| Basic Information | |
|---|---|
| Family ID | F074676 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 119 |
| Average Sequence Length | 49 residues |
| Representative Sequence | VRFLGLLALPGIWETASLLHGSLAVTALFTLGAALLGAWAIAVLREE |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 119 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 48.74 % |
| % of genes near scaffold ends (potentially truncated) | 18.49 % |
| % of genes from short scaffolds (< 2000 bps) | 82.35 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.68 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.790 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (19.328 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.101 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.00% β-sheet: 0.00% Coil/Unstructured: 48.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 119 Family Scaffolds |
|---|---|---|
| PF08543 | Phos_pyr_kin | 40.34 |
| PF00270 | DEAD | 17.65 |
| PF00085 | Thioredoxin | 7.56 |
| PF02110 | HK | 5.04 |
| PF00271 | Helicase_C | 4.20 |
| PF00586 | AIRS | 1.68 |
| PF03795 | YCII | 1.68 |
| PF00698 | Acyl_transf_1 | 0.84 |
| PF07992 | Pyr_redox_2 | 0.84 |
| PF09369 | MZB | 0.84 |
| PF09969 | DUF2203 | 0.84 |
| PF01329 | Pterin_4a | 0.84 |
| PF05016 | ParE_toxin | 0.84 |
| PF00498 | FHA | 0.84 |
| PF00005 | ABC_tran | 0.84 |
| PF00903 | Glyoxalase | 0.84 |
| COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
|---|---|---|---|
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 40.34 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 40.34 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 40.34 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 40.34 |
| COG0063 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domain | Nucleotide transport and metabolism [F] | 5.04 |
| COG2145 | Hydroxyethylthiazole kinase, sugar kinase family | Coenzyme transport and metabolism [H] | 5.04 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.68 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.84 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.79 % |
| Unclassified | root | N/A | 25.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002JV8ID | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300005166|Ga0066674_10427422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 609 | Open in IMG/M |
| 3300005167|Ga0066672_10079742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1956 | Open in IMG/M |
| 3300005167|Ga0066672_10158628 | Not Available | 1423 | Open in IMG/M |
| 3300005172|Ga0066683_10157308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1397 | Open in IMG/M |
| 3300005175|Ga0066673_10341558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
| 3300005176|Ga0066679_10149147 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300005179|Ga0066684_10056915 | All Organisms → cellular organisms → Bacteria | 2265 | Open in IMG/M |
| 3300005179|Ga0066684_10107775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1717 | Open in IMG/M |
| 3300005179|Ga0066684_10498767 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300005181|Ga0066678_10694451 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005187|Ga0066675_10497539 | Not Available | 911 | Open in IMG/M |
