| Basic Information | |
|---|---|
| Family ID | F074689 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 51 residues |
| Representative Sequence | EIRSGYTIGYVPPDRDGAYHRVRVQIEPSPPRRSTVRTRPGYFAAGRSSQP |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.85 % |
| % of genes near scaffold ends (potentially truncated) | 97.48 % |
| % of genes from short scaffolds (< 2000 bps) | 94.96 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.160 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.765 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.252 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.420 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF04203 | Sortase | 78.99 |
| PF00717 | Peptidase_S24 | 3.36 |
| PF13505 | OMP_b-brl | 2.52 |
| PF13193 | AMP-binding_C | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 78.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.16 % |
| Unclassified | root | N/A | 0.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908041|P3_CLC_ConsensusfromContig62203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 2199352025|deepsgr__Contig_112537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300000891|JGI10214J12806_12308098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300004081|Ga0063454_100484860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 863 | Open in IMG/M |
| 3300004114|Ga0062593_101006583 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300004153|Ga0063455_100607800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 713 | Open in IMG/M |
| 3300005093|Ga0062594_100854945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300005093|Ga0062594_102062803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300005166|Ga0066674_10007280 | All Organisms → cellular organisms → Bacteria | 4432 | Open in IMG/M |
| 3300005186|Ga0066676_11048516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300005327|Ga0070658_10068048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2911 | Open in IMG/M |
| 3300005328|Ga0070676_10493532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300005332|Ga0066388_100302119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2246 | Open in IMG/M |
| 3300005332|Ga0066388_107649891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300005332|Ga0066388_108773485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300005338|Ga0068868_100557265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300005345|Ga0070692_10542797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300005354|Ga0070675_102205031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300005364|Ga0070673_101857951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300005450|Ga0066682_10793602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300005454|Ga0066687_10422259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300005457|Ga0070662_101223083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300005468|Ga0070707_101265036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300005526|Ga0073909_10587041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300005534|Ga0070735_10430028 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005535|Ga0070684_101196016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 715 | Open in IMG/M |
