCRMIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE |
| Ga0209033_10355327 | 3300027697 | Freshwater Lake | SCSGDRSSRRMIKIELTPQQFNQLYELLVIGMKAGNVNNMKVGLPLVDILEAAAATSQAKPE |
| Ga0209770_101208044 | 3300027769 | Freshwater Lake | ELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| Ga0209770_102022454 | 3300027769 | Freshwater Lake | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLETAAAAQHKPE |
| Ga0209229_103633231 | 3300027805 | Freshwater And Sediment | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVD |
| Ga0209820_10081191 | 3300027956 | Freshwater Sediment | MIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLV |
| (restricted) Ga0247843_10904802 | 3300028569 | Freshwater | MIQIELTPQQFNQLYELLVIGMKAGNVNNMKIGIPLVEILETAAAQHKPE |
| (restricted) Ga0247840_103017061 | 3300028581 | Freshwater | ELTPQQFNQLYELLVIGMKAGNVNNMKIGIPLVEILETAAAQHKPE |
| Ga0315900_102023821 | 3300031787 | Freshwater | FNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| Ga0315909_100739191 | 3300031857 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILET |
| Ga0315909_102625753 | 3300031857 | Freshwater | MIKIELTPQQLNQLYELLVIGMKAGNVQNMKVGIPLVEILETAAAQHKPE |
| Ga0315904_106923601 | 3300031951 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELL |
| Ga0315901_105450961 | 3300031963 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEIL |
| Ga0315901_106630653 | 3300031963 | Freshwater | TNDQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| Ga0315906_106777862 | 3300032050 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILE |
| Ga0315902_101487271 | 3300032093 | Freshwater | LYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| Ga0315902_111642121 | 3300032093 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAA |
| Ga0315903_107058803 | 3300032116 | Freshwater | QFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| Ga0315903_107601471 | 3300032116 | Freshwater | YELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| Ga0316622_1008390755 | 3300033416 | Soil | RMIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT |
| Ga0334981_0158056_627_785 | 3300033980 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLETAAAYSQSKPE |
| Ga0334982_0093704_3_149 | 3300033981 | Freshwater | MIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSN |
| Ga0334982_0113667_1269_1412 | 3300033981 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQ |
| Ga0334982_0173301_2_133 | 3300033981 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAA |
| Ga0334994_0177033_2_115 | 3300033993 | Freshwater | MIKIELTLQQLQQLTQLLVIGMKAGDVMNMKVGLPLYE |
| Ga0334979_0260637_2_139 | 3300033996 | Freshwater | MIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKN |
| Ga0334986_0373144_2_121 | 3300034012 | Freshwater | MIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDIL |
| Ga0334985_0168550_1330_1476 | 3300034018 | Freshwater | ELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE |
| Ga0335002_0110405_1720_1848 | 3300034020 | Freshwater | MIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEA |
| Ga0334987_0148235_315_467 | 3300034061 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVDILEAAAAQHKPE |
| Ga0334987_0502826_50_202 | 3300034061 | Freshwater | MIEIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| Ga0335019_0003159_7164_7316 | 3300034066 | Freshwater | MIKIELTPQQFNQLYELLIIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| Ga0335027_0115351_1908_2024 | 3300034101 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVEL |
| Ga0335031_0279343_974_1093 | 3300034104 | Freshwater | MIKIELTLQQLQQLTQLLVIGMKAGDVMNMKVGLPLYESI |
| Ga0335066_0245953_2_106 | 3300034112 | Freshwater | MIKIELTLQQLQQLTQLLVIGMKAGDVMNMKVGLP |
| Ga0335033_0093731_1_126 | 3300034117 | Freshwater | MIKIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILES |
| Ga0335007_0056471_2858_3010 | 3300034283 | Freshwater | KIELTPQQFNQLYELLVIGMKAGNVTNMKVGLPLVELLEAAAAYSQSKPE |
| Ga0335007_0151273_933_1088 | 3300034283 | Freshwater | MIKIELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNPSNPT |
| Ga0335013_0547701_541_684 | 3300034284 | Freshwater | ELTLQQLQLLHQLLVIGMKAGDVNNMRVGLPLVDILEEAAKNQSNPT |
| Ga0335048_0139444_1256_1402 | 3300034356 | Freshwater | KIELTPQQFNQLYELLVIGMKAGNVQNMKVGLPLVEILETAAAQHKPE |
| ⦗Top⦘ |