| 3300005336|Ga0070680_101321637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 624 | Open in IMG/M |
| 3300005434|Ga0070709_10739082 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300005445|Ga0070708_100759816 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300005445|Ga0070708_101756824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300005447|Ga0066689_10969079 | Not Available | 524 | Open in IMG/M |
| 3300005450|Ga0066682_10724910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 608 | Open in IMG/M |
| 3300005458|Ga0070681_10617637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 998 | Open in IMG/M |
| 3300005468|Ga0070707_101348848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 680 | Open in IMG/M |
| 3300005471|Ga0070698_100187125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2008 | Open in IMG/M |
| 3300005471|Ga0070698_100210699 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
| 3300005471|Ga0070698_100905935 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005518|Ga0070699_100311604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1413 | Open in IMG/M |
| 3300005518|Ga0070699_100724845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 909 | Open in IMG/M |
| 3300005537|Ga0070730_10051674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2964 | Open in IMG/M |
| 3300005538|Ga0070731_10524548 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005539|Ga0068853_100459767 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300005540|Ga0066697_10734235 | Not Available | 539 | Open in IMG/M |
| 3300005586|Ga0066691_10118443 | Not Available | 1501 | Open in IMG/M |
| 3300005598|Ga0066706_10368239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1142 | Open in IMG/M |
| 3300005893|Ga0075278_1004619 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300006028|Ga0070717_10150694 | All Organisms → cellular organisms → Bacteria | 2012 | Open in IMG/M |
| 3300006028|Ga0070717_10845171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
| 3300006794|Ga0066658_10195052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1067 | Open in IMG/M |
| 3300006796|Ga0066665_11608610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300006797|Ga0066659_10843613 | Not Available | 762 | Open in IMG/M |
| 3300006797|Ga0066659_11494488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 565 | Open in IMG/M |
| 3300006800|Ga0066660_10522872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 997 | Open in IMG/M |
| 3300009090|Ga0099827_10866619 | Not Available | 782 | Open in IMG/M |
| 3300009090|Ga0099827_11324392 | Not Available | 627 | Open in IMG/M |
| 3300009137|Ga0066709_100163101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2872 | Open in IMG/M |
| 3300009137|Ga0066709_103117390 | Not Available | 606 | Open in IMG/M |
| 3300009137|Ga0066709_103691532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300009518|Ga0116128_1017639 | All Organisms → cellular organisms → Bacteria | 2450 | Open in IMG/M |
| 3300009549|Ga0116137_1032880 | Not Available | 1807 | Open in IMG/M |
| 3300010335|Ga0134063_10560548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300010373|Ga0134128_12771242 | Not Available | 540 | Open in IMG/M |