| 3300005536|Ga0070697_100719277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300005536|Ga0070697_101085649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300005540|Ga0066697_10446394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300005545|Ga0070695_101018853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300005547|Ga0070693_100606037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300005549|Ga0070704_100745228 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005557|Ga0066704_10441679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300005563|Ga0068855_102294290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300005566|Ga0066693_10074993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1180 | Open in IMG/M |
| 3300005578|Ga0068854_101151259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300005598|Ga0066706_10351706 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300005617|Ga0068859_101040854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300005617|Ga0068859_101081716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 882 | Open in IMG/M |
| 3300005618|Ga0068864_101225307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300005713|Ga0066905_101617319 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005719|Ga0068861_100164206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1835 | Open in IMG/M |
| 3300005874|Ga0075288_1083999 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006032|Ga0066696_11089210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300006034|Ga0066656_10057578 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
| 3300006791|Ga0066653_10628159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300006800|Ga0066660_11207108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300006844|Ga0075428_102477356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300006845|Ga0075421_100670543 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300006852|Ga0075433_10200984 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300006852|Ga0075433_10296831 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300006854|Ga0075425_100405538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1571 | Open in IMG/M |
| 3300006854|Ga0075425_103042172 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006871|Ga0075434_102567529 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300006904|Ga0075424_100343288 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300006904|Ga0075424_100480855 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300009093|Ga0105240_10725701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1082 | Open in IMG/M |
| 3300009094|Ga0111539_10484951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1440 | Open in IMG/M |
| 3300009101|Ga0105247_10747090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300009137|Ga0066709_100966795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1245 | Open in IMG/M |
| 3300009137|Ga0066709_101442460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300009137|Ga0066709_101788014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300009162|Ga0075423_11781235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300009649|Ga0105855_1236859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300010045|Ga0126311_10283649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
| 3300010326|Ga0134065_10339476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300010399|Ga0134127_13148189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300010400|Ga0134122_10499767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
| 3300010401|Ga0134121_10153659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1965 | Open in IMG/M |
| 3300012212|Ga0150985_108255174 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300012349|Ga0137387_10374723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1031 | Open in IMG/M |