| 3300012011|Ga0120152_1031846 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
| 3300012011|Ga0120152_1072744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1034 | Open in IMG/M |
| 3300012198|Ga0137364_10377664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1059 | Open in IMG/M |
| 3300012200|Ga0137382_10150096 | Not Available | 1579 | Open in IMG/M |
| 3300012200|Ga0137382_10233629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1271 | Open in IMG/M |
| 3300012211|Ga0137377_11153170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300012923|Ga0137359_10109635 | All Organisms → cellular organisms → Bacteria | 2441 | Open in IMG/M |
| 3300012955|Ga0164298_10088294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1610 | Open in IMG/M |
| 3300012960|Ga0164301_11522233 | Not Available | 552 | Open in IMG/M |
| 3300012977|Ga0134087_10388314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 677 | Open in IMG/M |
| 3300012984|Ga0164309_10633758 | Not Available | 839 | Open in IMG/M |
| 3300012988|Ga0164306_11504916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300013100|Ga0157373_10919562 | Not Available | 650 | Open in IMG/M |
| 3300013294|Ga0120150_1043777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 871 | Open in IMG/M |
| 3300017929|Ga0187849_1000058 | All Organisms → cellular organisms → Bacteria | 154846 | Open in IMG/M |
| 3300017959|Ga0187779_10000135 | All Organisms → cellular organisms → Bacteria | 55897 | Open in IMG/M |
| 3300017961|Ga0187778_10155956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1442 | Open in IMG/M |
| 3300017961|Ga0187778_10226166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1197 | Open in IMG/M |
| 3300017966|Ga0187776_10231483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1175 | Open in IMG/M |
| 3300017973|Ga0187780_10020598 | All Organisms → cellular organisms → Bacteria | 4731 | Open in IMG/M |
| 3300018001|Ga0187815_10153842 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300018025|Ga0187885_10005076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10411 | Open in IMG/M |
| 3300018060|Ga0187765_10352011 | Not Available | 897 | Open in IMG/M |
| 3300018060|Ga0187765_11166828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300018064|Ga0187773_10395420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300018433|Ga0066667_11275995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
| 3300018433|Ga0066667_12346039 | Not Available | 501 | Open in IMG/M |
| 3300018468|Ga0066662_13021634 | Not Available | 500 | Open in IMG/M |
| 3300018482|Ga0066669_12222284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300020070|Ga0206356_11123472 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300021080|Ga0210382_10261530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
| 3300021478|Ga0210402_11575425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300025495|Ga0207932_1036199 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300025664|Ga0208849_1000657 | All Organisms → cellular organisms → Bacteria | 29920 | Open in IMG/M |
| 3300025906|Ga0207699_11057792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300025915|Ga0207693_10416202 | Not Available | 1051 | Open in IMG/M |
| 3300025917|Ga0207660_11029387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 671 | Open in IMG/M |
| 3300025922|Ga0207646_11460400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300025929|Ga0207664_11745720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300026301|Ga0209238_1129295 | Not Available | 818 | Open in IMG/M |
| 3300026309|Ga0209055_1291290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300026530|Ga0209807_1194930 | Not Available | 719 | Open in IMG/M |
| 3300026547|Ga0209156_10033133 | All Organisms → cellular organisms → Bacteria | 2910 | Open in IMG/M |
| 3300026555|Ga0179593_1027255 | Not Available | 1795 | Open in IMG/M |
| 3300027432|Ga0209421_1117266 | Not Available | 547 | Open in IMG/M |
| 3300027857|Ga0209166_10090741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1715 | Open in IMG/M |
| 3300027869|Ga0209579_10322504 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300027905|Ga0209415_10775624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300028536|Ga0137415_10710955 | Not Available | 817 | Open in IMG/M |
| 3300028558|Ga0265326_10250422 | Not Available | 512 | Open in IMG/M |
| 3300028563|Ga0265319_1009458 | All Organisms → cellular organisms → Bacteria | 4148 | Open in IMG/M |
| 3300028563|Ga0265319_1139677 | Not Available | 752 | Open in IMG/M |
| 3300028654|Ga0265322_10007005 | All Organisms → cellular organisms → Bacteria | 3305 | Open in IMG/M |
| 3300028800|Ga0265338_10948804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300028807|Ga0307305_10111281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1265 | Open in IMG/M |
| 3300028824|Ga0307310_10617405 | Not Available | 553 | Open in IMG/M |
| 3300031152|Ga0307501_10209696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300031720|Ga0307469_10814540 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300031938|Ga0308175_100023073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5012 | Open in IMG/M |
| 3300031962|Ga0307479_10253216 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300031962|Ga0307479_10998033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
| 3300031962|Ga0307479_11662466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300032074|Ga0308173_10492685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1096 | Open in IMG/M |
| 3300032829|Ga0335070_10000364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 52090 | Open in IMG/M |
| 3300032892|Ga0335081_10212343 | All Organisms → cellular organisms → Bacteria | 2662 | Open in IMG/M |
| 3300032892|Ga0335081_11626682 | Not Available | 708 | Open in IMG/M |
| 3300032892|Ga0335081_11857995 | Not Available | 649 | Open in IMG/M |
| 3300033233|Ga0334722_10081742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2479 | Open in IMG/M |
| 3300033412|Ga0310810_10219584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2125 | Open in IMG/M |
| 3300033475|Ga0310811_10063168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4899 | Open in IMG/M |