| 3300012354|Ga0137366_11025818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300012502|Ga0157347_1058488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300012922|Ga0137394_11609294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300012923|Ga0137359_11712952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300012960|Ga0164301_11389428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300012972|Ga0134077_10580060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300012976|Ga0134076_10500339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300015359|Ga0134085_10550695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300015372|Ga0132256_102039498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300015373|Ga0132257_101737813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300015373|Ga0132257_102504452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300015374|Ga0132255_102121059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300016357|Ga0182032_10804095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300017654|Ga0134069_1030050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1663 | Open in IMG/M |
| 3300018482|Ga0066669_11283395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300020082|Ga0206353_12008021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300021080|Ga0210382_10038748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1830 | Open in IMG/M |
| 3300021861|Ga0213853_10283750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300023072|Ga0247799_1075763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300025913|Ga0207695_11387214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300025919|Ga0207657_10003841 | All Organisms → cellular organisms → Bacteria | 15954 | Open in IMG/M |
| 3300025920|Ga0207649_10700242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300025924|Ga0207694_10761633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300025927|Ga0207687_10872762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300025937|Ga0207669_10988354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300025941|Ga0207711_11520245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300025993|Ga0208415_1031470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300026035|Ga0207703_12203325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300026075|Ga0207708_11222979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300026075|Ga0207708_11998870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300026095|Ga0207676_10582273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1073 | Open in IMG/M |
| 3300026095|Ga0207676_11331053 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300026118|Ga0207675_100262831 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300026118|Ga0207675_102733703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300026220|Ga0209855_1012780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1497 | Open in IMG/M |
| 3300026538|Ga0209056_10138805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1890 | Open in IMG/M |
| 3300027915|Ga0209069_10778568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300028380|Ga0268265_12351415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300028381|Ga0268264_10782277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300028807|Ga0307305_10341065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300031226|Ga0307497_10200347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300031561|Ga0318528_10328260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300031562|Ga0310886_11070735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300031820|Ga0307473_11423947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300032205|Ga0307472_101073517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 760 | Open in IMG/M |