| 3300033806|Ga0314865_207938 | Not Available | 526 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.56% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 4.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.36% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.36% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.68% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.68% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.68% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.84% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.84% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.84% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.84% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.84% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_12190620 | 2170459003 | Grass Soil | VRVFGLLALPGIWQTASLLRGSPAVTAVFTLGAALLGVWAIAVLREE |
| Ga0066674_104274222 | 3300005166 | Soil | MVQVRILMLLALLGIWKAASSVLEASLAVTALITLGAAVLGAWAIAVLREG* |
| Ga0066672_100797422 | 3300005167 | Soil | MGEVRILMLLALVGIWQATSSILEAPLAVTALVTLGAAALGAWAIAVLREG* |
| Ga0066672_101586282 | 3300005167 | Soil | MGQVRILMLLALLGIWETASSVLRAPLAVTALVTLGAAVLGAWAIAVLREE* |
| Ga0066683_101573082 | 3300005172 | Soil | VRLLASLGLVGIWHAAAVLGGPLAVTAAFTLGAAALGAWAIAVLRET* |
| Ga0066673_103415583 | 3300005175 | Soil | QVRVFGLLALPGIWQTASLLHGSPAVTAAFTLGAALLGVWAIAVIREE* |
| Ga0066679_101491471 | 3300005176 | Soil | MLLALLGIWETASSVLRASLAVTALVTLGAAVLGAWAIAVLREE* |
| Ga0066684_100569154 | 3300005179 | Soil | MGQVRILMLLAALGIWETASSVLQAPLAVTALVTLGAAALGAWAIAVLREG* |
| Ga0066684_101077752 | 3300005179 | Soil | VSSGRLSIIRQVRVFGLLALPGIWQTASLLHGSPAVTAAFTLGAALLGVWAIAVIREE* |
| Ga0066684_104987671 | 3300005179 | Soil | SPSWGEVRILMLLALVGIWQATSSILEAPLAVTALVTLGAAALGAWAIAVLREG* |
| Ga0066678_106944511 | 3300005181 | Soil | MGRMRILMLLALLGIWETASTVLEAPLAVTALITLGAAVLGAWAIAVLREG* |
| Ga0066675_104975391 | 3300005187 | Soil | MLLALVGIWQATSSILEAPLAVTALVTLGAAALGAWAIAVLREG* |
| Ga0070680_1013216373 | 3300005336 | Corn Rhizosphere | DRGSPVPSGSRPMMGQVRIVMLLALLGIWKAAASLLGAPLAVTALVTLGAAALGAWALAVLREG* |
| Ga0070709_107390823 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VRIVVLLGLLGIWQAASSLLAAPLVVTALVTVGAAALGAWAIAVLRTG* |
| Ga0070708_1007598163 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VWVRALGLLALPGIWQTASLLHGSPAVTAVFTLGATLLGVWAIVVLGEG* |
| Ga0070708_1017568242 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIRQVRALGLLALPGIWQTASLLHGSPAVTAAFTLGATLLGIWAIAVLREQ* |
| Ga0066689_109690791 | 3300005447 | Soil | VRILALLALLGIWETASSLLRAPLAVTALLTLGAAVLGAWAIAVLREE* |
| Ga0066682_107249101 | 3300005450 | Soil | EVRILMLLALVGIWQATSSILEAPLAVTALVTLGAAALGAWAIAVLREG* |
| Ga0070681_106176372 | 3300005458 | Corn Rhizosphere | MRLLGLLGLVGIWQAAGALFPASVAAAALFTLGAALLGAWAIAVLRE* |
| Ga0070707_1013488482 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLLALPGIWQTASLLHGSPAVTAAFTLGAALLGIWAIAVLRED* |
| Ga0070698_1001871253 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VRVLGLLALPGIWETASLLHGSLVVTALFTLGAAALGVWAFAALREQ* |
| Ga0070698_1002106992 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VWVRALGLLALPGIWQTASLLHGSPAVTAVFTLGAALLGVWAIVVLREG* |
| Ga0070698_1009059352 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VRALGLLALPGIWETASLLHGSLVVTALFTLGAAALGVWAFAALREQ* |
| Ga0070699_1003116043 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLLALPGIWQTASRLRGSPAVTAAFTLGAALLGIWAIAVLRED* |
| Ga0070699_1007248453 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MWQVRILMLLALLGIWEAASSVLQASVAVTALVTLGAAALGAWAIAVLREG* |
| Ga0070730_100516743 | 3300005537 | Surface Soil | VRTLGLLALPGIWQTATLLHGSPAVTAVFTLGAALLGVWAIAVLREG* |
| Ga0070731_105245482 | 3300005538 | Surface Soil | VRLLGLLALPGIWEAAALLRGSTLVTALCTLGAAALGLWALAVLRELQ* |
| Ga0068853_1004597672 | 3300005539 | Corn Rhizosphere | MRLLGLLGLVGIWQAAGALFPASVAAAAFFTLGAALLGAWAIAVLRE* |
| Ga0066697_107342351 | 3300005540 | Soil | MGRVRILMLLALLGIWETTSSIFEAPLAVTALVPLGAAALGAWAIAVLR |
| Ga0066691_101184432 | 3300005586 | Soil | MLLALLGIWETASSVLRAPLAVTALVTLGAAVLGAWAIAVLREE* |
| Ga0066706_103682391 | 3300005598 | Soil | LTGVRLLASLGLVGIWHAAAGLGGPLAVTAAFTLGAAALGAWAIAVLRET* |
| Ga0075278_10046192 | 3300005893 | Rice Paddy Soil | VRLLGLVGLVGIWQATDALLRSSVLVTALLTLGAALLGAWAIAVLRE* |
| Ga0070717_101506944 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRALGLLALPGIWQTASLLHGSPAVTAAFTLGATLLGIWAIAVLREQ* |
| Ga0070717_108451711 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PGIWETASLLHGSLVVTALFTLGAAALGVWAFAALREQ* |
| Ga0066658_101950522 | 3300006794 | Soil | MEQVRILMLLALLGIWETASSVLRAPLAVTALVTLGAAVLGAWAIAVLREE* |
| Ga0066665_116086102 | 3300006796 | Soil | MGRVRILMLLALLGIWETASSVLEAPLAVTALITLGAAALGAWAIAVLREG* |
| Ga0066659_108436132 | 3300006797 | Soil | MGQVRILMLLALLGIWETASSVLRAPLAVTALVTLGAAALGAWAIAVLREG* |
| Ga0066659_114944882 | 3300006797 | Soil | MVQVRILMLLALLGISKAASSVLEASLAVTALITLGAAALGAWAIAVLREG* |
| Ga0066660_105228722 | 3300006800 | Soil | MGEVRILMLLALLGIWETASSVLRAPLAVTALVTLGAAVLGAWAIAVLREE* |
| Ga0099827_108666192 | 3300009090 | Vadose Zone Soil | VRILALLALLGIWEAASSLLRAPLVVTALFTLGAALLGAWAIAVLREE* |
| Ga0099827_113243922 | 3300009090 | Vadose Zone Soil | VRVFGLLALPGIWQTATLLHGSPAVTAAFTLGAAVLGVWAIAVLREQ* |
| Ga0066709_1001631012 | 3300009137 | Grasslands Soil | VRLLASLGLVGIWHAAAGLGGPLAVTAAFTLGAAALGAWAIAVLRET* |
| Ga0066709_1031173901 | 3300009137 | Grasslands Soil | MGQMRILMLLALLGIWETASTVLEAPLAVTALITLGAAVLGAWAIAVLREG* |
| Ga0066709_1036915322 | 3300009137 | Grasslands Soil | VSSGRLSIIYQVRVFGLLALPGIWQTASLLHGSPAVTAAFTLGAALLGVWAIAVIREE* |
| Ga0116128_10176392 | 3300009518 | Peatland | VRALALLALPGIWQTASLLHGSTVVTALFTLGVALLGLWAIAVLREE* |
| Ga0116137_10328802 | 3300009549 | Peatland | ALLALPGIWQTASLLHGSTVVTALFTLGVALLGLWAIAVLREE* |
| Ga0134063_105605482 | 3300010335 | Grasslands Soil | MGEVRILMLLALLGIWEAASSVLRAPLAVTALVTLGAAALGAWAIAVLREG* |
| Ga0134128_127712421 | 3300010373 | Terrestrial Soil | MGQVRILMLLALLGIWEAASSVLKASVAVTALITLGAAAL |
| Ga0120152_10318463 | 3300012011 | Permafrost | MGQVRILMLLALLGIWEAASSVLNASLTVTALITLGAAALGAWAIAVLREG* |
| Ga0120152_10727443 | 3300012011 | Permafrost | VRILALLALLGIWETASSVLRAPLVVTALFTLGAALLGAWAIAVLREE* |
| Ga0137364_103776642 | 3300012198 | Vadose Zone Soil | MVQVRILMLLALLGIWKAASSVLEASLAVTALITLGAAALGAWAIAVLREG* |
| Ga0137382_101500962 | 3300012200 | Vadose Zone Soil | MERVRILMLLALLGIWETASSVLEAPLAVTALITLGAAVLGAWAIAVLREG* |
| Ga0137382_102336292 | 3300012200 | Vadose Zone Soil | MGRVRIVMLLALMGIWQATSSILEAPLAVTALVTLGAAALGAWAIAVLREG* |
| Ga0137377_111531703 | 3300012211 | Vadose Zone Soil | MGQVRILILLALLGIWEATSSVLEAPLAVTALITLGAAALGAWAIAVLREG* |
| Ga0137359_101096353 | 3300012923 | Vadose Zone Soil | VSSDYPPIIGQVRVFGLLALPGIWQTASLLHGSPAVTAVFTLGAALLGVWAIAVLREQ* |
| Ga0164298_100882943 | 3300012955 | Soil | VRIVVLLGLLGIWQAASSLLAAPLVVTALVTIGAAALGAWAIAVFRTG* |