| 3300032205|Ga0307472_102606648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300034819|Ga0373958_0075228 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.24% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.20% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.68% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.68% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.84% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.84% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.84% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.84% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908041 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026220 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P3_CLC_00332290 | 2124908041 | Soil | TIGYAPPARDGAYHRVKVELDPSSARRLNVRTRPGYFAAGRPAQP |
| deepsgr_01770220 | 2199352025 | Soil | CQHIAREIRSGYTIGYTPPDRDGAFHRIRVEVAHPSKRKLTAKTRPGYFASRQSGEPR |
| JGI10214J12806_123080982 | 3300000891 | Soil | VPPDRDGLFHRVRVVIEPEPRHRLDVRTRPGYFAARSTSPSSQP* |
| Ga0063454_1004848601 | 3300004081 | Soil | AHEIRSGYTIGYVPPDRDGAYHRIKVDVQPQPSQKLNVRTRPGYFAASRISQQEPPLR* |
| Ga0062593_1010065832 | 3300004114 | Soil | RSGYTIGYVPPDRDGSYHRVRVQIDPADRGRLTIRTRPGYFAAGSPKP* |
| Ga0063455_1006078001 | 3300004153 | Soil | IGYVPPDRDGAYHRIKVDVQPQPSQKLNVRTRPGYFAASRISQQDRPLR* |
| Ga0062594_1008549451 | 3300005093 | Soil | REACQHIAREIRSGYTIGYVPPDRDGVFHHVRVDVMTPDKRKLAVRTRPGYFASREPTH* |
| Ga0062594_1020628032 | 3300005093 | Soil | AREIRSGYTLGYAPPDRDGIFHRIRVEVAPGDTRRLKIRTRPGYFAGGRSSQP* |
| Ga0066674_100072806 | 3300005166 | Soil | IGYVPPDRDGAYHRVRVQIEPSPPRRSTVRTRPGYFAAGRSSQP* |
| Ga0066676_110485161 | 3300005186 | Soil | YTIGYVPPDRDGAYHRVRVDIQSPDRRLTIRTRPGYFAAGRTTQP* |
| Ga0070658_100680481 | 3300005327 | Corn Rhizosphere | TIGYAPPDRDGSYHRVRIEIAQREGPKMIVRTRPGYFAAGSAASR* |
| Ga0070676_104935321 | 3300005328 | Miscanthus Rhizosphere | EIRSGYTIGYVPPDHDGAYHRVRVVLDAQPRKLNVRTRPGYFAAGRTAQP* |
| Ga0066388_1003021191 | 3300005332 | Tropical Forest Soil | REIRSGYTIGYVPPDRDGAFHRVRVDVATTGKQKLTVRTRSGYFAARQAMH* |
| Ga0066388_1076498912 | 3300005332 | Tropical Forest Soil | HIAREIRSGYTIGIVPPDRDGAFHRVRVEVAPGDRRRLTVRTRPGYFASRDTSSGQ* |
| Ga0066388_1087734852 | 3300005332 | Tropical Forest Soil | YTIGFVPPDRDGAYHNVRVILDARPRKLNVRTRPGYFAAGKTSER* |
| Ga0068868_1005572653 | 3300005338 | Miscanthus Rhizosphere | VQACLQIAREIRSGYTLGYAPPDRDGIFHRIRVEVAPGDTRRLKIRTRPGYFAGGRSSQP |
| Ga0070692_105427972 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | RIAREIRSGYTIGYVPPDRDGNYHRVRVDVQPPSSQKVNIRTRPGYFAAGRPAAPPQ* |
| Ga0070675_1022050311 | 3300005354 | Miscanthus Rhizosphere | IAIAREIRSGYTLGYIPPERDGRYHAVRVQVDSPDGRRLVVRTRPGYFAARAVTQ* |
| Ga0070673_1018579512 | 3300005364 | Switchgrass Rhizosphere | EIRSGYTIGYVPPDHDGTYHRVRVVLDARPRKLNVRTRPGYFASGRTAQP* |
| Ga0066682_107936021 | 3300005450 | Soil | GYTIGYVPPDRDGTYHRVKVEVRAPNGRRVSVRTRPGYVAASPETRR* |
| Ga0066687_104222592 | 3300005454 | Soil | RDIRAGYTIGYAPPDRDGHFHRVRVQIEPADPRHLDIRTRPGYFAAGPSALR* |
| Ga0070662_1012230832 | 3300005457 | Corn Rhizosphere | IRSGYTIGYVPPDHDGTYHRVRVVLDARPRKLNVRTRPGYFASGRTAQP* |
| Ga0070707_1012650362 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AGYTIGYAPPDRDGNFHRVRVVVEPADARHLDVRTRPGYFAAGPSTSR* |