| Ga0164301_115222332 | 3300012960 | Soil | MGQVRILMLLALLGIWEAASSVLKGSLAVTALITLGAAALGAWAIAVLREG* |
| Ga0134087_103883141 | 3300012977 | Grasslands Soil | MLLALVGIWQATSSILEAPLAVTALVTLGAAALAAWAIAVLREG* |
| Ga0164309_106337582 | 3300012984 | Soil | MWQVRILMLLALLGIWEAASSVLKASVAVTALVTLGAAALGAWAIAVLREG* |
| Ga0164306_115049162 | 3300012988 | Soil | VRIVVLLGLLGIWQAASSLLAAPLVVTALVTIGAAALGAWAIAVLRTG* |
| Ga0157373_109195623 | 3300013100 | Corn Rhizosphere | LGLLGLVGIWQAAGALFPASVAAAALFTLGAALLGAWAIAVLRE* |
| Ga0120150_10437773 | 3300013294 | Permafrost | MGQVRILILLALLGIWEAASSVLKASLAVTALITLGAAALGAWAIAVLREG* |
| Ga0187849_100005844 | 3300017929 | Peatland | VRALALLALPGIWQTASLLHGSTVVTALFTLGVALLGLWAIAVLREE |
| Ga0187779_1000013549 | 3300017959 | Tropical Peatland | VRFLGLLALPGLWETASLLHGSLVVTALFTLGAALLGAWAIAVLREE |
| Ga0187778_101559562 | 3300017961 | Tropical Peatland | VRFLGLLALPGIWETASLLHRSPAVTALFTLGAALLGAWAIAVLREG |
| Ga0187778_102261661 | 3300017961 | Tropical Peatland | VLLALPGIWETASLLHGSVAVTAVFTLGAALLGAWAIAVLREG |
| Ga0187776_102314832 | 3300017966 | Tropical Peatland | VRFFGLLALPGIWETASLLHGSVAVTALFTLGAALLGAWAIAVLREE |
| Ga0187780_100205983 | 3300017973 | Tropical Peatland | VRFLGLLALPGIWETASLLHGSPAVTALFTLGAALLGAWAIAVLREG |
| Ga0187815_101538422 | 3300018001 | Freshwater Sediment | VRFLGLLALPGIWETASLLHGSLAVTALFTLGAALLGAWAIAVLREE |
| Ga0187885_100050762 | 3300018025 | Peatland | VRALALLGLPGIWQTASLLHGSTVVTALFTLGATLLGLWAIAVLREE |
| Ga0187765_103520112 | 3300018060 | Tropical Peatland | VRFLALLALPGIWQAASLLHGSVAVTAVFTLGAALLGAWAIAVLREE |
| Ga0187765_111668281 | 3300018060 | Tropical Peatland | VRFLALLALPGIWQAASLLHGSVAVTALFTLGAALLGAWAIAVLREE |
| Ga0187773_103954202 | 3300018064 | Tropical Peatland | VQVRFLSLLALPGIWQTASLLRGSVAVTALFTLGAALLGMWALAVLRER |
| Ga0066667_112759952 | 3300018433 | Grasslands Soil | MGEVRILMLLALVGIWQAASSLLEAPLAITALVTLAAAVLGAWAIAVLREG |
| Ga0066667_123460392 | 3300018433 | Grasslands Soil | MLLALLGIWETASSVLRAPLAVTALVTLGAAVLGAWAIAVLREE |
| Ga0066662_130216342 | 3300018468 | Grasslands Soil | MGEVRILMLLALVGIWQATSSILEAPLAVTALVTLGAAALGAWAIAVQREG |
| Ga0066669_122222841 | 3300018482 | Grasslands Soil | MLLALVGIWQATSSILEAPLAVTALVTLGAAALGAWAIAVLREG |
| Ga0206356_111234722 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLGLLGLVGIWQAAGALFPASVAAAALFTLGAALLGAWAIAVLRE |
| Ga0210382_102615303 | 3300021080 | Groundwater Sediment | MVQVRILMLLALLGIWKAASSVLEASLAVTALITLGAAALGAWAIAVLREG |
| Ga0210402_115754252 | 3300021478 | Soil | VRLLASLGLVGIWQTASLLHGPPLVTAALTLGAAALAAWAIAVLRDE |
| Ga0207932_10361993 | 3300025495 | Arctic Peat Soil | VRLLALLALPGIWQTASLLRGSVAVTAAFTGGAALLGAWALAV |
| Ga0208849_100065727 | 3300025664 | Arctic Peat Soil | VRLLGLLALPGIWQTATLLRGSVAVTALFTLGAALLGAWALAVLREE |
| Ga0207699_110577923 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VRIVVLLGLLGIWQAASSLLAAPLVVTALVTIGAAALGAWAIAVLRTG |
| Ga0207693_104162022 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VRIVVLLGLLGIWQAASSLLAAPLVVTALVTIGAAALGAWAIAVLREG |
| Ga0207660_110293873 | 3300025917 | Corn Rhizosphere | MMGQVRIVMLLALLGIWKAAASLLGAPLAVTALVTLGAAALGAWALAVLREG |
| Ga0207646_114604002 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VWVRALGLLALPGIWQTASLLHGSPAVTAVFTLGATLLGVWAIVVLREG |
| Ga0207664_117457201 | 3300025929 | Agricultural Soil | VLLGLLGIWQAASSLLAAPLVVTALVTVGAAALGAWAIAVLRTG |
| Ga0209238_11292952 | 3300026301 | Grasslands Soil | VRILMLLALLGIWETASSVLRAPLAVTALVTLGAAVLGAWAIAVLREE |
| Ga0209055_12912902 | 3300026309 | Soil | MGEVRILMLLALVGIWQATSSILEAPLAVTALVTLGAAALGAWAIAVLREG |
| Ga0209807_11949302 | 3300026530 | Soil | MGEVRILMLLALVGIWQATSSILEAPLAVTALVTLGAAVLGAWAIAVLREE |
| Ga0209156_100331335 | 3300026547 | Soil | MGQVRILMLLALLGIWETASSVLRAPLAVTALVTLGAAVLGA |
| Ga0179593_10272553 | 3300026555 | Vadose Zone Soil | MGQVRILMLLALLGIWEAASSVLKASPAVTALITLGAAALGAWAIAVLREG |
| Ga0209421_11172662 | 3300027432 | Forest Soil | MIEEVRFVGLATLPGIWETASLLRGSFAVTGTLTICAALLGV |
| Ga0209166_100907413 | 3300027857 | Surface Soil | VRTLGLLALPGIWQTATLLHGSPAVTAVFTLGAALLGVWAIAVLREG |
| Ga0209579_103225042 | 3300027869 | Surface Soil | VRLLGLLALPGIWEAAALLRGSTLVTALCTLGAAALGLWALAVLRELQ |
| Ga0209415_107756242 | 3300027905 | Peatlands Soil | VRFLGLLALPGIWETASLLHGSLAVTALFTLGAALLGVWAIAVLREE |
| Ga0137415_107109551 | 3300028536 | Vadose Zone Soil | MGQVRILMLLALLGIWEAASSVLKASPAVTALITLGAAALGAW |
| Ga0265326_102504222 | 3300028558 | Rhizosphere | VRFAGLATLPGIWETASLLRGSFVVTGTLTLCAALLGVWALAVLR |
| Ga0265319_10094581 | 3300028563 | Rhizosphere | MIGQVRFAGLATLPGIWETASLLRGSFAVTGTLTLCAALLGVWAIAVLREG |
| Ga0265319_11396772 | 3300028563 | Rhizosphere | VRFAGLATLPGIWETASLLRGSFVVTGTLTLCAALLGVWALAVLREG |
| Ga0265322_100070052 | 3300028654 | Rhizosphere | MIGEVRLLALLALPGIWETASLLRGSVAVTAAFTLGAALLGVWAIAVLREE |
| Ga0265338_109488042 | 3300028800 | Rhizosphere | EVRLLALLALPGIWQTASLLRGSISVTAAFTLGAALLGVWAIAVLREG |
| Ga0307305_101112811 | 3300028807 | Soil | VRILTLLALLGIWKAASSVLEASLAVTALITLGAAALGAWAIAVLREG |
| Ga0307310_106174051 | 3300028824 | Soil | MGQVRILMFLALLGIWEAASSVLEASLAVTALITLGAAALGAWAIAVLREG |
| Ga0307501_102096962 | 3300031152 | Soil | MGRVRILMLLALLGIWETASSVLEAPLAVTALITLGAAALGAWAIAVLREG |
| Ga0307469_108145402 | 3300031720 | Hardwood Forest Soil | VLLVALVGLVGIWQTASLLHGSLLVTAVFTLGAAALGLWAVTVLRDE |
| Ga0308175_1000230731 | 3300031938 | Soil | GSRPIMGQVRIVMLLALLGIWKAAASLLGAPLAVTALVTLGAAALGAWALAVLREG |
| Ga0307479_102532163 | 3300031962 | Hardwood Forest Soil | VRALGLLALPGIWETASLLHGSLVVTALFTLGAAALGVWAFAALREQ |
| Ga0307479_109980332 | 3300031962 | Hardwood Forest Soil | VRVLGLLALPGIWQTASLLHGPVVVTVLFTLGAAALGGWAFAVLREE |
| Ga0307479_116624662 | 3300031962 | Hardwood Forest Soil | VSSDYPPIIRQVRALGLVALPGIWQTASLLHGSPAVTAVFTLGAALLGVWALAVIRE |
| Ga0308173_104926853 | 3300032074 | Soil | MIGQVRVVMLLGLLGIWEAASSLLAAPLAVTALVTLGAAALGAWALAVLREG |
| Ga0335070_100003642 | 3300032829 | Soil | VRFLGLLALPGIWQTASLLHGSVAVTALFTLGAALLGAWAIAVLREE |
| Ga0335081_102123434 | 3300032892 | Soil | VEVRLLGLLALPGIWQTASLLQGSVAVTALFTLGAALLGAWAIAVLREQ |
| Ga0335081_116266822 | 3300032892 | Soil | VRFLGLLALPGIWETASLLHGSVAVTALFTLGAALLGAWAIAVLREE |
| Ga0335081_118579952 | 3300032892 | Soil | ALPALAGIWETASLLHGSVAVTAAFTLGAALLGAWAIAVLREQ |
| Ga0334722_100817423 | 3300033233 | Sediment | MFGLIALPGIWQTASLLHGSPAVTAVFTLGAAALGVWAIAVLHEQ |
| Ga0310810_102195841 | 3300033412 | Soil | DRGGPVPSGSRPIMGQVRIVMLLALLGIWKAAASLLGAPLAVTALVTLGAAALGAWALAVLREG |
| Ga0310811_100631685 | 3300033475 | Soil | MGQVRIVMLLALLGIWKAAASLLGAPLAVTALVTLGAAALGAWALAVLREG |
| Ga0314865_207938_394_522 | 3300033806 | Peatland | LLALPGIWESASLLRGSIAVTALFTLGAALLGAWAIAVLREG |
| ⦗Top⦘ |