| Ga0073909_105870412 | 3300005526 | Surface Soil | QIAHEIRSGYTLGYAPPDRDGVFHRIRVEVAPADTRRLKIRTRPGYFAGGRSSQP* |
| Ga0070735_104300281 | 3300005534 | Surface Soil | REIRSGYTIGYTPPARDGAFHRVRVVVQTTTSLNVRTRPGYFAGRGSER* |
| Ga0070684_1011960162 | 3300005535 | Corn Rhizosphere | IAREIRGGYTIGYVPPARDGAYHRVRVEIGSQADRRLNVRTRPGYFAAAAAPQP* |
| Ga0070697_1007192771 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | YAPPDRDGNFHRVRVQIEPADPRHLDIRTRPGYFAAGLSASR* |
| Ga0070697_1010856492 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | IRSGYTIGYVPPDHDGAFHRVRVEIQPGDRHLTLRTRPGYFAAGRMTSR* |
| Ga0066697_104463942 | 3300005540 | Soil | YTIGYVPPDRDGAYHRVKVEVRAPDGRRVSVRTRPGYVAASPETRP* |
| Ga0070695_1010188531 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | EIRAGYTLGYEPPDRDGAYHRVRVEVLPSPARRLNVRTRPGYFAAGRGTLTRSPQ* |
| Ga0070693_1006060371 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | RSGYTIGYVPPDHDGTYHRVRVVLDARPRKLNVRTRPGYFASGRTAQP* |
| Ga0070704_1007452281 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | IRSGYTIGYVPPDRDGSYHRVRVVVQPPASQKITVRTRPGYFAAGRATQPQ* |
| Ga0066704_104416791 | 3300005557 | Soil | IRTGYTIGYVPPDHDGAFHRVRVAIEPAGRRLTVRTRPGYFAAARPTDR* |
| Ga0068855_1022942902 | 3300005563 | Corn Rhizosphere | YAPPDRDGAYHRVRVEVAQNGGPKMIARTRPGYFAAGSEAPR* |
| Ga0066693_100749931 | 3300005566 | Soil | YTIGYVPPDRDGAYHRVRVVVDAPSRKLTVRTRPGYFASGRSTER* |
| Ga0068854_1011512591 | 3300005578 | Corn Rhizosphere | RSGYTIGYVPPDRDGAFHRVRVQVEADAGRKLIVRTRPGYFAAGVVTRR* |
| Ga0066706_103517063 | 3300005598 | Soil | ERIAREIRSGYTIGYVPPDRDGAYHRVRVQIEPSPPRRSTVRTRPGYFAAGRSSQP* |
| Ga0068859_1010408542 | 3300005617 | Switchgrass Rhizosphere | LRSGYTIGYVPPDRDGLFHRVRVVIEPEPRHRLDVRTRPGYFAARSTSPSSQP* |
| Ga0068859_1010817161 | 3300005617 | Switchgrass Rhizosphere | IAREIRGGYTIGYVPPARDGAYHRVKVEMAPSAARGLNVRTRPGYFAAGPPAHP* |
| Ga0068864_1012253071 | 3300005618 | Switchgrass Rhizosphere | IAREIRGGYTIGYAPPARDGAYHRVKVVVESPSRKLHVRTRPGYFAAAGTSQP* |
| Ga0066905_1016173191 | 3300005713 | Tropical Forest Soil | YTIGYVPPDRDGTFHRVRVTVGGQDVKVRTRPGYFAAGAPR* |
| Ga0068861_1001642061 | 3300005719 | Switchgrass Rhizosphere | YVPPDHDGAYHRVRVVLDAQPRKLNVRTRPGYFAAGRTAQP* |
| Ga0075288_10839992 | 3300005874 | Rice Paddy Soil | HIAREIRSVYTLGFAPPDRDGRYHRVRVAVDVPNGKHLSIRTRPGYFAATAAIAEPSR* |
| Ga0066696_110892102 | 3300006032 | Soil | CQHIAREIRSGYTIGYVPPDHDGAFHRVRVEVESADRRLTVRTRPGYFAAARTAQR* |
| Ga0066656_100575784 | 3300006034 | Soil | DTPARLMQACQHIAREIRSGYTIGYLPPDRDGAYHRVRVDVRPPDGRRISVRTRPGYFAASRVTRP* |
| Ga0066653_106281591 | 3300006791 | Soil | AREIRSGYTIGYAPPARDGAFHRIRVLLEPPDPRRLEVRTRPGYFAGR* |
| Ga0066660_112071081 | 3300006800 | Soil | SGYTLGYAPPDRDGTFHRVRVEIQPSDRHLSIRTRPGYFAAARMTER* |
| Ga0075428_1024773562 | 3300006844 | Populus Rhizosphere | TIGYVPPDRDGLFHRVRVVIEPATRGLDVRTRPGYFAARSAPPSSQP* |
| Ga0075421_1006705431 | 3300006845 | Populus Rhizosphere | HIAREIRSGYTIGYVPPDRDGNYHRVRVEVQPSPSQKMTVRTRPGYFAAGRTAQPE* |
| Ga0075433_102009843 | 3300006852 | Populus Rhizosphere | EIRSGYTIGYAPPDRDGYYHRVRVVVDAGDRRVQVRTRPGYFAGRNASER* |
| Ga0075433_102968313 | 3300006852 | Populus Rhizosphere | SGYTIGYTPPDRDGAYHRIRVVVDAPDRKLTIRTRPGYFAAGSRTQ* |
| Ga0075425_1004055381 | 3300006854 | Populus Rhizosphere | AREIRAGYTIGYAPPDRDGNFHRVRVVVEPADARHLDVRTRPGYFAAGPSTPR* |
| Ga0075425_1030421722 | 3300006854 | Populus Rhizosphere | YTIGYVPPDRDGAYHRVRVEASAADRRKLTVRTRPGYFAARQTSSQP* |
| Ga0075434_1025675292 | 3300006871 | Populus Rhizosphere | TIGYVPPDRDGAYHRVRVEASAADRRKLTVRTRPGYFAARQTSSQP* |
| Ga0075424_1003432881 | 3300006904 | Populus Rhizosphere | GYTLGYAPPDRDGAFHRIRVEVSPADARRLKVRTRPGYFAGGRSSRP* |
| Ga0075424_1004808553 | 3300006904 | Populus Rhizosphere | IAREIRSGYTIGYVPPDRDGAYHRVRVEASAADRRKLTVRTRPGYFAARQTSSQP* |
| Ga0105240_107257011 | 3300009093 | Corn Rhizosphere | SGYTIGYVPPDRDGAFHRVSVQVQAGAGRKLVVRTRPGYFAAGVGATP* |
| Ga0111539_104849513 | 3300009094 | Populus Rhizosphere | SGYTLGYAPPDRDGAFHRIRVEVAPADPRRLKIRTRPGYFAGGRSSQP* |
| Ga0105247_107470901 | 3300009101 | Switchgrass Rhizosphere | IGYVPPDRDGVYHRVRVDVQPAASQKLTVRTRPGYFAAERTSQRQ* |
| Ga0066709_1009667953 | 3300009137 | Grasslands Soil | AREIRNGYTIGYVPPDRDGAYHRVKVEVRVPDGRRVSVRTRPGYVAASPETRP* |
| Ga0066709_1014424601 | 3300009137 | Grasslands Soil | REIRSGYTVGYAPPDRDGTFHRVRVEIQPSDRHLSIRTRPGYFAAARMTER* |
| Ga0066709_1017880141 | 3300009137 | Grasslands Soil | EIRSGYTIGYTPPDRDGNYHRVRVVVETPNRKLTIRTRPGYFAAGSRTQN* |
| Ga0075423_117812351 | 3300009162 | Populus Rhizosphere | VQACRQIAREIRSGYTLGYAPPDRDGVFHRIRVEIAPAEGRRLNVRTRPGYFAAGRPSQP |
| Ga0105855_12368592 | 3300009649 | Permafrost Soil | AYHRVKVEIDRSAAQSSGRRLDVRTRPGYFAAAAAAQP* |
| Ga0126311_102836493 | 3300010045 | Serpentine Soil | AREIRSGYTIGYVPPDRDGAFHRVRVTVQGPGAKNLNVRTRPGYFAAGARR* |
| Ga0134065_103394762 | 3300010326 | Grasslands Soil | YTIGYVPPDRDGAYHRVRVQIEPSPPRRSTVRTRPGYFAAGRSSQP* |
| Ga0134127_131481891 | 3300010399 | Terrestrial Soil | IAREIRAGYTLGYEPPDRDGAYHRVRVEVLPSPARRLNVRTRPGYFAAGRGTLTRSPQ* |
| Ga0134122_104997673 | 3300010400 | Terrestrial Soil | RDGAYHRVRVEVLPSPARRFNVRTRPGYFAAGRGTLTPSPQ* |
| Ga0134121_101536591 | 3300010401 | Terrestrial Soil | TLGYAPPDRDGIFHRIRVEVAPGDTRRLKIRTRPGYFAGGRSSQP* |
| Ga0126356_108692222 | 3300010877 | Boreal Forest Soil | YTIGYVPPDHDGAFHRVRVAMQPAAKNLTLRTRPGYFAAPRATP* |
| Ga0150985_1082551742 | 3300012212 | Avena Fatua Rhizosphere | VLACERIAREIRSGYTIGYTPPAHDGAYHHVRVVVESPARKLRIRTRPGYFAGGS* |
| Ga0137387_103747231 | 3300012349 | Vadose Zone Soil | TIGYVPPDRDGAYHRVRVQIEPSPPRRSTVRTRPGYFAAGRSSQP* |
| Ga0137366_110258181 | 3300012354 | Vadose Zone Soil | RSGYTIGYTPPDRDGIFHRVRVQIEPSVRHLTVRTRPGYFAAGVQEPRTSSREP* |
| Ga0157347_10584882 | 3300012502 | Arabidopsis Rhizosphere | LVQACLQIAHEIRSGYTLGYAPPDRDGAFHRIRVEVASADPRRLKVRTRPGYFAGSRSSQP* |
| Ga0137394_116092941 | 3300012922 | Vadose Zone Soil | RDGDYHRVRVQIEPADPRRLTLRTRPGYFAAGSPARP* |
| Ga0137359_117129522 | 3300012923 | Vadose Zone Soil | RIARDIRSGYTIGFVPPDRDGNFHRIRVGIEPSDARHLNIRTRPGYFAAGRTTQP* |
| Ga0164301_113894281 | 3300012960 | Soil | IAREIRAGYTIGYVPPDRDGNYHRVRVTIDAPNARGLQIRTRPGYFAARNPTNGAR* |
| Ga0134077_105800602 | 3300012972 | Grasslands Soil | REIRSGYTIGYVPPDRDGAYHRVRVQIEPSPPRRSTVRTRPGYFAAGRSSQP* |
| Ga0134076_105003392 | 3300012976 | Grasslands Soil | CAQIAREIRSGYTIGYTPPDRDGAYHRVRVLVEAPDRKLNIRTRPGYFAAGSSPSGGPREP* |
| Ga0134085_105506952 | 3300015359 | Grasslands Soil | RSGYTIGYVPPDRDGLYHRVRVAIEPPIPHADVRTRPGYFAARAEKSTP* |
| Ga0132256_1020394982 | 3300015372 | Arabidopsis Rhizosphere | CQRIAEEIRSGYTIGYEPVRRDGAFHRIRVQVSHEGRRFDVRTRPGYFAAGSSLRP* |
| Ga0132257_1017378131 | 3300015373 | Arabidopsis Rhizosphere | ARELRSGYTIGYVPPDRDGQFHRVRVVIEPAMRGLDVRTRPGYFAARSATSSSQP* |
| Ga0132257_1025044521 | 3300015373 | Arabidopsis Rhizosphere | RRDVQRIAREIRSGYTIGYTPPVRDGAYHRVRVVIDSPDRKLRIRTRPGYFAANSPSS* |
| Ga0132255_1021210592 | 3300015374 | Arabidopsis Rhizosphere | YTIGYVPPDRDGLYHRIRVVIEPPLPHVDIRTRPGYFAARGTPKPSQP* |
| Ga0182032_108040952 | 3300016357 | Soil | YTIGYTPPDRDGAFHRVRVEVAPADGRKVEVRTRPGYFAANRTAEHE |
| Ga0134069_10300503 | 3300017654 | Grasslands Soil | GYTIGYVPPDRDGAYHRVRVQIEPSPPRRSTVRTRPGYFAAGRSSQP |
| Ga0066669_112833951 | 3300018482 | Grasslands Soil | EIRNGYTIGYVPPDRDGAYHRVRVVVDAPSRKLTVRTRPGYFASGRSTER |
| Ga0206353_120080211 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | GYTIGYAPPDRDGQYHRVRVEIDRGRGPKVSARTRPGYFAAAGSGAR |
| Ga0210382_100387484 | 3300021080 | Groundwater Sediment | GYTIGYVPPDRDGAYHRVRVQIEPADPRRLTLRTRPGYFAAGSPTRP |
| Ga0213853_102837502 | 3300021861 | Watersheds | TIGYVPPARDGAYHRVKVVVDSPARKLNVRTRPGYFAAAGTSRP |
| Ga0247799_10757632 | 3300023072 | Soil | LRSGYTIGYVPPDRDGLFHRVRVVIEPEPRHRLDVRTRPGYFAARSTSPSSQP |
| Ga0207695_113872141 | 3300025913 | Corn Rhizosphere | RIAREIRSGYTIGYVPPDRDGAFHRVSVQVQAGAGRKLVVRTRPGYFAAGVGATP |
| Ga0207657_1000384117 | 3300025919 | Corn Rhizosphere | PLLADCERIAREIRSGYTIGYAPPDRDGSYHRVRIEIAQREGPKMIVRTRPGYFAAGSAASR |
| Ga0207649_107002421 | 3300025920 | Corn Rhizosphere | RGGYTIGYVPPARDGAYHRVKVEMAPSAARGLNVRTRPGYFAAGPPAHP |
| Ga0207694_107616331 | 3300025924 | Corn Rhizosphere | YTIGYAPPDRDGSYHRVRIEIAQREGPKMIVRTRPGYFAAGSAASR |
| Ga0207687_108727621 | 3300025927 | Miscanthus Rhizosphere | AREIRGGYTIGYAPPARDGAYHRVKVVVESPSRKLHVRTRPGYFAAAGTSQP |
| Ga0207669_109883541 | 3300025937 | Miscanthus Rhizosphere | ELVQACLRIAHEIRSGYTLGYAPPDRDGAFHRIRVEVAPADRRRFNIRTRPGYFAAGRSSQP |
| Ga0207711_115202452 | 3300025941 | Switchgrass Rhizosphere | GYVPPARDGAYHRVKVEIDPRASRKLNIRTRPGYFAAGRPTQP |
| Ga0208415_10314701 | 3300025993 | Rice Paddy Soil | DHIAREIRSVYTLGFAPPDRDGRYHRVRVAVDVPNGKHLSIRTRPGYFAATAAIAEPSR |
| Ga0207703_122033253 | 3300026035 | Switchgrass Rhizosphere | GYTIGFVPPDRDGAFHRVRVEVQRGNGGKLSVRTRPGYFAASTSTVR |
| Ga0207708_112229792 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | AREIRSGYTIGYVPPDRDGSYHRVRVQIDSADRGRLTIRTRPGYFAAGSPTP |
| Ga0207708_119988701 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | SGYTLGYVPPDRDGLFHRVRVVVEPDAKLQIRTRPGYFAAASASGSRP |
| Ga0207676_105822733 | 3300026095 | Switchgrass Rhizosphere | GYTIGYVPPARDGAYHRVKVEMTPAISRGLTVRTRPGYFAAGPATHP |
| Ga0207676_113310532 | 3300026095 | Switchgrass Rhizosphere | IAREIRGGYTIGYAPPARDGAYHRVKVVVESPSRKLHVRTRPGYFAAAGTSQP |
| Ga0207675_1002628313 | 3300026118 | Switchgrass Rhizosphere | IGYVPPDHDGAYHRVRVVLDAQPRKLNVRTRPGYFAAGRTAQP |
| Ga0207675_1027337031 | 3300026118 | Switchgrass Rhizosphere | TIGYEPPERDGAYHRVRVEVMPSPARRLNVRTRPGYFAAGQGTLTRSPQP |
| Ga0209855_10127801 | 3300026220 | Permafrost Soil | APPARDGAYHRVKVEINPEPAPAAARRLNVRTRPGYFAAGRPAQP |
| Ga0209056_101388051 | 3300026538 | Soil | EIRSGYTIGYVPPDRDGAYHRVRVQIEPSPPRRSTVRTRPGYFAAGRSSQP |
| Ga0209069_107785682 | 3300027915 | Watersheds | MLAACERIAREIRQGYTIGFAPPDHDGRFHRVRVQVTAQGRSRVDVRTRPGYFAGGPQ |
| Ga0268265_123514151 | 3300028380 | Switchgrass Rhizosphere | TIGYVPPDRDGNYHRVRVEVQPSPSQKMNVRTRPGYFAAGRTSQPE |
| Ga0268264_107822773 | 3300028381 | Switchgrass Rhizosphere | REIRSGYTIGYTPPDRDGAFHRIRVEVAHDGKRKLTAKTRPGYFAAGSPTP |
| Ga0307305_103410651 | 3300028807 | Soil | RLMEVCRHIAREIRSGYTIGYVPPDRDGAYHRVRVELQSHGRGLSIRTRPGYFATNALTR |
| Ga0307497_102003471 | 3300031226 | Soil | LPRSPGELVQACLQIAHEIRSGYTLGYAPPDRDGVFHRIRVEIAPADTRRLKIRTRPGYFAGGRSSQP |
| Ga0318528_103282602 | 3300031561 | Soil | GYTIGYTPRDRDGAFHRVRVDVAPADGRKVEVRTRPGYFAANRTIEHE |
| Ga0310886_110707352 | 3300031562 | Soil | YTLAYVPPDRDGLYHRVRVEATGAGGRKLNVRTRPGYFAARETAQSASRPPGSKP |
| Ga0307473_114239472 | 3300031820 | Hardwood Forest Soil | PLLQACQHIAREIRSGYTIGYVPPDRDGAYHRVRVDVSTPDRRRVSVRTRPGYVAASPVTRR |
| Ga0307472_1010735172 | 3300032205 | Hardwood Forest Soil | YVPPDHDGVFHRVRVEIQPGDRHLTLRTRPGYFAAGRMTAR |
| Ga0307472_1026066482 | 3300032205 | Hardwood Forest Soil | TCSRIAHEIRNGYTIGYVPPDHDGAYHRVRVVVDARPRKVDVRTRPGYFASGRTTER |
| Ga0373958_0075228_589_756 | 3300034819 | Rhizosphere Soil | QIAHEIRSGYTLGYAPPNRDGVFHRIRVEVAPADPRRLKVRTRPGYFAGSRSSQP |
| ⦗Top⦘ |